sfrp-1, Pmo_009874 (mRNA) Phagocata morgani

Overview
Namesfrp-1
Unique NamePmo_009874
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1068
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of sfrp-1 vs. uniprot
Match: gi|61216791|sp|Q863H1|SFRP2_CANFA (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; Flags: Precursor [Canis lupus familiaris])

HSP 1 Score: 148.288 bits (373), Expect = 7.03551e-40
Identity = 91/290 (31.38%), Postives = 143/290 (49.31%), Query Frame = 1
Query:   67 IFYLQIACFLGD-----WQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSCV-KSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
+ L C LG + Q Y C IP NL LC + Y+ M LPN + HE ++E ++ + WI LV CH D KKFLCSL+APVC+ ++ + + PC LC+ VK+ C P M FGF WP+++EC FP N LCI P+T K C +C K+ + C ++ ++ K++ IT + II L KS+ + + S+ L+ +W LQC C E + +L+M + G+ ++ + +W++ +F+ +RK
Sbjct: 10 LLVLASHCCLGSARGLFFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKLGGELVITSVKRWQKGQREFKRISRSIRKL 292
BLAST of sfrp-1 vs. uniprot
Match: gi|61216828|sp|Q96HF1|SFRP2_HUMAN (RecName: Full=Secreted frizzled-related protein 2; Short=FRP-2; Short=sFRP-2; AltName: Full=Secreted apoptosis-related protein 1; Short=SARP-1; Flags: Precursor)

HSP 1 Score: 147.902 bits (372), Expect = 8.74885e-40
Identity = 91/291 (31.27%), Postives = 143/291 (49.14%), Query Frame = 1
Query:   67 IFYLQIACFLGD------WQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSCV-KSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
+ +L C LG + Q Y C IP NL LC + Y+ M LPN + HE ++E ++ + WI LV CH D KKFLCSL+APVC+ ++ + + PC LC+ VK+ C P M FGF WP+++EC FP N LCI P+T K C +C K+ + C ++ ++ K++ IT + II L KS+ + + S+ L+ +W LQC C E + +L+M G+ ++ + +W++ +F+ +RK
Sbjct: 10 LLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. uniprot
Match: gi|341942099|sp|Q8C4U3|SFRP1_MOUSE (RecName: Full=Secreted frizzled-related protein 1; Short=sFRP-1; Flags: Precursor)

HSP 1 Score: 148.288 bits (373), Expect = 9.0419e-40
Identity = 93/287 (32.40%), Postives = 140/287 (48.78%), Query Frame = 1
Query:   73 YLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI----PSTIHKDKK-----CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYI--------------IDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLR 864
Y+ +G +Q + QC IP +L LC NVGYK+M+LPN ++HE + E Q + W+ L+N NCH + FLCSL+APVC+ + + PC+ LC +V++SC P M+ FGF WP +++C FP G +CI P+T K C C E + C S +R KI+ + KK+NG I + R + F N + C C +L L +LIM VK Q ++ I KW ++N +F+N + ++
Sbjct: 36 YVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEG--DVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEV--KKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGA--------DCPCHQL----DNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMK 302
BLAST of sfrp-1 vs. uniprot
Match: gi|61216765|sp|P97299|SFRP2_MOUSE (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; AltName: Full=Protein SDF5; AltName: Full=Secreted apoptosis-related protein 1; Short=SARP-1; Flags: Precursor)

HSP 1 Score: 147.902 bits (372), Expect = 9.79771e-40
Identity = 85/267 (31.84%), Postives = 136/267 (50.94%), Query Frame = 1
Query:  121 GYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSC-VKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
Y C IP NL LC + Y+ M LPN + HE ++E ++ + WI LV CH D KKFLCSL+APVC+ ++ + + PC LC+ VK+ C P M FGF WP+++EC FP N LCI P+T K C +C K+ + C ++ ++ K++ IT + II L KS+ + + S+ L+ +W LQC C ++ + +L+M G+ ++ + +W++ +F+ +RK
Sbjct: 34 SYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. uniprot
Match: gi|61216861|sp|Q9XSC1|SFRP5_BOVIN (RecName: Full=Secreted frizzled-related protein 5; Short=sFRP-5; Flags: Precursor)

