porcupine-like, Pgr_029656 (mRNA) Phagocata gracilis

Overview
Nameporcupine-like
Unique NamePgr_029656
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1734
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of porcupine-like vs. RefSeq Human
Match: gi|40548387|ref|NP_620154.2| (lysophospholipid acyltransferase 2 [Homo sapiens])

HSP 1 Score: 246.128 bits (627), Expect = 1.79241e-72
Identity = 151/442 (34.16%), Postives = 231/442 (52.26%), Query Frame = 2
Query:   77 PLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTG--YDI--------------KAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQ-RMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQL-YHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYF 1342
PLS + LPIDQ+NFVVC L ++L R +KTS+ +R + T+ G + +FC+G+ + L+QS +SY ++II+ + ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLA + DG +R + T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G Y I + P + L + + L + P + +Q +I++ IS R KYYFAW++++A + +AG G+ G +N W I N IE + K+ D WN+ T WL+ + YER+ F T+ F SA WHG YPGYYL F T + T AR +R + R F+ P +L Y VIT I+T +A++Y PF LL + +L F+ +Y+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFI-EPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450
BLAST of porcupine-like vs. RefSeq Human
Match: gi|122937404|ref|NP_001073949.1| (lysophospholipid acyltransferase 1 [Homo sapiens])

HSP 1 Score: 236.113 bits (601), Expect = 6.67096e-69
Identity = 146/447 (32.66%), Postives = 234/447 (52.35%), Query Frame = 2
Query:   59 GSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIK----AIPCAKKQIRA----ALCLSIIHGL--------LTAYVAPQFPYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFF 1345
GST L PLSE+LG+P+DQ+NFVVC L+++ R P TS++VR + TIFG VIFC+G+ +L + ++ Y +++ F ++G++ + H+ RI+ F YG T D SGP+MI TQK+T+LAF + DG L ++H A+K P+ + Y SYL+ F + AGP + +Y ++ G I + +K + + ++IH L L + FP + + + R+ + + + KYYFAW++++A + +AG G+SG KN W + N + IE+ + K+ + WN+ T WL+ + Y+R P + T+L F SA WHG YPGYY F T + T AR VR + R F+++ +Y T +T LA++Y APF +L + + +K YF+
Sbjct: 16 GSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLG-RRAEDLSAEQHRL-AIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFY 459
BLAST of porcupine-like vs. RefSeq Human
Match: gi|767913127|ref|XP_011508611.1| (PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Homo sapiens])

HSP 1 Score: 216.468 bits (550), Expect = 1.34339e-62
Identity = 131/385 (34.03%), Postives = 198/385 (51.43%), Query Frame = 2
Query:   77 PLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTG--YDI--------------KAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQ-RMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCAR 1174
PLS + LPIDQ+NFVVC L ++L R +KTS+ +R + T+ G + +FC+G+ + L+QS +SY ++II+ + ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLA + DG +R + T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G Y I + P + L + + L + P + +Q +I++ IS R KYYFAW++++A + +AG G+ G +N W I N IE + K+ D WN+ T WL+ + YER+ F T+ F SA WHG YPGYYL F T + T AR
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRD---LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAAR 394
BLAST of porcupine-like vs. RefSeq Human
Match: gi|578811432|ref|XP_006715062.1| (PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Homo sapiens])

HSP 1 Score: 208.379 bits (529), Expect = 5.2392e-59
Identity = 133/429 (31.00%), Postives = 218/429 (50.82%), Query Frame = 2
Query:  113 INFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIK----AIPCAKKQIRA----ALCLSIIHGL--------LTAYVAPQFPYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFF 1345
+NFVVC L+++ R P TS++VR + TIFG VIFC+G+ +L + ++ Y +++ F ++G++ + H+ RI+ F YG T D SGP+MI TQK+T+LAF + DG L ++H A+K P+ + Y SYL+ F + AGP + +Y ++ G I + +K + + ++IH L L + FP + + + R+ + + + KYYFAW++++A + +AG G+SG KN W + N + IE+ + K+ + WN+ T WL+ + Y+R P + T+L F SA WHG YPGYY F T + T AR VR + R F+++ +Y T +T LA++Y APF +L + + +K YF+
Sbjct: 2 VNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLG-RRAEDLSAEQHRL-AIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFY 427
BLAST of porcupine-like vs. RefSeq Human
Match: gi|767913132|ref|XP_011508613.1| (PREDICTED: lysophospholipid acyltransferase 2 isoform X3 [Homo sapiens])

HSP 1 Score: 177.178 bits (448), Expect = 8.55385e-49
Identity = 109/341 (31.96%), Postives = 172/341 (50.44%), Query Frame = 2
Query:   77 PLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTG--YDI--------------KAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQ-RMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRE 1042
PLS + LPIDQ+NFVVC L ++L R +KTS+ +R + T+ G + +FC+G+ + L+QS +SY ++II+ + ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLA + DG +R + T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G Y I + P + L + + L + P + +Q +I++ IS R KYYFAW++++A + +AG G+ G +N W I N IE + K+ D WN+ T WL+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRD---LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKR 351
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15039044 (dd_smedV4_413_0_1|m.25695|m.4576)

