pc2, Pmo_008419 (mRNA) Phagocata morgani

Overview
Namepc2
Unique NamePmo_008419
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1901
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of pc2 vs. uniprot
Match: gi|13124785|sp|P16519|NEC2_HUMAN (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 675.626 bits (1742), Expect = 0
Identity = 361/589 (61.29%), Postives = 423/589 (71.82%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P VK A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + TDAC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +G+L EW
Sbjct: 29 VFTNHFLVELHKGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEW 587
BLAST of pc2 vs. uniprot
Match: gi|75061998|sp|Q5REC2|NEC2_PONAB (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 675.241 bits (1741), Expect = 0
Identity = 361/589 (61.29%), Postives = 423/589 (71.82%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P VK A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + TDAC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +G+L EW
Sbjct: 29 VFTNHFLVELHKGGEDEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEW 587
BLAST of pc2 vs. uniprot
Match: gi|128003|sp|P21661|NEC2_MOUSE (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 673.7 bits (1737), Expect = 0
Identity = 359/590 (60.85%), Postives = 423/590 (71.69%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEWV 1901
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P +K A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN ++ WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + T+AC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +GLL EW
Sbjct: 28 VFTNHFLVELHKDGEEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGLLKEWT 587
BLAST of pc2 vs. uniprot
Match: gi|128004|sp|P28841|NEC2_RAT (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 672.544 bits (1734), Expect = 0
Identity = 358/590 (60.68%), Postives = 423/590 (71.69%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEWV 1901
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P +K A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN ++ WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + T+AC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +GLL EW
Sbjct: 28 VFTNHFLVELHKDGEEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGLLKEWT 587
BLAST of pc2 vs. uniprot
Match: gi|417351|sp|Q03333|NEC2_PIG (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 672.159 bits (1733), Expect = 0
Identity = 359/589 (60.95%), Postives = 423/589 (71.82%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P VK+A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+S+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + TDAC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +G + EW
Sbjct: 29 VFTNHFLVELHKGGEEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGAVKEW 587
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15019018 (SmedSxldir_c108536_g2_i2|m.79117|m.1373)

HSP 1 Score: 1002.28 bits (2590), Expect = 0
Identity = 496/596 (83.22%), Postives = 541/596 (90.77%), Query Frame = 3
Query:  120 LTATIHSNQWHVHLQQPG-EHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQ-RVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEWV 1901
+ I +NQWHVHL P + A +VA ETGFS+LRNHL SPNEF+F H+ +P S+V S S H L+AH LVK A Q+EGFLR+KRGYKPIK+Q RVPLP+I+KKGIP + + K +KLPTDPLF KEWYIRNTGQA+GVKDLDLNVLSAW+QGITGKG+TTAIMDDGIDYLH DLS+NYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNG+CGVG+AY+S++AGLRMLDQPYMTDLIEAAAMS+DRDNI IYSASWGPTDDGRTVDGPRNETMRAIV+GVNKGR GKG+IYVWASGDGGA+DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAA VFALALEAN +GWRDMQHL+VLTSKRNHLHDRD RHNWTINGAGLEFNHLFGYGVLDAGDMVRVAK W NVPERFHCIAG+I+++ RFN++KAL+LEIDTDACKSD HRVNYLEHVQAFV+VK+SRRGDITMFLTSPMGTTSMILS R KD DS RGFTKWPFMTTHTWGE PRGKW+LTVMFDT+D L QG+ SEWV
Sbjct: 15 VCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWV 610
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15036165 (SmedSxlregen_c89995_g1_i1|m.42695|m.12874)

HSP 1 Score: 376.711 bits (966), Expect = 9.72481e-121
Identity = 217/493 (44.02%), Postives = 309/493 (62.68%), Query Frame = 3
Query:  447 LKERSNKESIK--LPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRY-----TDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGAS-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDA-GVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHC------IAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVM-FDTEDALI 1877
L+++ K +K + DP + K WY+ K+ +N++SAW +G G+ + +I+DDGI+ H DL NY+ +SYD SND P PRY T N HGTRCAG+++A +N +CGVG+AY + + G+RMLD ++D +E+ ++ +I IYSASWGP DDG+TVDGP A DG+ KGRNG G+I+VWASG+GG + D+CNCDGY S++T+ +N+ + G+ Y E CSSTLA T+S+G S+D + T D+ +CT HSGTSA+AP AA + ALAL AN + WRDMQHL V+T+++ +L D W+ N AG E++H FG+G++DAG MV +A W VPE+ C G I+ K N VL I TDAC + RV YLEHVQA +++++++RG++ ++L SP +TS +L++R D S GF WPFM+ H WGE G W+LT+ +D E LI
Sbjct: 92 LEQQFAKVRVKRHIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGE-VSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSG----SMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVD----WSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYAN----EVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASA-GFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLI 565
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15033125 (SmedSxlregen_c82367_g1_i3|m.22377|m.8734)