HSP 1 Score: 148.288 bits (373), Expect = 1.01291e-39
Identity = 82/256 (32.03%), Postives = 134/256 (52.34%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI-------PSTIHKDKK-CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQ------CNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVL 861
QC IP +L LC VGYKRM LPN ++HE L E Q + W+ L+ CH D + FLCSL+APVC+ + + PC+ LC +V+ C P M+ +GF WP ++ C FP N LCI P+T K C C S + + + C S+ V++ +I+ I + + +I +K + LK + + + ++ L C C +L +L G +L+M V GQ ++ + +W ++N + + ++ +
Sbjct: 50 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKRLVLHMKNSAGCPCPQL----DSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFM 296
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001274 (Asxlregen_comp63361_c0_seq1|m.13574|m.6037)

HSP 1 Score: 383.645 bits (984), Expect = 2.20379e-131
Identity = 181/309 (58.58%), Postives = 238/309 (77.02%), Query Frame = 1
Query:   67 IFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIPSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNI-VKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYAKMKNRNKASNKTK 990
+F + F+GDWQ FQ+GY+ +QCY+IPDN TLC NVGY+ M+LPNYIQHE +EE QHSKVW+GLVN+ CH DIKKF+CSLYAPVCI N + QKVPPC+ELC++VKESCLPSMK++GF+WP IM+CS FP +NSLCIP T+ KKC C+K ASYEV+AN+FCLS IVIR KI+RI N I L +KS+FLKFQ+N SQ++L++ L+CNCT LKF+ +ALKG+W+IM I + +VNFI+KWKR+ +F++S+ +++ FG+ +C+ LP DG S+ +RY AY KM N+ K SN+ K
Sbjct: 13 LFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLP---DG-ISLRERYAAYLKMNNQLKYSNERK 317
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15040524 (dd_smedV4_8832_0_1|m.39951|m.18186)

HSP 1 Score: 186.037 bits (471), Expect = 6.24371e-55
Identity = 103/273 (37.73%), Postives = 158/273 (57.88%), Query Frame = 1
Query:  100 DWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIPST-----------IHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELC 885
+W GYS+ +C++IP+ LC N+GY +MILPN++QHE ++E + S W + CH D ++FLCSLYAPVC+ N ++K+ PCKELCLSVK++C P+M FG++WP I+ C FP LCI T + K CRS +A + + +C S VIR KI R+ + ++ Y++ L +KS+ +K I + C C + +N KG+WL+M + G+ + +TKWK++N DF+ I L+KF ++C
Sbjct: 27 EWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAA---FINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDN-IRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKIC 295
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15030883 (SmedSxlregen_c55322_g1_i1|m.6956|m.30359)

HSP 1 Score: 153.68 bits (387), Expect = 1.96156e-42
Identity = 101/312 (32.37%), Postives = 147/312 (47.12%), Query Frame = 1
Query:   91 FLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY--KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIP------------------------STIHKD-------KKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQS--NQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELCR-----LNLPNN 906
F D++ N QCY N TLC G +++ ++ S +WI L+++ CH D++KFLC++YAP+C+ + +V PC+ELC SVKE CLP +K++GFEWP+I++C FP + CI TI D K C C + E++ FC ++VIR KI I K I L KS + S ++L +QC C+ L+ KGKWL+ +I GQ IV F+TKW+R+ FR+ L K C+ LN+ NN
Sbjct: 17 FSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNN 328
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001054 (Asxlregen_comp62015_c0_seq1|m.11130|m.22104)