HSP 1 Score: 761.14 bits (1964), Expect = 0
Identity = 346/468 (73.93%), Postives = 410/468 (87.61%), Query Frame = 2
Query:   41 MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVRPIINDKVGQINFNLTKKA 1444
MSQFYGGSTILAPLS ++G+P+DQINF+VCSLLSI LGQ+MRH FPP+K S + RG IE FG LIV+FC+GYQ+KYLLLQS VSY++L+ LP+ ++AHLVT+W + FM +VH+YR+H+DYGGYT+DISGPVMIQTQKLTSLAFNLLDG R+N G L Q+ HE+HAVK+LP+A+ +F Y YFHG+ AGPF FYNEY+EY+TGYD K IPC+KKQ+ +ALCLS+IHGLLTAYVAPQFPYIF+ STDYQRMHM+RRI+FTMISFFLVRQKYYFAWS+ EA +LS GLGY GK KN EN+WS++KNYDFMAIESGS LKV+ DGWN+STTRWLREL+YER+PLFCRT+LVF SAFWHGFYPGYYLMF TF++FTFCARTVRKH+RPLF+ +P+T QLYHV+TKI TNLALNYGQ PFYLLEFQ+ LLFWKPYYFFGHV+A+ +L Q RPIINDKV +N T+KA
Sbjct: 1 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLLQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKA 468
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15001330 (Asxlregen_comp63653_c0_seq2|m.14305|m.9304)

HSP 1 Score: 335.109 bits (858), Expect = 5.41891e-107
Identity = 183/476 (38.45%), Postives = 268/476 (56.30%), Query Frame = 2
Query:   41 MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIPCAKK----------------QIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISI-ILMFQVRPIINDKVGQ 1417
MS FY GS I P+S+ +GL +DQ NF+ C L++ G + +K S R IE + G + IFC+G QI +LL QS+ Y+M+ + A + + + L F+ V H+ R+++DYGGYTMDI+GP+MIQTQKL+SLAFNL DG R+ L + H HA+ + P + +FSY+ YFHGI GPF F +Y ++ G + + K+ +I + ++ GLLT +V P F + + +Y + M + + I FLVRQKYYFAWSI +++ +GLG+SG ++ + + +KN+DF IE G+ K I D WN+ T WLRE VY+R P TL VF S+ WHG+YPGYYL F + A+FT +R RK++RPL + Y V+T ++ LALNY PF LE Q W +F HV ++ + L ++ P+ + G
Sbjct: 1 MSNFYSGSKIFQPVSDAVGLTVDQFNFMFCQLVASGFGFIFSRYLNTDKISPTFRHIIELVCGVSLTIFCFGSQIWHLLGQSISVYIMMNAMSTKSARYFILGFVLLFLSVAHLARMYYDYGGYTMDITGPLMIQTQKLSSLAFNLHDGQRIKKNEPLRRDYHRKHALLKYPTLLEFFSYMFYFHGIMVGPFVFLADYLRFIEGRQEEVLDNEKEKEYFRKNKSTILAGWPEIGFYVKSCLVFGLLTIFVQPHFDPDYFKTDEYLQSGMFYKYIMLTIVSFLVRQKYYFAWSIGSMSNIFSGLGFSGFSEERKPIYDVVKNFDFFKIELGTSTKSIIDNWNVGTIYWLRECVYDRIPRAYGTLAVFVCSSIWHGYYPGYYLCFMSLALFTEASRAGRKYIRPLVHKASLNLP-YDVLTSLLGMLALNYCAIPFTQLEVQLTFYIWSKMFFIVHVGSVLLYFLTPKLAPLFSSASGD 475
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15028343 (SmedSxldir_c96028_g2_i3|m.38137|m.41744)

HSP 1 Score: 315.079 bits (806), Expect = 1.93808e-99
Identity = 172/454 (37.89%), Postives = 249/454 (54.85%), Query Frame = 2
Query:   41 MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGY---------DIKAIPCAKKQIRAA-------LCLSIIHGLLTAYVAPQFPYIFIYSTDYQRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHV 1354
MS F+ GS IL P SE +GL IDQ NF+ C + + +G L K + N + E I G L+ +FC+G QI YLL QS+ Y+M+ +L A + + + L F+ V H+ R+++DYG YT+DI+GP+MIQTQKL+SLAFNL+DG R+ + L + H+ HA+ P + +FSY YFHG+ GPF F +Y ++ G D K QI +A L + + LL ++ P F F+ S ++ + +R + I+ FLVRQKYY AW++ +L AGLG+SG + + + +KN+ F E G+ K + D WN+ T WLRE VY+R P T+ VF SA WHG+YPGYYL F + A+ T AR R+ R F + Y + T ++ LN+ PF LL+ + + WK Y G V
Sbjct: 32 MSNFHSGSKILLPFSEAVGLKIDQFNFLFCQISACGIGYLFSRYLSRAKINPNYKHISEIILGILLTLFCFGLQIWYLLAQSISVYVMMNVLSVRKARYCILIFVLFFLSVAHIGRMYYDYGSYTLDITGPLMIQTQKLSSLAFNLMDGQRVKNKEKLRKDYHQVHAINHYPTVLEFFSYTFYFHGLMVGPFVFLGDYLRFIEGRQDELLINEDDKNHFKRNKFQILSAWPEISFHLFSLVCYSLLFFFIEPYFKPEFLLSDEFYQNGFFKRYLLMTITMFLVRQKYYIAWTMGSITNLFAGLGFSGFDEKQQPKYHIVKNFHFSRTEFGTSAKTMIDHWNVGTAIWLRECVYDRVPHSIGTITVFTCSAIWHGYYPGYYLAFASVALMTNAARCGRRLFRTYFHNAGLKLP-YDITTATMSMFCLNFSIIPFALLDIRKGFMVWKSLYILGPV 484
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15014228 (SmedAsxldir_c93263_g1_i1|m.32754|m.42353)