HSP 1 Score: 347.051 bits (889), Expect = 1.50212e-104
Identity = 228/584 (39.04%), Postives = 335/584 (57.36%), Query Frame = 3
Query:  135 HSNQWHVHLQQPGEHV-AEQVASETGFSLLRNHLRSPNEF-IFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGG-ASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAG----EINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRG---FTKWPFMTTHTWGETPRGKWRLTV 1850
H N++ + Q PG + A+ VA + GF +L++ +R ++F +F +R ++ H L V A Q R KR + IK+ + +DPLF+K+WY+ + K +D+NV AW G TGKG+T +I+DDGIDY H DL NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVGIAYNS++ +RMLD +TD +EA A+S + +I IYS SWGP D+G+ V+GP A G+ GRNG GNIYVWASG+GG SD C CDGYA+S++TISI+S + + Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AA + AL +EAN + WRD+Q++ VLTS + D N+ +NGA + ++L+G+G++D+G +VR+ ++W +P C +I+ K +F + L + TD C + +VNY+EHV ++ + +RGD+ + L SP GT S IL R D RG F WP M+ WGE G+W + +
Sbjct: 27 HINEYVI--QCPGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYRYDNSENSKF---HLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQIKF--------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFID----GNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVK----LSVKTDGCPGKN--KVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEI 557
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15002657 (Asxlregen_comp67843_c0_seq3|m.34885|m.51170)

HSP 1 Score: 347.051 bits (889), Expect = 1.64894e-104
Identity = 226/582 (38.83%), Postives = 334/582 (57.39%), Query Frame = 3
Query:  135 HSNQWHVHLQQPGEHV-AEQVASETGFSLLRNHLRSPNEF-IFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGG-ASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAG----EINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKD-SDSIRGFTKWPFMTTHTWGETPRGKWRLTV 1850
H N++ + Q PG + A+ VA + GF +L++ +R ++F +F +R ++ H L V A Q R KR + IK+ + +DPLF+K+WY+ + K +D+NV AW G TGKG+T +I+DDGIDY H DL NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVGIAYNS++ +RMLD +TD +EA A+S + +I IYS SWGP D+G+ V+GP A G+ GRNG GNIYVWASG+GG SD C CDGYA+S++TISI+S + + Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AA + AL +EAN + WRD+Q++ VLTS + D N+ +NGA + ++L+G+G++D+G +VR+ ++W +P C +I+ K +F + L + TD C + +VNY+EHV ++ + +RGD+ + L SP GT S IL R D + F WP M+ WGE G+W + +
Sbjct: 27 HINEYVI--QCPGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYRYDNSENSKF---HLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQIKF--------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFID----GNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVK----LSVKTDGCPGKN--KVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPHDFARGPSTFDIWPLMSVQFWGEKASGEWSVEI 557
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15000885 (Asxlregen_comp60502_c0_seq1|m.9253|m.45850)

HSP 1 Score: 322.013 bits (824), Expect = 5.49982e-100
Identity = 214/582 (36.77%), Postives = 312/582 (53.61%), Query Frame = 3
Query:  120 LTATIHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHM-NLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGA-SDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFS-NGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDT--DACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTV 1850
LT + +W V ++ GE A+++A + GF L N F F + S+ NL H + R+KR K + I RL+ R ++ +++ DP + EWY+ ++ K D+ V W ITG+G+ AI+DDG+++ H DL NY+ SS D + ND P P T N HGTRCA EI+ +N +CGVGIAYN ++ G+RMLD P + +IEA ++ + ++I IYS+SWGP DDG+T++ P + G GRNGKGNI+VWASG+GG D C+CDGY +S++ IS+NS T+D + + E C ST+ +T+S + ++ +SL A D+ G+CT HSGTSA+AP A+ +FAL LE N + WRD++HL TS+ N + + G W N AG N FG+G+L+A MV+ A+ W NVP C + KS IS L I + CK +V ++E + + + RG + + L SP G + +L+ R D S G WPF + H WGE P GKW + V
Sbjct: 33 LTQAEYQWEWAVKIED-GETAAKEIADDFGFEYLGIIGNLDNMFHFRKESSKNGRFKRSVKSATRNLSKHSKISLVIHQRILHRQKRDSKITDH-------MIHHNIIKRLQHR--RKVLEMFNDPKWPDEWYLFDSRFNSDQKSYDMRVTPVWYMNITGRGVKVAILDDGLEHTHPDLIDNYDPFSSTDLNDNDDDPSPDLTPGTSNEHGTRCASEIAMSANNKICGVGIAYNCKIGGIRMLDGP-VNGIIEAKSLGFNNNHIDIYSSSWGPLDDGKTMEQPSKLVQEVLRRGALSGRNGKGNIFVWASGNGGLYQDSCSCDGYVSSLYVISVNSITDDNKFPYFAEKCPSTMCATYSASSESKYSLIAA----DVKGKCTKKHSGTSASAPYASGIFALVLEMNPNLTWRDIKHLIAWTSEYNWIKNNLG---WKKNAAGFWVNEKFGFGLLNAYKMVKKAQNWKNVPPMTTC---RVKVKSSKKISNKLPATIIAYGNHCK----EKVAFIESIIILMNITYEVRGALLIKLQSPYGMNTTLLTTRNLDK-SKDGIINWPFHSVHNWGENPTGKWVVYV 588
BLAST of pc2 vs. RefSeq Human
Match: gi|320118926|ref|NP_001188457.1| (neuroendocrine convertase 2 isoform 3 [Homo sapiens])