HSP 1 Score: 92.8189 bits (229), Expect = 1.33917e-20
Identity = 47/125 (37.60%), Postives = 67/125 (53.60%), Query Frame = 1
Query:  148 IPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIPSTIHKDKKCRS 522
IP +++C +GY +PN + H LEE + + LV NC ED++ FLCS+YAP+C+ N ++P C+ LC+S +E C M +GF+WP M C P L KD K RS
Sbjct: 36 IPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWP-NRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACL------RKDNKTRS 153
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15005581 (SmedAsxldir_c106676_g1_i1|m.77561|m.15397)

HSP 1 Score: 88.1965 bits (217), Expect = 5.84325e-19
Identity = 47/132 (35.61%), Postives = 71/132 (53.79%), Query Frame = 1
Query:   91 FLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI 486
F+ + + + Y+ C KI + C + Y+ I PN++ H +E ++ L+ CH ++ FLCSLY PVC K +PPC+ LCL +K+ C P +K F F+WP M C L+P N+LCI
Sbjct: 23 FINNIRAVNDPYNQPNCEKI--KVPACQGLLYQMTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVCTIMKK--ALPPCRSLCLQIKKECEPILKKFYFKWPQSMSCDLYP--ENNLCI 148
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|48475052|ref|NP_003004.1| (secreted frizzled-related protein 2 precursor [Homo sapiens])

HSP 1 Score: 147.902 bits (372), Expect = 3.30189e-40
Identity = 91/291 (31.27%), Postives = 143/291 (49.14%), Query Frame = 1
Query:   67 IFYLQIACFLGD------WQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSCV-KSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
+ +L C LG + Q Y C IP NL LC + Y+ M LPN + HE ++E ++ + WI LV CH D KKFLCSL+APVC+ ++ + + PC LC+ VK+ C P M FGF WP+++EC FP N LCI P+T K C +C K+ + C ++ ++ K++ IT + II L KS+ + + S+ L+ +W LQC C E + +L+M G+ ++ + +W++ +F+ +RK
Sbjct: 10 LLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|56117838|ref|NP_003003.3| (secreted frizzled-related protein 1 precursor [Homo sapiens])

HSP 1 Score: 146.747 bits (369), Expect = 1.25506e-39
Identity = 93/286 (32.52%), Postives = 139/286 (48.60%), Query Frame = 1
Query:   73 YLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI----PSTIHKDKK-----CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNG------YIIDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELC 885
Y+ +G +Q + QC IP +L LC NVGYK+M+LPN ++HE + E Q + W+ L+N NCH + FLCSL+APVC+ + + PC+ LC +V++SC P M+ FGF WP +++C FP G +CI P+ K C C E + C S +R KI+ + KK+NG + K + L+ C C +L L +LIM VK Q ++ I KW ++N +F+ N ++K N C
Sbjct: 36 YVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEG--DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEV--KKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQL----DNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFK---NFMKKMKNHEC 306
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|188528609|ref|NP_003006.2| (secreted frizzled-related protein 5 precursor [Homo sapiens])

HSP 1 Score: 140.969 bits (354), Expect = 1.9995e-37
Identity = 82/259 (31.66%), Postives = 135/259 (52.12%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI-------PSTIHKDKK-CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQ------CNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
QC IP +L LC VGYKRM LPN ++HE L E Q + W+ L+ CH D + FLCSL+APVC+ + + PC+ LC +V+ C P M+ +GF WP ++ C FP N LCI P+T K C C S + + + C S+ V++ +I+ I + + +I +K + LK + + + ++ L C C +L +L G +L+M V GQ ++ + +W ++N + + ++ + +
Sbjct: 52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQL----DSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 301
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 89.7373 bits (221), Expect = 9.13677e-19
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  124 YSAEQCYKIPDN-------LTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
Y+ E+ +PD+ + LC ++ Y + I+PN + H E+ + LV C ++K FLCS+YAPVC + Q +PPC+ LC ++ C M FGF+WP+ ++C FP G LC+
Sbjct: 102 YNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC--TVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCV 228
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503833|ref|NP_003498.1| (frizzled-7 precursor [Homo sapiens])