HSP 1 Score: 314.309 bits (804), Expect = 3.25622e-99
Identity = 166/479 (34.66%), Postives = 267/479 (55.74%), Query Frame = 2
Query:   41 MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIPCAKKQ----------------IRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTK-NMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTN---PVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVRPIINDKVGQ 1417
MS+FY G PLS G+ +DQ NFV C + L+G+ + + SA R + GF + +FC+G+QI +L + ++SY ++ LP + ++V +++ ++ V H+ R ++DYGGYT+DI+GP+M+ Q+L+ LAFNL DG ++ L HAV E P + +FSY++ F I GPF FY++Y ++ G +I+ +K++ + + +I G L +V P F F + ++ + +++F +I L+RQ+YYFAWS++ A L +GLG+SG K + + ++ I N+D IE +K I DGWN +WLRE +Y R+P T VF SA WHGFYPGYYL F T IF +R R+++RP F+ N T + Y V+T +I+ A+NY PF LL ++ FW+ +YF GH+ +++++ + P I ++ Q
Sbjct: 19 MSKFYAGVRFFEPLSSKFGIHVDQFNFVFCMFAACLMGRQFQTKYSIKNISAEQRHRFAFLGGFTLALFCFGHQIMHLFIPPIISYCIMYFLPYQHSRYIVLLFAMSYLAVTHLARQYWDYGGYTLDITGPLMVLVQRLSILAFNLYDGDQIKKKRKLDFDDAIKHAVLEHPTPLQFFSYVINFQTIMIGPFIFYSDYLRFIEGREIEYAETSKEKEYFVVHRTSILSPEDVTKKYFIIMLICGGLHLFVFPFFQPTFYLTPEFGQYSFINKVIFMLIVSPLLRQQYYFAWSLTSACCLCSGLGFSGFNKISGKPEYKLIDNFDMRNIEMAKNMKAIIDGWNKPANQWLRECIYNRAPKKFATPAVFICSAIWHGFYPGYYLFFVTAGIFLEISRMARRYIRPYFLVNFGDGQTSKFYDVLTTLISMFAINYMSVPFVLLGLSKSIQFWRQFYFCGHLAVPALLILIRFLPKIRTRIHQ 497
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15003924 (SmedAsxldir_c103283_g3_i5|m.58037|m.44976)