HSP 1 Score: 675.626 bits (1742), Expect = 0
Identity = 361/590 (61.19%), Postives = 423/590 (71.69%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEWV 1901
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P VK A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + TDAC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +G+L EW
Sbjct: 10 VFTNHFLVELHKGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWT 569
BLAST of pc2 vs. RefSeq Human
Match: gi|20336244|ref|NP_002585.2| (neuroendocrine convertase 2 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 675.626 bits (1742), Expect = 0
Identity = 361/589 (61.29%), Postives = 423/589 (71.82%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
+ +N + V L + GE A QVA+E GF + R + + F H L A SL H L P VK A Q EGF RKKRGY+ I N+ I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + TDAC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +G+L EW
Sbjct: 29 VFTNHFLVELHKGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDI-----------------------NEIDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEW 587
BLAST of pc2 vs. RefSeq Human
Match: gi|320118928|ref|NP_001188458.1| (neuroendocrine convertase 2 isoform 2 preproprotein [Homo sapiens])

HSP 1 Score: 659.062 bits (1699), Expect = 0
Identity = 349/589 (59.25%), Postives = 410/589 (69.61%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRSPNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
+ +N + V L + GE A QVA+E GF + + VK A Q EGF RKKRGY+ I + + DPLF K+WY+ NTGQA+G LDLNV AW G TGKG+T IMDDGIDYLH DL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AYNS+VAG+RMLDQP+MTD+IEA+++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LHD H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + LVL + TDAC+ +N V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +D DS GF KWPFMTTHTWGE RG W L + F A +G+L EW
Sbjct: 29 VFTNHFLVELHKGGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYRDINEIDINM------------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDE--VHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEW 552
BLAST of pc2 vs. RefSeq Human
Match: gi|4505579|ref|NP_002560.1| (furin preproprotein [Homo sapiens])

HSP 1 Score: 406.371 bits (1043), Expect = 9.27068e-130
Identity = 229/484 (47.31%), Postives = 311/484 (64.26%), Query Frame = 3
Query:  450 KERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGAS-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
K R+ ++ + PTDP F ++WY+ GV DLNV +AW+QG TG GI +I+DDGI+ H DL+ NY+ +S+D + DP P PRYT N HGTRCAGE++A +NGVCGVG+AYN+++ G+RMLD +TD +EA ++ + ++IHIYSASWGP DDG+TVDGP A GV++GR G G+I+VWASG+GG D CNCDGY S++T+SI+SAT G Y E+CSSTLA+T+S+G + + T DL +CT H+GTSA+AP AA + AL LEAN + WRDMQHL V TSK HL+ D W NG G + +H +GYG+LDAG MV +A+ W V + CI + + +I K L + AC + NH + LEH QA +T+ +RRGD+ + L SPMGT S +L+ R D S GF W FMTTH+W E P G+W L + +T +A G L+++
Sbjct: 102 KRRTKRDVYQEPTDPKFPQQWYL------SGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNAND----WATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPK--DIGKRLEVRKTVTACLGEPNH-ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDY-SADGFNDWAFMTTHSWDEDPSGEWVLEIE-NTSEANNYGTLTKF 566
BLAST of pc2 vs. RefSeq Human
Match: gi|577019578|ref|NP_001276752.1| (furin preproprotein [Homo sapiens])