HSP 1 Score: 85.8853 bits (211), Expect = 1.70608e-17
Identity = 43/129 (33.33%), Postives = 66/129 (51.16%), Query Frame = 1
Query:  124 YSAEQCYKIPDN-------LTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
Y E+ +PD+ + LC ++ Y + ILPN + H E+ + LV C +++ FLCS+YAPVC + Q +PPC+ LC ++ C M FGF+WP + C FP G +C+
Sbjct: 35 YHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC--TVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICV 161
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 81.2629 bits (199), Expect = 1.52607e-16
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  151 PDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
P +++C N+ Y I+PN I H EE + LV C +D++ FLCSLY PVC + + +PPC+ LC S + C MK + F WP +ECS FP G LC+
Sbjct: 55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC--TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 81.2629 bits (199), Expect = 1.74253e-16
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  151 PDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
P +++C N+ Y I+PN I H EE + LV C +D++ FLCSLY PVC + + +PPC+ LC S + C MK + F WP +ECS FP G LC+
Sbjct: 55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC--TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|24640330|ref|NP_511068.2| (frizzled 4, isoform A [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 2.95475e-16
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRN--SLCI--PSTIHKDKK 513
QC I + +C +GY +PN + +E + + + L+ +C +K FLC+ Y P+C + + PC+ LC SV+ C P ++ FGF WP ++C FP N ++C+ P +H+ ++
Sbjct: 45 QCETI--RIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQ 172
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|45551429|ref|NP_727170.2| (frizzled 4, isoform B [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 2.95475e-16
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRN--SLCI--PSTIHKDKK 513
QC I + +C +GY +PN + +E + + + L+ +C +K FLC+ Y P+C + + PC+ LC SV+ C P ++ FGF WP ++C FP N ++C+ P +H+ ++
Sbjct: 45 QCETI--RIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQ 172
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 73.559 bits (179), Expect = 6.3321e-14
Identity = 33/102 (32.35%), Postives = 51/102 (50.00%), Query Frame = 1
Query:  157 NLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP 462
+ +C +GY PN + HE +E + LV C D+K FLCS+Y P+C+ + + +P C+ +C + C P M+ + FEWP M C P
Sbjct: 68 TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP 168
The following BLAST results are available for this feature:
BLAST of sfrp-1 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|61216791|sp|Q863H1|SFRP2_CANFA7.035510e-4031.38RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216828|sp|Q96HF1|SFRP2_HUMAN8.748850e-4031.27RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|341942099|sp|Q8C4U3|SFRP1_MOUSE9.041900e-4032.40RecName: Full=Secreted frizzled-related protein 1;... [more]