HSP 1 Score: 84.7297 bits (208), Expect = 2.79629e-17
Identity = 91/366 (24.86%), Postives = 142/366 (38.80%), Query Frame = 2
Query:  437 MIQTQKLTSLAFNLLDGWRLNHGYT--LPQKKHETHAVKEL----------PNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIPCAKKQIRAALCLSIIHGLLTAYV-APQFPYI-FIYSTDYQRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLG-YSGKT-----------KNMEN-------DWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFC-RTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHV------------------RPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILM 1378
++ T KL AF + D L + E + +++L + ++ F+Y F G+ GP Y +YR YL + + I L + AY+ A F +I + S ++ R VF + FF+ R + YFAW ISE + AG+G Y + K ME + +N + E ++ WNMS WL VY R P+ RT + SAFWHG +PGYYL F T + + K V +P + F + ++ +Y F LLE + L++W +F H++ I +I M
Sbjct: 106 LVLTLKLVGAAFEIKDSLERERKLKILLNTIQMEDNEIEDLKLEIKYFNVKSDVIDLFTYSYCFIGLLTGP---YFKYRVYLDCSQFSSTVYVNRYIEFWNRLKNAAFIGVAYLFASHFYFIEYAKSDEFYNRSFFYRFVFMSVMFFVFRMRMYFAWLISECVCMCAGMGAYPASSVPVPGHGPTNLKGMEPIGDSIAVSYDTTRNLNISGCEWAPSVRDGMRSWNMSVQYWLATFVYRRFPIKAYRTFVTMLVSAFWHGVHPGYYLSFMTIPLSLLAESALEKLVIGAAPTLSARIRNANGEWQPSMLIEKSFFIRWFYKMRV-----FDYCCMGFLLLEAGSTLMYWWSIWFSVHLLMIVLISM 463
BLAST of porcupine-like vs. uniprot
Match: gi|82082193|sp|Q5ZKL6|MBOA2_CHICK (RecName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 266.544 bits (680), Expect = 1.11614e-79
Identity = 157/469 (33.48%), Postives = 245/469 (52.24%), Query Frame = 2
Query:   41 MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTG-------------YDIK---AIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQ-RMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVR 1390
M+ GST+L PLS + LP+DQ+NFVVC L ++L R +KTS +R + T+ G + +FC+G+ + ++QS +SY ++II+ ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLAF + DG +R N T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G D K P + L + + L + P + +++ R+ + +S R KYYFAW++++A + +AG G+ G KN W I N IES + K+ D WN+ T WL+ + YER+ F T+ F SA WHG YPGYYL F T + T AR +R ++R F+ +P Y +IT + T +A++Y PF LL + + F+ YF H+ +I ++L+F ++
Sbjct: 1 MATSTTGSTLLQPLSNAVRLPVDQVNFVVCQLFALLAAIWFRTYLHSSKTSPFIRHVVATLLGLYLALFCFGWYALHFVIQSGISYYLMIIIGVENMHKYCFVFALGYLTVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAFEIHDGMFRKNEDLTPSQR---CLAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYQLQQSEANGKEDTKYEQTDPSPNIAVAQKLLICGLSLLFHMTITKTLPVEYNIDENFRATASWPVRVFYLYLSLMAARPKYYFAWTLADAINNAAGFGFRGYDKNGVTRWDLISNLRIQQIESSTSFKMFLDNWNIQTALWLKRVCYERAT-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAIRNNIRHYFVESPAVKLCYDIITWMTTQVAISYTVVPFVLLSVKPSFTFYSSCYFCLHIASILVLLVFPLK 465
BLAST of porcupine-like vs. uniprot
Match: gi|81879081|sp|Q8R3I2|MBOA2_MOUSE (RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 2; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=Lysophosphatidylcholine acyltransferase; Short=LPCAT; Short=Lyso-PC acyltransferase; AltName: Full=Lysophosphatidylcholine acyltransferase 4; Short=Lyso-PC acyltransferase 4; Short=mLPCAT4; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 251.906 bits (642), Expect = 3.79487e-74
Identity = 154/472 (32.63%), Postives = 238/472 (50.42%), Query Frame = 2
Query:   77 PLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDI---------------KAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQRM-HMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVRPIINDKVGQINFNLTK 1438
PLS + LPIDQ+NFVVC L ++L R +KTS+ +R + T+ G + FC+G+ + L+QS +SY ++II ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLA+ + DG +R + T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G KA P + L + + L ++ P + +Q + + +S R KYYFAW++++A + +AG G+ G KN W I N IE + K+ D WN+ T WL+ + YER+ F T+ F SA WHG YPGYYL F T + T AR VR + R F+ P Y +IT + T + ++Y PF LL + + F+ +Y+ HV +I ++L+ V+ Q N +L++
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMQQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGL---AVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSILVLLLLPVKKSQRRTSTQENVHLSQ 481
BLAST of porcupine-like vs. uniprot
Match: gi|124015157|sp|Q3T1J2|MBOA2_RAT (RecName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 248.825 bits (634), Expect = 4.78584e-73
Identity = 156/469 (33.26%), Postives = 240/469 (51.17%), Query Frame = 2
Query:   77 PLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAA-HLVTF-WSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDI---------------KAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQ-RMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVRPIINDKVGQIN 1423
PLS + LPIDQ+NFVVC L ++L R +KTS+ +R + T+ G + FC+G+ + L+QS +SY ++II AG+ + H F ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLA+ + DG +R + T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G KA P + L + + L ++ P + +Q + + +S R KYYFAW++++A + +AG G+ G KN W I N IE + K+ D WN+ T WL+ + YER+ F T+ F SA WHG YPGYYL F T + T AR VR + R F+ P Y +IT T + ++Y PF LL + F++ +Y+ H+ +I ++L+ V+ K + N
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMII--AGVESMHQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRG---LAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHMAQSGENGKEEQHGKAEPSPNAAVTEKLLVCGLSLLFHLTISSMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTVQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFVEPPQLKLFYDIITWAATQITISYTVVPFVLLSINPSFTFYRSWYYCLHICSILVLLLLPVKKSPRKKNTEEN 476
BLAST of porcupine-like vs. uniprot
Match: gi|143811417|sp|Q6ZWT7|MBOA2_HUMAN (RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 2; AltName: Full=1-acylglycerophosphate O-acyltransferase; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=Lysophosphatidic acid acyltransferase; Short=LPAAT; Short=Lyso-PA acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 246.128 bits (627), Expect = 4.74926e-72
Identity = 151/442 (34.16%), Postives = 231/442 (52.26%), Query Frame = 2
Query:   77 PLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDG-WRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTG--YDI--------------KAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQ-RMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQL-YHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYF 1342
PLS + LPIDQ+NFVVC L ++L R +KTS+ +R + T+ G + +FC+G+ + L+QS +SY ++II+ + ++LG++ V + R++ FDYG Y+ D SGP+MI TQK+TSLA + DG +R + T Q+ AV+ +P+ + Y SY F GI AGP Y +Y ++ G Y I + P + L + + L + P + +Q +I++ IS R KYYFAW++++A + +AG G+ G +N W I N IE + K+ D WN+ T WL+ + YER+ F T+ F SA WHG YPGYYL F T + T AR +R + R F+ P +L Y VIT I+T +A++Y PF LL + +L F+ +Y+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFI-EPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450
BLAST of porcupine-like vs. uniprot
Match: gi|81873769|sp|Q8BH98|MBOA1_MOUSE (RecName: Full=Lysophospholipid acyltransferase 1; Short=LPLAT 1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=1-acylglycerophosphoserine O-acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Lysophosphatidylserine acyltransferase; Short=LPSAT; Short=Lyso-PS acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 1; Short=O-acyltransferase domain-containing protein 1)

HSP 1 Score: 236.113 bits (601), Expect = 1.47183e-68
Identity = 151/480 (31.46%), Postives = 248/480 (51.67%), Query Frame = 2
Query:   59 GSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIH-FDYGGYTMDISGPVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIK----------------AIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVRPIINDKVGQINFNLTKKA 1444
GST L PLS++LG+P+DQ+NFV C L ++ R P K S VR + TI G V+FC+G+ +L + ++ Y +++ F ++G++ + H+ RI+ F YG T D SGP+MI TQK+T+LAF + DG L ++H AVK P+ + Y SY + F + AGP + +Y ++ G I P + LC++++ LL ++ FP F+ + + + R+ + + + KYYFAW++++A +AG G++G + ++ W + N + IE+ + K+ + WN+ T+ WL+ + YER P + T+L F SA WHG YPGYY F T T AR VR + R F+++ Y V+T +T LA++Y APF +L + + +K +FF H+I + IIL ++P + + ++ KKA
Sbjct: 15 GSTCLHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCYGVMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLG-RKAEDLSAEQHRL-AVKAKPSLLEYLSYHLNFMSVIAGPCNNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLPEPSPMGAVIQKLCVTLMSLLLFLTLSKSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGFNGMDTDGKSRWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVPWY-PTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQLAVSYTAAPFVMLAVEPTISLYKSVFFFLHIICLLIILFLPIKPHQPQRQSRSPNSVKKKA 491
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|20129843|ref|NP_610546.1| (oysgedart, isoform A [Drosophila melanogaster])