HSP 1 Score: 406.371 bits (1043), Expect = 9.27068e-130
Identity = 229/484 (47.31%), Postives = 311/484 (64.26%), Query Frame = 3
Query:  450 KERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGAS-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
K R+ ++ + PTDP F ++WY+ GV DLNV +AW+QG TG GI +I+DDGI+ H DL+ NY+ +S+D + DP P PRYT N HGTRCAGE++A +NGVCGVG+AYN+++ G+RMLD +TD +EA ++ + ++IHIYSASWGP DDG+TVDGP A GV++GR G G+I+VWASG+GG D CNCDGY S++T+SI+SAT G Y E+CSSTLA+T+S+G + + T DL +CT H+GTSA+AP AA + AL LEAN + WRDMQHL V TSK HL+ D W NG G + +H +GYG+LDAG MV +A+ W V + CI + + +I K L + AC + NH + LEH QA +T+ +RRGD+ + L SPMGT S +L+ R D S GF W FMTTH+W E P G+W L + +T +A G L+++
Sbjct: 102 KRRTKRDVYQEPTDPKFPQQWYL------SGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNAND----WATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPK--DIGKRLEVRKTVTACLGEPNH-ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDY-SADGFNDWAFMTTHSWDEDPSGEWVLEIE-NTSEANNYGTLTKF 566
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|17136192|ref|NP_477318.1| (amontillado [Drosophila melanogaster])

HSP 1 Score: 690.263 bits (1780), Expect = 0
Identity = 363/573 (63.35%), Postives = 426/573 (74.35%), Query Frame = 3
Query:  183 AEQVASETGFSLLRNHLRSP-NEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFNISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQGLLSEW 1898
A VA + GF L + + +E+ F HR LP A + SL+H L +HP V A Q GF R KRG +P +P+I G+ LK + PTDP F +WY++NTGQ G LDLNV +AW+QGITGK +TTAIMDDG+DY+H DL NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNG+CGVG+AY+S++AG+RMLDQPYMTDLIEA +M H+ IHIYSASWGPTDDG+TVDGPRN TMRAIV GVN+GRNG GNIYVWASGDGG DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG + GV T DLYG+CT HSGTSAAAPEAA VFALALEAN ++ WRD+QHL+VLTSKRN L D R +WT+NG GLEFNHLFG+GVLDAG MV ++K W +VP R+HC AGE+ Q + ++L EI TDACK D VNYLEHVQA ++ ASRRGD+ +FLTSPMGT SMILSRR D D GFTKWPFMTTH+WGE P+G W+L F++ G L EW
Sbjct: 57 AHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA------VPAI--HGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGTDT-EVNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQTR-HGNLLEW 617
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|281360987|ref|NP_001162774.1| (furin 2, isoform I [Drosophila melanogaster])

