beta-catenin, Pgr_027642 (mRNA) Phagocata gracilis

Overview
Namebeta-catenin
Unique NamePgr_027642
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length3271
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of beta-catenin vs. RefSeq Human
Match: gi|4503131|ref|NP_001895.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 430.639 bits (1106), Expect = 5.98757e-134
Identity = 290/754 (38.46%), Postives = 406/754 (53.85%), Query Frame = 1
Query:  169 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE-DQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNK-SPGSTVSS--KDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
D+ WQQ YL DSGI+S T S+S + +E D + Q +W+ + S DI D + ++ AM L G ++ D ++ +L A AIP+L KL+ DED VV+N A MV QLSK +A A++ S +M+S ++ M +T R AGT++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++ + K+V LL K N+KFL I TDCLQILA+ +Q SK+ IL + GP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L DP SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N V CAAGILSNLTCNN NK+ + ++GG+EAL+R + EDI EP ICALRHLTSRH+EAE Q ++ GL ++++LL P + +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + S G T + +++I+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I + T L E++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------------------TDP----SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLL--------------HPPS---------HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA-EGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148227672|ref|NP_001091680.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 430.639 bits (1106), Expect = 5.98757e-134
Identity = 290/754 (38.46%), Postives = 406/754 (53.85%), Query Frame = 1
Query:  169 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE-DQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNK-SPGSTVSS--KDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
D+ WQQ YL DSGI+S T S+S + +E D + Q +W+ + S DI D + ++ AM L G ++ D ++ +L A AIP+L KL+ DED VV+N A MV QLSK +A A++ S +M+S ++ M +T R AGT++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++ + K+V LL K N+KFL I TDCLQILA+ +Q SK+ IL + GP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L DP SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N V CAAGILSNLTCNN NK+ + ++GG+EAL+R + EDI EP ICALRHLTSRH+EAE Q ++ GL ++++LL P + +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + S G T + +++I+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I + T L E++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------------------TDP----SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLL--------------HPPS---------HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA-EGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148233338|ref|NP_001091679.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 430.639 bits (1106), Expect = 5.98757e-134
Identity = 290/754 (38.46%), Postives = 406/754 (53.85%), Query Frame = 1
Query:  169 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE-DQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNK-SPGSTVSS--KDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
D+ WQQ YL DSGI+S T S+S + +E D + Q +W+ + S DI D + ++ AM L G ++ D ++ +L A AIP+L KL+ DED VV+N A MV QLSK +A A++ S +M+S ++ M +T R AGT++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++ + K+V LL K N+KFL I TDCLQILA+ +Q SK+ IL + GP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L DP SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N V CAAGILSNLTCNN NK+ + ++GG+EAL+R + EDI EP ICALRHLTSRH+EAE Q ++ GL ++++LL P + +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + S G T + +++I+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I + T L E++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------------------TDP----SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLL--------------HPPS---------HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA-EGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|530371928|ref|XP_005264943.1| (PREDICTED: catenin beta-1 isoform X1 [Homo sapiens])

HSP 1 Score: 430.639 bits (1106), Expect = 5.98757e-134
Identity = 290/754 (38.46%), Postives = 406/754 (53.85%), Query Frame = 1
Query:  169 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE-DQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNK-SPGSTVSS--KDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
D+ WQQ YL DSGI+S T S+S + +E D + Q +W+ + S DI D + ++ AM L G ++ D ++ +L A AIP+L KL+ DED VV+N A MV QLSK +A A++ S +M+S ++ M +T R AGT++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++ + K+V LL K N+KFL I TDCLQILA+ +Q SK+ IL + GP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L DP SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N V CAAGILSNLTCNN NK+ + ++GG+EAL+R + EDI EP ICALRHLTSRH+EAE Q ++ GL ++++LL P + +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + S G T + +++I+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I + T L E++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------------------TDP----SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLL--------------HPPS---------HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA-EGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|578805674|ref|XP_006713046.1| (PREDICTED: catenin beta-1 isoform X2 [Homo sapiens])