HSP 1 Score: 271.937 bits (694), Expect = 1.0399e-80
Identity = 153/469 (32.62%), Postives = 255/469 (54.37%), Query Frame = 2
Query:   32 KITMSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW-RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIP-------CAKKQI------RAALCLSIIHGLLTAYVAPQF----PYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMF 1381
K + Y GS L++++GL +D +NF++C + ++ L L R + P+K S+ +R G FC+G Q ++ + Y+++ + V ++ ++ VH+ R +DYG Y +DI+GP+MI TQK+TSLAF++ DG+ R + T K + HA++++P+A+ YFSY+ +F I AGP FY +Y E++ GY++ + P +K+++ A+ ++ L+ A++ +F P + D+ M + + M++ +R KYY AW +++A ++GLG++G K+ + W I N + ++ E + ++ + WN T RWLR LVYER P TLL FA SA WHGFYPGYYL F T A+ ART R+ R F + VT Y ++T +IT + L Y PF LLEF ++ + +Y H+I++ I +
Sbjct: 6 KFIENDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDGFVRGDEELT---KAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399947|ref|NP_001286265.1| (oysgedart, isoform B [Drosophila melanogaster])

HSP 1 Score: 271.937 bits (694), Expect = 1.0399e-80
Identity = 153/469 (32.62%), Postives = 255/469 (54.37%), Query Frame = 2
Query:   32 KITMSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW-RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIP-------CAKKQI------RAALCLSIIHGLLTAYVAPQF----PYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMF 1381
K + Y GS L++++GL +D +NF++C + ++ L L R + P+K S+ +R G FC+G Q ++ + Y+++ + V ++ ++ VH+ R +DYG Y +DI+GP+MI TQK+TSLAF++ DG+ R + T K + HA++++P+A+ YFSY+ +F I AGP FY +Y E++ GY++ + P +K+++ A+ ++ L+ A++ +F P + D+ M + + M++ +R KYY AW +++A ++GLG++G K+ + W I N + ++ E + ++ + WN T RWLR LVYER P TLL FA SA WHGFYPGYYL F T A+ ART R+ R F + VT Y ++T +IT + L Y PF LLEF ++ + +Y H+I++ I +
Sbjct: 6 KFIENDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDGFVRGDEELT---KAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399951|ref|NP_001286267.1| (oysgedart, isoform E [Drosophila melanogaster])

HSP 1 Score: 271.937 bits (694), Expect = 1.0399e-80
Identity = 153/469 (32.62%), Postives = 255/469 (54.37%), Query Frame = 2
Query:   32 KITMSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW-RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIP-------CAKKQI------RAALCLSIIHGLLTAYVAPQF----PYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMF 1381
K + Y GS L++++GL +D +NF++C + ++ L L R + P+K S+ +R G FC+G Q ++ + Y+++ + V ++ ++ VH+ R +DYG Y +DI+GP+MI TQK+TSLAF++ DG+ R + T K + HA++++P+A+ YFSY+ +F I AGP FY +Y E++ GY++ + P +K+++ A+ ++ L+ A++ +F P + D+ M + + M++ +R KYY AW +++A ++GLG++G K+ + W I N + ++ E + ++ + WN T RWLR LVYER P TLL FA SA WHGFYPGYYL F T A+ ART R+ R F + VT Y ++T +IT + L Y PF LLEF ++ + +Y H+I++ I +
Sbjct: 6 KFIENDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDGFVRGDEELT---KAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399949|ref|NP_001286266.1| (oysgedart, isoform D [Drosophila melanogaster])

HSP 1 Score: 258.84 bits (660), Expect = 4.04291e-76
Identity = 146/444 (32.88%), Postives = 242/444 (54.50%), Query Frame = 2
Query:  107 DQINFVVCSLLSILLGQLMRHIFPPNKTSANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHLVTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW-RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTGYDIKAIP-------CAKKQI------RAALCLSIIHGLLTAYVAPQF----PYIFIYSTDY-QRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHVITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMF 1381
D +NF++C + ++ L L R + P+K S+ +R G FC+G Q ++ + Y+++ + V ++ ++ VH+ R +DYG Y +DI+GP+MI TQK+TSLAF++ DG+ R + T K + HA++++P+A+ YFSY+ +F I AGP FY +Y E++ GY++ + P +K+++ A+ ++ L+ A++ +F P + D+ M + + M++ +R KYY AW +++A ++GLG++G K+ + W I N + ++ E + ++ + WN T RWLR LVYER P TLL FA SA WHGFYPGYYL F T A+ ART R+ R F + VT Y ++T +IT + L Y PF LLEF ++ + +Y H+I++ I +
Sbjct: 11 DLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDGFVRGDEELT---KAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 451
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|24666648|ref|NP_524157.2| (nessy, isoform A [Drosophila melanogaster])