HSP 1 Score: 406.371 bits (1043), Expect = 2.27473e-124
Identity = 255/602 (42.36%), Postives = 363/602 (60.30%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRS-PNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKR--GYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGA-SDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFN--ISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQ-GLLSEW 1898
I++N++ V++ G+ +A+ +A++ GF + R + S N ++F H + S +S H L + VK Q +R+KR Y+ + + SI R++ R P DPLF+++WY+ N G +G LD+NV AW +G TGKG+ +I+DDGI H DL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVG+AYN+ + G+RMLD + D++EA A+S + +I IYSASWGP DDG TVDGP RA + GV GR GKG+I+VWASG+GG +D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AA + ALALEAN E+ WRDMQ+L V TS+ L +G WT+NG +++H FGYG++DAG MV +A+ W +VP + C + E N+ + + L +D + C N V YLEHVQ +T++ RG++ + LTSPMGTTS +L R +D F WPF++ H WGE G+W L V+ + Q G+LS+W
Sbjct: 238 IYTNEFAVNIPA-GKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYK----SISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYL-NGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSRPAPLEKENG---WTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTIN-EVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVK-SNFDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKW 818
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642484|ref|NP_727963.1| (furin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 403.29 bits (1035), Expect = 3.28029e-123
Identity = 259/624 (41.51%), Postives = 365/624 (58.49%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRS-PNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKR--------GYKPIKRQRV-------PLP-------SIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI--RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGA-SDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFN--ISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQ-GLLSEW 1898
I++N++ V++ G+ +A+ +A++ GF + R + S N ++F H + S +S H L + VK Q +R+KR Y P R P P SI R++ R P DPLF+++WY+ +N G +G LD+NV AW +G TGKG+ +I+DDGI H DL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVG+AYN+ + G+RMLD + D++EA A+S + +I IYSASWGP DDG TVDGP RA + GV GR GKG+I+VWASG+GG +D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AA + ALALEAN E+ WRDMQ+L V TS+ L +G WT+NG +++H FGYG++DAG MV +A+ W +VP + C + E N+ + + L +D + C N V YLEHVQ +T++ RG++ + LTSPMGTTS +L R +D F WPF++ H WGE G+W L V+ + Q G+LS+W
Sbjct: 238 IYTNEFAVNIPA-GKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSRPAPLEKENG---WTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTIN-EVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVK-SNFDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKW 845
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642486|ref|NP_727964.1| (furin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 403.29 bits (1035), Expect = 3.28029e-123
Identity = 259/624 (41.51%), Postives = 365/624 (58.49%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRS-PNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKR--------GYKPIKRQRV-------PLP-------SIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI--RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGA-SDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFN--ISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQ-GLLSEW 1898
I++N++ V++ G+ +A+ +A++ GF + R + S N ++F H + S +S H L + VK Q +R+KR Y P R P P SI R++ R P DPLF+++WY+ +N G +G LD+NV AW +G TGKG+ +I+DDGI H DL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVG+AYN+ + G+RMLD + D++EA A+S + +I IYSASWGP DDG TVDGP RA + GV GR GKG+I+VWASG+GG +D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AA + ALALEAN E+ WRDMQ+L V TS+ L +G WT+NG +++H FGYG++DAG MV +A+ W +VP + C + E N+ + + L +D + C N V YLEHVQ +T++ RG++ + LTSPMGTTS +L R +D F WPF++ H WGE G+W L V+ + Q G+LS+W
Sbjct: 238 IYTNEFAVNIPA-GKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSRPAPLEKENG---WTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTIN-EVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVK-SNFDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKW 845
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642488|ref|NP_727965.1| (furin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 403.29 bits (1035), Expect = 3.28029e-123
Identity = 259/624 (41.51%), Postives = 365/624 (58.49%), Query Frame = 3
Query:  132 IHSNQWHVHLQQPGEHVAEQVASETGFSLLRNHLRS-PNEFIFTHRXXXXXXXXXXXXHHMNLVAHPLVKQATQMEGFLRKKR--------GYKPIKRQRV-------PLP-------SIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI--RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYNSQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPRNETMRAIVDGVNKGRNGKGNIYVWASGDGGA-SDDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSXXXXXXXXXXXXXXXXNGEMGWRDMQHLSVLTSKRNHLHDRDGRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRFN--ISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTEDALIQ-GLLSEW 1898