gi|61216765|sp|P97299|SFRP2_MOUSE9.797710e-4031.84RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216861|sp|Q9XSC1|SFRP5_BOVIN1.012910e-3932.03RecName: Full=Secreted frizzled-related protein 5;... [more]
back to top
BLAST of sfrp-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150012742.203790e-13158.58Asxlregen_comp63361_c0_seq1|m.13574|m.6037[more]
SMU150405246.243710e-5537.73dd_smedV4_8832_0_1|m.39951|m.18186[more]
SMU150308831.961560e-4232.37SmedSxlregen_c55322_g1_i1|m.6956|m.30359[more]
SMU150010541.339170e-2037.60Asxlregen_comp62015_c0_seq1|m.11130|m.22104[more]
SMU150055815.843250e-1935.61SmedAsxldir_c106676_g1_i1|m.77561|m.15397[more]
back to top
BLAST of sfrp-1 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|48475052|ref|NP_003004.1|3.301890e-4031.27secreted frizzled-related protein 2 precursor [Hom... [more]
gi|56117838|ref|NP_003003.3|1.255060e-3932.52secreted frizzled-related protein 1 precursor [Hom... [more]
gi|188528609|ref|NP_003006.2|1.999500e-3731.66secreted frizzled-related protein 5 precursor [Hom... [more]
gi|4503825|ref|NP_003496.1|9.136770e-1934.11frizzled-1 [Homo sapiens][more]
gi|4503833|ref|NP_003498.1|1.706080e-1733.33frizzled-7 precursor [Homo sapiens][more]
back to top
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|442632294|ref|NP_001261836.1|1.526070e-1638.94frizzled, isoform C [Drosophila melanogaster][more]
gi|17864440|ref|NP_524812.1|1.742530e-1638.94frizzled, isoform A [Drosophila melanogaster][more]
gi|24640330|ref|NP_511068.2|2.954750e-1629.23frizzled 4, isoform A [Drosophila melanogaster][more]
gi|45551429|ref|NP_727170.2|2.954750e-1629.23frizzled 4, isoform B [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|6.332100e-1432.35frizzled 2, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_009874 ID=Pmo_009874|Name=sfrp-1|organism=Phagocata morgani|type=mRNA|length=1068bp
AAAATATTTACACTAGAAATTTAAAACTTGAAAAAAATGTGTATTTTGTC
TTTATTTTTTTTTAATATTTTTTATTTACAAATCGCTTGCTTCCTGGGCG
ACTGGCAGCAATTTCAAAATGGTTATTCTGCAGAACAATGTTACAAAATT
CCAGATAACTTAACGCTTTGTCTCAATGTTGGATATAAAAGAATGATTTT
GCCAAATTATATTCAACACGAATATTTAGAAGAAACTGTTCAGCATTCAA
AAGTATGGATTGGTTTAGTGAATTCAAACTGCCATGAAGATATAAAAAAA
TTTTTATGTTCTTTGTACGCTCCTGTTTGTATATATAATATGAAAATTCA
AAAGGTGCCTCCATGTAAAGAATTATGTTTAAGTGTGAAAGAATCATGCT
TACCAAGTATGAAATTGTTTGGATTTGAATGGCCTAATATTATGGAATGT
TCTTTATTTCCAAGTGGAAGAAATTCACTCTGTATTCCCAGTACAATCCA
CAAAGATAAAAAATGTCGATCATGTGTCAAATCAGCTTCTTATGAAGTCA
TGGCTAACAAATTCTGTTTATCGAATATCGTTATAAGAGGAAAAATCAGA
CGCATCACAGCAAAGAAAGACAATGGATATATAATTGATTTGAGTCAAAA
ATCTCGATTTTTAAAGTTTCAATCTAATCAAAGTCAAAGTTCATTACAAA
TTTGGCTACAGTGTAATTGCACGAAATTAAAATTTGAAAATAAAGCTTTA
AAAGGAAAATGGTTGATAATGGTAAATATTGTCAAAGGTCAGCCAATTGT
AAATTTTATCACCAAATGGAAAAGAAGGAATATAGATTTTAGGAACAGTA
TAAATGTTTTACGGAAATTTGGAAACGAATTATGCCGATTGAATCTTCCA
AACAATTCAGACGGACGAACAAGTATGCTTAAAAGATATTTAGCATATGC
TAAAATGAAGAATCGAAACAAGGCTTCAAATAAAACGAAGTGACATTCAA
TAAAATTGATAACATAACTTTATTAGATTCAAGATTAATTTCATCGATCA
GTTTTATCCTGCTTCACG