HSP 1 Score: 71.633 bits (174), Expect = 7.23133e-13
Identity = 53/244 (21.72%), Postives = 107/244 (43.85%), Query Frame = 2
Query:  431 PVMIQTQKLTSLAFNLLDGWRLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYREYLTG---YDIKAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQRMHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDWSRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVFATS----AFWHGFYPGYYLMF 1141
P I ++ F++ DG L L + + ET A+K+ P+ + ++ + G GP + Y+ ++ G + ++ A I+ + Y+ P + + ++ ++ +RI KY W ++E A + GL Y G+ KN + DWS N +E+G+ ++ +N++T +W+ + +Y+R + + + A WHG++ GYY+ F
Sbjct: 132 PHCILVLRMIGYGFDITDG--LKEESELSKDQKET-ALKKPPSLLELLAFSYFPSGFLVGPQFPFRRYKAFVDGEFRQHEGNVEAGVRRFGAGAFYLIVCQVGLRYL----PDSYFLTPEFAQVSFVKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGCSNVKLKLLETGNTMEHYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFLAVWHGYHSGYYMTF 368
The following BLAST results are available for this feature:
BLAST of porcupine-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|40548387|ref|NP_620154.2|1.792410e-7234.16lysophospholipid acyltransferase 2 [Homo sapiens][more]
gi|122937404|ref|NP_001073949.1|6.670960e-6932.66lysophospholipid acyltransferase 1 [Homo sapiens][more]
gi|767913127|ref|XP_011508611.1|1.343390e-6234.03PREDICTED: lysophospholipid acyltransferase 2 isof... [more]
gi|578811432|ref|XP_006715062.1|5.239200e-5931.00PREDICTED: lysophospholipid acyltransferase 1 isof... [more]
gi|767913132|ref|XP_011508613.1|8.553850e-4931.96PREDICTED: lysophospholipid acyltransferase 2 isof... [more]
back to top
BLAST of porcupine-like vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150390440.000000e+073.93dd_smedV4_413_0_1|m.25695|m.4576[more]
SMU150013305.418910e-10738.45Asxlregen_comp63653_c0_seq2|m.14305|m.9304[more]
SMU150283431.938080e-9937.89SmedSxldir_c96028_g2_i3|m.38137|m.41744[more]
SMU150142283.256220e-9934.66SmedAsxldir_c93263_g1_i1|m.32754|m.42353[more]
SMU150039242.796290e-1724.86SmedAsxldir_c103283_g3_i5|m.58037|m.44976[more]
back to top
BLAST of porcupine-like vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|82082193|sp|Q5ZKL6|MBOA2_CHICK1.116140e-7933.48RecName: Full=Membrane-bound O-acyltransferase dom... [more]
gi|81879081|sp|Q8R3I2|MBOA2_MOUSE3.794870e-7432.63RecName: Full=Lysophospholipid acyltransferase 2; ... [more]
gi|124015157|sp|Q3T1J2|MBOA2_RAT4.785840e-7333.26RecName: Full=Membrane-bound O-acyltransferase dom... [more]
gi|143811417|sp|Q6ZWT7|MBOA2_HUMAN4.749260e-7234.16RecName: Full=Lysophospholipid acyltransferase 2; ... [more]
gi|81873769|sp|Q8BH98|MBOA1_MOUSE1.471830e-6831.46RecName: Full=Lysophospholipid acyltransferase 1; ... [more]
back to top
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|20129843|ref|NP_610546.1|1.039900e-8032.62oysgedart, isoform A [Drosophila melanogaster][more]
gi|665399947|ref|NP_001286265.1|1.039900e-8032.62oysgedart, isoform B [Drosophila melanogaster][more]
gi|665399951|ref|NP_001286267.1|1.039900e-8032.62oysgedart, isoform E [Drosophila melanogaster][more]
gi|665399949|ref|NP_001286266.1|4.042910e-7632.88oysgedart, isoform D [Drosophila melanogaster][more]
gi|24666648|ref|NP_524157.2|7.231330e-1321.72nessy, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_029656 ID=Pgr_029656|Name=porcupine-like|organism=Phagocata gracilis|type=mRNA|length=1734bp
TCTGAATCAAAATTAATCACTTATTTGATTTAAGATTACTATGTCACAAT
TTTACGGTGGTTCTACCATTCTCGCCCCATTATCGGAAATATTAGGTCTA
CCAATTGATCAAATTAATTTTGTAGTATGTAGTTTGCTTTCTATATTACT
TGGTCAACTAATGAGACATATATTTCCTCCCAATAAAACATCCGCAAATG
TAAGGGGATTTATTGAGACGATTTTTGGATTTCTTATTGTAATATTCTGC
TATGGTTATCAAATAAAATATTTGTTACTTCAATCGGTAGTATCCTACCT
TATGTTAATTATTCTTCCAGCAGGCTTAGCCGCTCATCTTGTCACATTTT
GGAGCTTAGGTTTTATGGGAGTGGTACATATGTATCGCATACATTTTGAT
TATGGTGGCTATACAATGGACATTTCAGGCCCAGTAATGATTCAAACTCA
GAAGTTGACAAGTCTTGCTTTCAATTTACTTGATGGATGGAGACTTAATC
ACGGCTATACTTTACCTCAAAAGAAGCACGAAACTCATGCAGTAAAGGAA
CTTCCAAATGCTGTTAATTATTTTAGTTATCTTATGTATTTCCATGGTAT
ACAGGCAGGACCTTTTACATTTTACAACGAGTACAGAGAATACCTAACAG
GATATGACATTAAAGCAATACCATGTGCCAAAAAGCAAATAAGAGCAGCT
TTATGCTTATCGATTATTCATGGTTTACTTACAGCATATGTTGCACCTCA
ATTCCCTTATATTTTTATATACAGTACAGACTATCAACGAATGCATATGA
GTCGCCGAATCGTATTTACAATGATTTCTTTTTTCCTTGTGCGTCAAAAA
TATTATTTTGCTTGGTCTATTTCTGAAGCAGCATCACTTAGTGCGGGTCT
TGGCTACAGTGGCAAGACTAAAAACATGGAAAACGACTGGTCACGTATTA
AGAATTATGATTTTATGGCTATTGAAAGTGGTAGTTGTTTGAAAGTAATT
GGAGATGGATGGAATATGTCAACAACTAGGTGGCTTCGAGAACTCGTATA
TGAGAGATCACCTCTATTCTGTCGAACATTATTAGTATTTGCAACAAGTG
CATTCTGGCATGGATTCTATCCCGGTTATTACTTAATGTTTGGAACCTTT
GCAATTTTTACCTTCTGCGCAAGAACTGTACGTAAGCATGTTAGACCTTT
ATTTATGACTAATCCAGTAACATTTCAACTATATCACGTAATAACAAAAA
TTATAACTAATTTAGCACTTAATTATGGTCAGGCGCCATTTTATTTATTA
GAATTCCAAACTGCACTCTTATTTTGGAAACCGTATTATTTTTTTGGACA
CGTCATTGCAATATCTATAATATTAATGTTCCAAGTTCGACCAATTATCA
ATGATAAAGTAGGACAAATTAATTTCAATCTCACAAAGAAAGCTAACTTA
AATTTTTTACTTCTAAAGGAACGTCTGCTGTTAAAACTCCAATGATATGT
ATTTAAATATAATGTTATAAATATATTTTCGACTTTATCTGTGATGTATC
GAATATTGTTAATTGTTTGTGTCTTACGTAATAAGTTTATTCGTTTTAAT
TATTCCATTTTATGACGATATTATCGGTTATTCGAATCTAATTATGACTA
CATCGATGCTGATACGTGTATCATTTTAAAGTACACTATATTTTGATTGT
TTATTAATAAATGTGAAGTTTTCTTATTAAAAAA