I++N++ V++ G+ +A+ +A++ GF + R + S N ++F H + S +S H L + VK Q +R+KR Y P R P P SI R++ R P DPLF+++WY+ +N G +G LD+NV AW +G TGKG+ +I+DDGI H DL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVG+AYN+ + G+RMLD + D++EA A+S + +I IYSASWGP DDG TVDGP RA + GV GR GKG+I+VWASG+GG +D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AA + ALALEAN E+ WRDMQ+L V TS+ L +G WT+NG +++H FGYG++DAG MV +A+ W +VP + C + E N+ + + L +D + C N V YLEHVQ +T++ RG++ + LTSPMGTTS +L R +D F WPF++ H WGE G+W L V+ + Q G+LS+W
Sbjct: 238 IYTNEFAVNIPA-GKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSRPAPLEKENG---WTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTIN-EVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVK-SNFDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKW 845
The following BLAST results are available for this feature:
BLAST of pc2 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|13124785|sp|P16519|NEC2_HUMAN0.000000e+061.29RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|75061998|sp|Q5REC2|NEC2_PONAB0.000000e+061.29RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128003|sp|P21661|NEC2_MOUSE0.000000e+060.85RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128004|sp|P28841|NEC2_RAT0.000000e+060.68RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|417351|sp|Q03333|NEC2_PIG0.000000e+060.95RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
back to top
BLAST of pc2 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150190180.000000e+083.22SmedSxldir_c108536_g2_i2|m.79117|m.1373[more]
SMU150361659.724810e-12144.02SmedSxlregen_c89995_g1_i1|m.42695|m.12874[more]
SMU150331251.502120e-10439.04SmedSxlregen_c82367_g1_i3|m.22377|m.8734[more]
SMU150026571.648940e-10438.83Asxlregen_comp67843_c0_seq3|m.34885|m.51170[more]
SMU150008855.499820e-10036.77Asxlregen_comp60502_c0_seq1|m.9253|m.45850[more]
back to top
BLAST of pc2 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|320118926|ref|NP_001188457.1|0.000000e+061.19neuroendocrine convertase 2 isoform 3 [Homo sapien... [more]
gi|20336244|ref|NP_002585.2|0.000000e+061.29neuroendocrine convertase 2 isoform 1 preproprotei... [more]
gi|320118928|ref|NP_001188458.1|0.000000e+059.25neuroendocrine convertase 2 isoform 2 preproprotei... [more]
gi|4505579|ref|NP_002560.1|9.270680e-13047.31furin preproprotein [Homo sapiens][more]
gi|577019578|ref|NP_001276752.1|9.270680e-13047.31furin preproprotein [Homo sapiens][more]
back to top
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136192|ref|NP_477318.1|0.000000e+063.35amontillado [Drosophila melanogaster][more]
gi|281360987|ref|NP_001162774.1|2.274730e-12442.36furin 2, isoform I [Drosophila melanogaster][more]
gi|24642484|ref|NP_727963.1|3.280290e-12341.51furin 2, isoform A [Drosophila melanogaster][more]
gi|24642486|ref|NP_727964.1|3.280290e-12341.51furin 2, isoform B [Drosophila melanogaster][more]
gi|24642488|ref|NP_727965.1|3.280290e-12341.51furin 2, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_008419 ID=Pmo_008419|Name=pc2|organism=Phagocata morgani|type=mRNA|length=1901bp
GAGGCAAGGAAGAGAATTTGAGAGTCCTTTTTATAGATTGAGTGACATTT
TGGGAATTCACTTTTTAGATGCGCGTTGCAATATTAGTGTCCGTTATTGT
GGTGCTACTTAGCCATCGATTGACCGCTACGATCCATAGCAATCAGTGGC
ACGTGCACCTCCAACAGCCGGGGGAACATGTCGCCGAGCAGGTGGCCAGT
GAAACGGGATTCTCTCTCCTTAGGAATCATCTCCGATCGCCGAATGAATT
TATATTCACACACAGAGCGCTGCCTCCAGCGAGCGCGGTCGCCAGTCTGA
GTCATCACATGAACCTCGTTGCGCACCCTTTGGTGAAGCAAGCCACGCAA
ATGGAAGGCTTCCTTCGCAAGAAGCGAGGCTACAAGCCGATAAAGAGACA
GCGAGTTCCTTTACCGAGTATAGACAAGAAGGGTATTCCAGACAGACTGA
AGGAACGCTCTAACAAAGAGAGTATAAAGCTGCCAACCGATCCATTATTC
GAGAAGGAATGGTATATTCGGAATACGGGCCAGGCTGAAGGAGTGAAGGA
CCTTGATCTAAATGTGCTCTCTGCTTGGTCACAAGGGATCACCGGCAAAG
GGATTACAACTGCAATAATGGACGATGGCATTGATTATCTGCACTCCGAT
TTATCGAGGAATTACAACGCAGAGAGTAGCTATGACTTCAGCAGCAACGA
TCCGTACCCTTTCCCTCGGTACACAGATGATTGGTTCAATAGTCACGGGA
CCAGATGTGCCGGGGAGATATCAGCAGAGAGAGACAATGGCGTCTGCGGG
GTCGGCATTGCATACAATTCCCAGGTGGCCGGTTTGCGGATGCTGGACCA
ACCATACATGACGGATCTCATTGAAGCTGCAGCGATGAGCCATGATCGCG
ACAATATCCATATTTATTCCGCCAGTTGGGGCCCCACCGATGACGGTAGA
ACTGTCGATGGACCCCGCAACGAAACCATGAGGGCCATTGTTGACGGGGT
CAATAAGGGCCGCAACGGCAAAGGTAACATTTATGTCTGGGCTTCAGGAG
ACGGTGGTGCCTCAGACGATTGCAATTGCGATGGATACGCGGCGAGCATG
TGGACGATCAGCATCAATTCCGCCACGAATGACGGCGAAACAGCGAGTTA
TGATGAGTCGTGTTCTTCGACCCTCGCTTCCACATTCTCCAATGGCAAGG
CTTGGTTCAGTCTGGATGCCGGAGTCGGCACAGTGGATCTGTACGGCCAA
TGTACACTCCACCATTCTGGCACATCCGCCGCCGCTCCAGAGGCAGCAGC
GGTCTTTGCTCTTGCCCTTGAAGCGAACGGGGAAATGGGCTGGAGAGACA
TGCAGCATTTGTCAGTACTGACTAGCAAGAGGAACCATTTGCACGACAGG
GACGGGCGACATAACTGGACGATTAATGGTGCAGGTCTCGAGTTCAATCA
CTTATTCGGCTATGGGGTGCTAGACGCAGGTGACATGGTCCGAGTGGCGA
AGATGTGGGCCAACGTTCCAGAAAGGTTTCATTGCATTGCTGGAGAGATC
AACCAAAAATCGAGGTTTAATATCAGCAAAGCACTTGTGCTGGAGATTGA
CACGGACGCTTGCAAATCCGATGATAACCACAGAGTGAACTACTTAGAAC
ACGTACAAGCATTTGTGACTGTGAAAGCAAGTCGTCGAGGTGACATAACG
ATGTTTCTGACGAGTCCAATGGGAACGACGTCGATGATCCTTAGTCGTCG
AGAGAAAGACAGTGACTCGATCCGCGGGTTTACCAAATGGCCCTTCATGA
CCACGCACACGTGGGGAGAGACCCCTCGCGGCAAGTGGCGACTGACCGTC
ATGTTCGATACGGAGGACGCCCTGATACAAGGACTGCTCTCTGAGTGGGT
C