Design Primers for sfrp-1

back to top

protein sequence

>Pmo_009874-protein ID=Pmo_009874-protein|Name=sfrp-1|organism=Phagocata morgani|type=polypeptide|length=319bp
MCILSLFFFNIFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY
KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIY
NMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI
PSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYII
DLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVK
GQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKR
YLAYAKMKNRNKASNKTK*
back to top

coding sequence

>Pmo_009874.37.993 ID=Pmo_009874.37.993|Name=Pmo_009874.37.993|organism=Phagocata morgani|type=CDS|length=957bp
ATGTGTATTTTGTCTTTATTTTTTTTTAATATTTTTTATTTACAAATCGC
TTGCTTCCTGGGCGACTGGCAGCAATTTCAAAATGGTTATTCTGCAGAAC
AATGTTACAAAATTCCAGATAACTTAACGCTTTGTCTCAATGTTGGATAT
AAAAGAATGATTTTGCCAAATTATATTCAACACGAATATTTAGAAGAAAC
TGTTCAGCATTCAAAAGTATGGATTGGTTTAGTGAATTCAAACTGCCATG
AAGATATAAAAAAATTTTTATGTTCTTTGTACGCTCCTGTTTGTATATAT
AATATGAAAATTCAAAAGGTGCCTCCATGTAAAGAATTATGTTTAAGTGT
GAAAGAATCATGCTTACCAAGTATGAAATTGTTTGGATTTGAATGGCCTA
ATATTATGGAATGTTCTTTATTTCCAAGTGGAAGAAATTCACTCTGTATT
CCCAGTACAATCCACAAAGATAAAAAATGTCGATCATGTGTCAAATCAGC
TTCTTATGAAGTCATGGCTAACAAATTCTGTTTATCGAATATCGTTATAA
GAGGAAAAATCAGACGCATCACAGCAAAGAAAGACAATGGATATATAATT
GATTTGAGTCAAAAATCTCGATTTTTAAAGTTTCAATCTAATCAAAGTCA
AAGTTCATTACAAATTTGGCTACAGTGTAATTGCACGAAATTAAAATTTG
AAAATAAAGCTTTAAAAGGAAAATGGTTGATAATGGTAAATATTGTCAAA
GGTCAGCCAATTGTAAATTTTATCACCAAATGGAAAAGAAGGAATATAGA
TTTTAGGAACAGTATAAATGTTTTACGGAAATTTGGAAACGAATTATGCC
GATTGAATCTTCCAAACAATTCAGACGGACGAACAAGTATGCTTAAAAGA
TATTTAGCATATGCTAAAATGAAGAATCGAAACAAGGCTTCAAATAAAAC
GAAGTGA
back to top
Gene Groups
sfrp-1 is similar in sequence to the genes of this group: GG7656
Gene NameGene ID
SMU15001274SMU15001274
sfrp-1Ddo_009225
sfrp-1Gsp_013592
sfrp-1Pgr_015361
sfrp-1Pmo_009874

Gene Group Protein Sequences

>SMU15001274

MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNV
GYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVC
ISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSL
CIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAI
QIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQI
DSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERY
AAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS*
>Ddo_009225 sfrp-1
LIAFSNDIGIRGMITILPLGLLLSLFSNGNCFIGDWESFRSGYTTDQCYK
VPENFSMCHNVGYNKMVLPNFIQHEYMEEAIAHSRVWLSLVKSQCHLDVR
KFLCSLYAPVCITNKRIQKVPPCRELCIIVKEACLPSMKMYGFNWPEIMK
CSKFPPVQNALCIPKTTVKKKNCELCVKNAPYEVIANRFCLSPIVIRAKI
KRIIPKESGFQIVLHQKSKFLKFQSNSSRDSVNLWLKCNCLNLKFQQRAL
RGRWIIMARIVEDRFVVNFISKWKKKKEEFKNSIRIIQKFGNVVCKSKLK
DGISLQERYVAYMKMNNKTNYQNQLKQQTRKFKKRKQNQQRRIP*
>Gsp_013592 sfrp-1
MVIIFRFTFILFVFNVNCFIGDWQSFQSGYTIDQCYHIPDNFSLCRNVGY
NRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCIS
SQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI
PRTLVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQI
VLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQ
NEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAY
LKMNNKIKYSNNNNKSKQQTRRSKKPINTRSSSIS*
>Pgr_015361 sfrp-1
LFLFFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMIL
PNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQ
KVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVS
KGKKCRPCVKSSSYEVMANKFCLSNIVIRAKIKRIVKEGNNGFKIELGQK
TGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVV
NFITKWKRKNTNFRYSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYA
KMNNITQFKNRKNRNNNSKENKKPKKSWTTQKKNAYKN*
>Pmo_009874 sfrp-1
MCILSLFFFNIFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY
KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIY
NMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI
PSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYII
DLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVK
GQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKR
YLAYAKMKNRNKASNKTK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.