Design Primers for porcupine-like

back to top

protein sequence

>Pgr_029656-protein ID=Pgr_029656-protein|Name=porcupine-like|organism=Phagocata gracilis|type=polypeptide|length=485bp
MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKT
SANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHL
VTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW
RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYRE
YLTGYDIKAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDW
SRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVF
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHV
ITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVR
PIINDKVGQINFNLTKKANLNFLLLKERLLLKLQ*
back to top

coding sequence

>Pgr_029656.41.1495 ID=Pgr_029656.41.1495|Name=Pgr_029656.41.1495|organism=Phagocata gracilis|type=CDS|length=1455bp
ATGTCACAATTTTACGGTGGTTCTACCATTCTCGCCCCATTATCGGAAAT
ATTAGGTCTACCAATTGATCAAATTAATTTTGTAGTATGTAGTTTGCTTT
CTATATTACTTGGTCAACTAATGAGACATATATTTCCTCCCAATAAAACA
TCCGCAAATGTAAGGGGATTTATTGAGACGATTTTTGGATTTCTTATTGT
AATATTCTGCTATGGTTATCAAATAAAATATTTGTTACTTCAATCGGTAG
TATCCTACCTTATGTTAATTATTCTTCCAGCAGGCTTAGCCGCTCATCTT
GTCACATTTTGGAGCTTAGGTTTTATGGGAGTGGTACATATGTATCGCAT
ACATTTTGATTATGGTGGCTATACAATGGACATTTCAGGCCCAGTAATGA
TTCAAACTCAGAAGTTGACAAGTCTTGCTTTCAATTTACTTGATGGATGG
AGACTTAATCACGGCTATACTTTACCTCAAAAGAAGCACGAAACTCATGC
AGTAAAGGAACTTCCAAATGCTGTTAATTATTTTAGTTATCTTATGTATT
TCCATGGTATACAGGCAGGACCTTTTACATTTTACAACGAGTACAGAGAA
TACCTAACAGGATATGACATTAAAGCAATACCATGTGCCAAAAAGCAAAT
AAGAGCAGCTTTATGCTTATCGATTATTCATGGTTTACTTACAGCATATG
TTGCACCTCAATTCCCTTATATTTTTATATACAGTACAGACTATCAACGA
ATGCATATGAGTCGCCGAATCGTATTTACAATGATTTCTTTTTTCCTTGT
GCGTCAAAAATATTATTTTGCTTGGTCTATTTCTGAAGCAGCATCACTTA
GTGCGGGTCTTGGCTACAGTGGCAAGACTAAAAACATGGAAAACGACTGG
TCACGTATTAAGAATTATGATTTTATGGCTATTGAAAGTGGTAGTTGTTT
GAAAGTAATTGGAGATGGATGGAATATGTCAACAACTAGGTGGCTTCGAG
AACTCGTATATGAGAGATCACCTCTATTCTGTCGAACATTATTAGTATTT
GCAACAAGTGCATTCTGGCATGGATTCTATCCCGGTTATTACTTAATGTT
TGGAACCTTTGCAATTTTTACCTTCTGCGCAAGAACTGTACGTAAGCATG
TTAGACCTTTATTTATGACTAATCCAGTAACATTTCAACTATATCACGTA
ATAACAAAAATTATAACTAATTTAGCACTTAATTATGGTCAGGCGCCATT
TTATTTATTAGAATTCCAAACTGCACTCTTATTTTGGAAACCGTATTATT
TTTTTGGACACGTCATTGCAATATCTATAATATTAATGTTCCAAGTTCGA
CCAATTATCAATGATAAAGTAGGACAAATTAATTTCAATCTCACAAAGAA
AGCTAACTTAAATTTTTTACTTCTAAAGGAACGTCTGCTGTTAAAACTCC
AATGA
back to top
Gene Groups
porcupine-like is similar in sequence to the genes of this group: GG1535
Gene NameGene ID
SMU15039044SMU15039044
porcupine-likeDdo_022473
Ddo_027705Ddo_027705
porcupine-likeGsp_005554
Pgr_005179Pgr_005179
porcupine-likePgr_029656
Pmo_003187Pmo_003187
Pmo_015173Pmo_015173
Pmo_032921Pmo_032921