Design Primers for pc2

back to top

protein sequence

>Pmo_008419-protein ID=Pmo_008419-protein|Name=pc2|organism=Phagocata morgani|type=polypeptide|length=611bp
MRVAILVSVIVVLLSHRLTATIHSNQWHVHLQQPGEHVAEQVASETGFSL
LRNHLRSPNEFIFTHRALPPASAVASLSHHMNLVAHPLVKQATQMEGFLR
KKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI
RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYN
AESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYN
SQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPR
NETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISIN
SATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHS
GTSAAAPEAAAVFALALEANGEMGWRDMQHLSVLTSKRNHLHDRDGRHNW
TINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRF
NISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSP
MGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTED
ALIQGLLSEWV
back to top

coding sequence

>Pmo_008419.69.1901 ID=Pmo_008419.69.1901|Name=Pmo_008419.69.1901|organism=Phagocata morgani|type=CDS|length=1833bp
ATGCGCGTTGCAATATTAGTGTCCGTTATTGTGGTGCTACTTAGCCATCG
ATTGACCGCTACGATCCATAGCAATCAGTGGCACGTGCACCTCCAACAGC
CGGGGGAACATGTCGCCGAGCAGGTGGCCAGTGAAACGGGATTCTCTCTC
CTTAGGAATCATCTCCGATCGCCGAATGAATTTATATTCACACACAGAGC
GCTGCCTCCAGCGAGCGCGGTCGCCAGTCTGAGTCATCACATGAACCTCG
TTGCGCACCCTTTGGTGAAGCAAGCCACGCAAATGGAAGGCTTCCTTCGC
AAGAAGCGAGGCTACAAGCCGATAAAGAGACAGCGAGTTCCTTTACCGAG
TATAGACAAGAAGGGTATTCCAGACAGACTGAAGGAACGCTCTAACAAAG
AGAGTATAAAGCTGCCAACCGATCCATTATTCGAGAAGGAATGGTATATT
CGGAATACGGGCCAGGCTGAAGGAGTGAAGGACCTTGATCTAAATGTGCT
CTCTGCTTGGTCACAAGGGATCACCGGCAAAGGGATTACAACTGCAATAA
TGGACGATGGCATTGATTATCTGCACTCCGATTTATCGAGGAATTACAAC
GCAGAGAGTAGCTATGACTTCAGCAGCAACGATCCGTACCCTTTCCCTCG
GTACACAGATGATTGGTTCAATAGTCACGGGACCAGATGTGCCGGGGAGA
TATCAGCAGAGAGAGACAATGGCGTCTGCGGGGTCGGCATTGCATACAAT
TCCCAGGTGGCCGGTTTGCGGATGCTGGACCAACCATACATGACGGATCT
CATTGAAGCTGCAGCGATGAGCCATGATCGCGACAATATCCATATTTATT
CCGCCAGTTGGGGCCCCACCGATGACGGTAGAACTGTCGATGGACCCCGC
AACGAAACCATGAGGGCCATTGTTGACGGGGTCAATAAGGGCCGCAACGG
CAAAGGTAACATTTATGTCTGGGCTTCAGGAGACGGTGGTGCCTCAGACG
ATTGCAATTGCGATGGATACGCGGCGAGCATGTGGACGATCAGCATCAAT
TCCGCCACGAATGACGGCGAAACAGCGAGTTATGATGAGTCGTGTTCTTC
GACCCTCGCTTCCACATTCTCCAATGGCAAGGCTTGGTTCAGTCTGGATG
CCGGAGTCGGCACAGTGGATCTGTACGGCCAATGTACACTCCACCATTCT
GGCACATCCGCCGCCGCTCCAGAGGCAGCAGCGGTCTTTGCTCTTGCCCT
TGAAGCGAACGGGGAAATGGGCTGGAGAGACATGCAGCATTTGTCAGTAC
TGACTAGCAAGAGGAACCATTTGCACGACAGGGACGGGCGACATAACTGG
ACGATTAATGGTGCAGGTCTCGAGTTCAATCACTTATTCGGCTATGGGGT
GCTAGACGCAGGTGACATGGTCCGAGTGGCGAAGATGTGGGCCAACGTTC
CAGAAAGGTTTCATTGCATTGCTGGAGAGATCAACCAAAAATCGAGGTTT
AATATCAGCAAAGCACTTGTGCTGGAGATTGACACGGACGCTTGCAAATC
CGATGATAACCACAGAGTGAACTACTTAGAACACGTACAAGCATTTGTGA
CTGTGAAAGCAAGTCGTCGAGGTGACATAACGATGTTTCTGACGAGTCCA
ATGGGAACGACGTCGATGATCCTTAGTCGTCGAGAGAAAGACAGTGACTC
GATCCGCGGGTTTACCAAATGGCCCTTCATGACCACGCACACGTGGGGAG
AGACCCCTCGCGGCAAGTGGCGACTGACCGTCATGTTCGATACGGAGGAC
GCCCTGATACAAGGACTGCTCTCTGAGTGGGTC
back to top
Gene Groups
pc2 is similar in sequence to the genes of this group: GG3186
Gene NameGene ID
SMU15019018SMU15019018
pc2Ddo_018155
pc2Gsp_010792
pc2Pgr_003685
Pgr_007588Pgr_007588
pc2Pmo_008419
Pmo_028616Pmo_028616