HSP 1 Score: 430.254 bits (1105), Expect = 7.29927e-134
Identity = 290/754 (38.46%), Postives = 406/754 (53.85%), Query Frame = 1
Query:  169 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE-DQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNK-SPGSTVSS--KDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
D+ WQQ YL DSGI+S T S+S + +E D + Q +W+ + S DI D + ++ AM L G ++ D ++ +L A AIP+L KL+ DED VV+N A MV QLSK +A A++ S +M+S ++ M +T R AGT++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++ + K+V LL K N+KFL I TDCLQILA+ +Q SK+ IL + GP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L DP SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N V CAAGILSNLTCNN NK+ + ++GG+EAL+R + EDI EP ICALRHLTSRH+EAE Q ++ GL ++++LL P + +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + S G T + +++I+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I + T L E++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 10 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------------------TDP----SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLL--------------HPPS---------HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA-EGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 663
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15031548 (SmedSxlregen_c67076_g1_i1|m.10982|m.22691)

HSP 1 Score: 1296.18 bits (3353), Expect = 0
Identity = 672/953 (70.51%), Postives = 778/953 (81.64%), Query Frame = 1
Query:  115 VMNEQMNIVNSPLSDD-INDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKK--DWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDK--EFGLDIDKLEAESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMS-YKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRYTPCHNYNAPLQNSACSRPNLSIALSNNQSHNSPGFLNSILHSPVMHNQPPCVSHRHIP-SQCGDQNYINSELLGQIGDMDVSDMQMNYGPPMTPQTRYPYNPGYMDXXXXXXXXXXXXXIQADMRYFKQTG------DCHLQDTQKG-----------------GPYASKSKG--KDSMDLCMAEGPDWPDSGSDFSQAHSHK 2877
+MNE MNIVNSPL+D+ INDK+NFTR WQQNQYL+DSGINSALE+H+HSVSS+HGYD+MDSEDQ+K +WK SN + ND +NDICMLTPD+PGS C R GGE MADV+L++ YD NK E ++ +FG+DIDK+EAESAIPDLIKLI DEDDAVVIN AT MVFQLSK DAIDA+INSKEMISC+I+AMNKAEH + VR+LAG IYNMSQKK GLK+IFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ+GGKEAVR S CIPK+V LLQKNN+KFLTICTDCLQILAFNHQPSK+EILK+ GPLHLIHIIKSY+YEKLLWTATRVLKVLSVCSANKPVIIREGG++ALTNILYHTIQ N++V PY EN++ +P FSQRLLHNCLWTLRNLSDAATR+NFDHLLKVLVQILM+++NSFQRQ+ HID N + CAAGILSNLTCNNQYNKI FKLGGVEA++R IEWN A L NPN PNK N NN F +DI EPCIC LRH++SRHEEAEA QAS++ FQGL +LIR++EMQLG DLF+MQ+ QP+ NLF+S YKINWSLIKAIIGLIRN+AMS CNF IRERGF WPMIVLINRAQID NK+ + +S KDKLL++I+EV+CGALHMLAKDPGIR+QIIS+K+WQRLI PQQIGIQSA+YVIASLLFNHLESIQRV GLLVE+SAER+ LE+I+S +VITN+LNEMVHS +EA+STYASAILIRATEEKNKRY HNYN QN + R NLSI+L NQ++NS G+LNSIL+SP+MHNQPPCVSHRH +QCGDQN +E L I D+DV+D M + + PQ RYPYNP ++D + +S I MR+FKQ G +C QD QK G S ++ KD MD+CM + DW ++ SDFSQ HS K
Sbjct: 1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYD-NKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLA-LTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNS-GYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIA--MRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDA-DWIETCSDFSQGHSQK 947
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15006664 (SmedAsxldir_c108529_g1_i1|m.90628|m.5971)