Gene Group Protein Sequences

>SMU15039044

MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKL
SGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHL
VTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RINQGIKLLQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKE
YITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
TVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHV
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR
PIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR*
>Ddo_022473 porcupine-like
MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKL
SGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHL
VTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKE
YIVGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNENGENDW
SKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
ATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINLQFYHF
VTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFR
PIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
>Ddo_027705 Ddo_027705
MGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQG
IKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGY
NDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR
RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKN
YDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAF
WHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIF
TNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHI
>Gsp_005554 porcupine-like
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKV
SGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHL
VTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKE
YIIGYNDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVF
TVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHI
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFR
PIINDKVNQMNFVFTKKAHYRLQKLKNHLQRKLG*
>Pgr_005179 Pgr_005179
MSKFYGGSRILSPLSDLFGIPVDQINFVVCSLVSILLGQIMRHVFPPKKT
SANVRGFIETGFGFLIVIFCYGGQIKYLFLQSMVAYVILMLLPPRIAAHL
VTYWSMGFLAVVHLYRMHFDYGGYTIDISGPVMIQTQKLTSLAFNLLDGY
RINKGIDLSQKYHEQHAVKKFPDALKYFSYLMYFHGIQVGPFMFYNEYKE
YLIGYGNKTIPCANKQIRAALCMSVIFGLLTAYVAPQFPYIFTCSVDYQR
MAMSRRIMFTMISFFLTRQKYYFAWTIVEVGSLSAGMGYGGKNENNENDW
SRVKNYNFMAIESGSSLKLITDGWNISTARWLRELVYERAPLFCRTLLVY
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFVANPVTLQLYHI
ITKIITNLSFNYGQAPFFLLEFQLGLVFWKPYYFFGHVIAISVILIFQVK
PIFNNRVGHVDVADLRKKGDHLISQAATVTKF*
>Pgr_029656 porcupine-like
MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKT
SANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHL
VTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW
RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYRE
YLTGYDIKAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDW
SRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVF
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHV
ITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVR
PIINDKVGQINFNLTKKANLNFLLLKERLLLKLQ*
>Pmo_003187 Pmo_003187
MSQFYGGSTILSPLSDIVGLPVDQINFVICGLLSILLGQLMRHVFPPNKI
SSNVRGLIETFFGVLIVIFCYGYQIKYLLLQSMISYIILLIMPPRVAAHL
VTFWSLGFMGVVHLYRIHFDYGGYTMDISGPVMIQTQKLSSLAFNLLDGY
RLNQGNQLNNKKHEAHAVKRIPNLFSYMSYLIYFHGIQAGPFIFYNEYEE
YLGGYDNQAIPCAKKQIRAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSIAEAGSLSAGLGYGGKNENLENDW
SRVKNYDFMAIESGSSLKVVTDGWNMSTTRWLRELVYERSPLFCRTLLVF
TVSAFWHGFYPGYYLMFGTFAIFTFCARTARKFIRPMFMTNPVTFQLYHI
VTKILTNLSLNYGQAPFYLLEFQSALLFWKPYYFFAHVITISIILIFQFR
PIINDKVGQINFRITKKANLNFLNFKQCLKIKLR*
>Pmo_015173 Pmo_015173
LLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFY
NEYKEYIIGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCS
TDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNEN
GENDWSKVKNYDFKAIESGNSLKVLVDGWNISTTRWLRELIYERAPLFCR
TILVFATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINL
QFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFLVL
TLRFRPIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
>Pmo_032921 Pmo_032921
MSNFYGGSTILNPLSNVLGIPVDQVNFVVCCLLSIVFGQMMRHLFPPRNT
SANVRGIIEASAGLLIVLFCYGNQVKYLLLQSMVAYVMLMVLPPRIAAHF
VTYWSMGFLAVVHLYRMHYDYGGYTIDISGPVMIQTQRLTCLAFNLLDGH
RINNGLPLSNERHKLHAVKKLPDAVKFFSYLMYFHGVQVGPFTFYSEYKE
YLIGYGNKSIPCAKQQIRSALCLSVIFGLLTAYVAPQFPYLFTCSIEYQR
MTMTRRIVFTMISFFLTRQKYYFAWSIVEVGSLSAGLGYGGKTENLENDW
SRIRNYDFKAIESGSCLKLITDGWNMSTARWLRELVYERSPLFCRTLLVY
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHI
ITKIITNLSFNYGQAPFFLLEFQLGLLFWKPYYFFGHVIAISAILIFQCR
PIFNDKSAQISPRSIKTTDFLKSQSIVTTKIH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.