Gene Group Protein Sequences

>SMU15019018

MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLR
NHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRK
RGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFN
VTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP
LSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Ddo_018155 pc2
MMFLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVLR
GHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKK
RGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRN
TGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSK
IAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNE
TMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKRNHLHDRDRRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNV
SRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMG
TTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPL
SQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRFMQ*
>Gsp_010792 pc2
MYRISLLFLIQIYTIYGKIVTNQWHVRLHDPGTHDLANKVAQETGFSLLR
NHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKK
RGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN
VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDP
LSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Pgr_003685 pc2
MKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSL
LRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLR
KKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRN
TGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSK
VVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNE
TMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAAVFALALEANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNV
SKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMG
TTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDAL
SQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ*
>Pgr_007588 Pgr_007588
MHFYLIFWLFVLSGVRESLAKIHSNQWYVRLHESGDDAAKRVASETGFVY
LRNHLQSPHEFIFTHRGIADASAAPSVSHQMNLLAHPMVKQASQMEGFLR
RKRGYKPVKKLPLQLTNINKKGIPDREKNSTDAHSQRRLPRDPLFSKEWY
ILNTGQAEGVKDLDLNVLSAWDQGVTGKGITTAIMDDGIDYLHPDLSKNY
NAENSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNDICGVGIAY
NSKVAGLRMLDQPYMTDLIEASAMSHDRDMIDIYSASWGPTDDGRTVDGP
RNETMRAIVDGVNKGRNGRGSIYVWASGDGGMSDDCNCDGYAASMWTISI
NSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLLH
SGTSAAAPEAAAVFALALEANREIGWRDMQHLSVLTSKRNHLHDRDGRHN
WTINGAGLEFNHLFGYGVLDAGDMVRVAKKWINVPERFHCIAGEISERSR
FNISKALILEINTDACKSSDGHRVNYLEHVQAFVTVRASRRGDVTLFLTS
PMGTTSMILSRRVKDGDSMQGFTKWPFMTTHTWGENPRGKWRLMAMFDTD
DALSQGVLSEWILVLHGTQERPYDKLSSSLEKILPKLAVIKRQHASKNFL
Q*
>Pmo_008419 pc2
MRVAILVSVIVVLLSHRLTATIHSNQWHVHLQQPGEHVAEQVASETGFSL
LRNHLRSPNEFIFTHRALPPASAVASLSHHMNLVAHPLVKQATQMEGFLR
KKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI
RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYN
AESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYN
SQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPR
NETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISIN
SATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHS
GTSAAAPEAAAVFALALEANGEMGWRDMQHLSVLTSKRNHLHDRDGRHNW
TINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRF
NISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSP
MGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTED
ALIQGLLSEWV
>Pmo_028616 Pmo_028616
MDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGE
ISAERDNGVCGVGIAYNSQVVGLRMLDQPYMTDLIESAAMSHERDSIDIY
SASWGPTDDGRTVDGPRNETMKAIVDGVNKGRRGKGNIYVWASGDGGVAD
DCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLD
AGVGTVDLYGQCTLHHSGTSAAAPEAAAVFALALEANTNIGWRDMQHLSV
LTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNV
PERFHCIAGQIDHKARFNVTKALILEIDTDACKSDDGHRVNYLEHVQAFV
TVKASRRGDTTMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWG
ENPRGKWRLTVMFDTEDALSQGMFSEWILLLHGTQIPPYDKLSTSLEKII
PKLAAVKRQHASKKFLE*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.