HSP 1 Score: 171.4 bits (433), Expect = 5.72463e-44
Identity = 170/585 (29.06%), Postives = 288/585 (49.23%), Query Frame = 1
Query:  607 SKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKIN----WSLIKAIIGLIRNMAMSS--CNFAAIRERGFVWPMIVLINRAQ--IDATNKSPGSTVSSKDKL-------LDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAIL 2313
S ++ +D L K+++SC + KAE +V+++ S+ + G I N IP L+ LL + ++ I+TL NL+ + ++ +R S I KLV + +N++K LT+ +CL L FN+ +K +L + G ++ I++ Y YEKLL+ A+++LKVLSVC+ANKP+++ G +EAL ++L S +P RL+ + LW++RNLSD ++ I + LL+ L+++L S D + C+ G L NLT N NK+A + GGV+A+ ++I E+++EP + ALRH+T + A+ Q + ++I Q P+ SNL + + LIKAI+GL+RN++M S C + I + G + + R I ++ S VS +L LDD++E+T AL LAKD + +IIS + RL +QS + ++ ++ + + R +GLL E+ E I+ RL+E++HS ++A+STYA+ ++
Sbjct: 115 SDIEVVDGL--KKKIVSCK-NKNTKAECISSVQHI-------SKGEQGATNIVNVNFIPILLDLLSSNDLKIVECVISTLDNLMYFVNQSRDIIRNSHGIEKLVEQMDRNDVKLLTVVLNCLHKLTFNNYEAKKTMLLSHGSEKVVQILRQYTYEKLLFAASKLLKVLSVCNANKPILVETGAMEALHSLL-------RSGSP------------------RLVLSSLWSIRNLSDYSSHIADMQKLLQKLIELLGSD-----------DEHTSICSMGCLCNLTSGNTENKLAFIEYGGVQAVCQLICERVG-----------------QEEVVEPGVAALRHVTHNNHLAQ---------QAIDIII----------------QSPLLSNLSVLIRGQPDKMLPLIKAIVGLLRNLSMISPQCRRSLI-DLGITNSLCEIFYRTSKGISDLSQQRNSIVSVSSELSFIEGVRLDDLLELTLAALQALAKD-NLAKKIISYE--NRL--------LQSVVQMV--MIKENSVPLHRACLGLLAEM-VEYADCARILEGEGFNTRLSELIHSTNKAISTYAAIVM 596
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15040734 (dd_smedV4_9667_0_1|m.42039|m.41887)

HSP 1 Score: 72.7886 bits (177), Expect = 6.72854e-13
Identity = 92/391 (23.53%), Postives = 173/391 (44.25%), Query Frame = 1
Query:  706 YLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQK------NNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLI--HIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALT-NILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAV--QASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNM 1845
+++G + +S+ +G +++ + N L+ +L +++V+FY+ITTLHN+LL V +++CI ++ + K K L IC DCL L++++ KI+I ++ + +I +++ N EKLL ++LK+LS + K I L N+ + NS+V TLRNLSD + D KV +L F + + + CA GIL+N +C+ NK L K ++++++ + + +S + LE L HL S HE + V + + L+ ++ + +D+ + + S I+WS+++A +GL+R++
Sbjct: 160 WVSGCFHYISRTPFGCEMLLKNNS-DILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVKIQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFAILVLNLFKSKSKMNSNVWLVM----------------------FLTLRNLSDILFQPKSD-FWKVYHDVLYQICLRFDEISCLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTLS------------VTTDKFKLWSGETLEAMYRCLHHLCSNHERSLYVINKCLMSDMNFLTNASHIIILNSSKDISFAN----ILSQSLTDIPISWSILRAWLGLVRHL 510
BLAST of beta-catenin vs. uniprot
Match: gi|461856|sp|P35224|CTNB_URECA (RecName: Full=Catenin beta; AltName: Full=Beta-catenin [Urechis caupo])

HSP 1 Score: 464.922 bits (1195), Expect = 4.76962e-146
Identity = 304/756 (40.21%), Postives = 420/756 (55.56%), Query Frame = 1
Query:  169 DKSNFTRLWQQNQYLVDSGINSALETHTH-SVSSRHGYDEMDSE------------DQN------KKDWKCLSNISINDNFANDI-CMLTPDS--PGSNICGRQ--GGEAMADVNLTSGYDANKSECDKEFGLDIDKLEAESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQIDATNKS---PGSTVSSKDKL-LDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
D T LWQQNQY+ DSGI S T SVSS+HG D+MD+ DQ ++ N +N + + + P++ G I Q G+ A L+ K D A AIP+L KL+ DED VV++ A MV QLSK +A A++NS +M++ L+ AM +T R AGT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QEG K AVR++ + K+V LLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY YEKLLWT +RVLKVLSVC++NKP I+ E G + L H SQRL+ NCLWTLRNLSDAAT+ + + LL++LVQ+L S+ D N V CAAGILSNLTCNNQ NK+ + ++GG+EAL+R I EDI EP +CALRHLTSRH EAE Q ++ GL +L++LL P + W LIKA++GLIRN+A+ N A +RE G + ++ L+ RA D ++ G+T + D + +++I+E T GALH++A++ RA I R + C I + A LL++ +++IQRVA G+L EL+A++ EMI T L E++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 33 DAKQQTMLWQQNQYMGDSGIQSGATTQAPPSVSSKHGLDDMDTGEGMDTSRMMFDFDQGFSTQAFTQEQVDEMNQQLNQTRSQRVRAAMFPETLEEGVQIPSTQLDPGQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATRAIPELTKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHRQGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLLLQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLKVLSVCASNKPAIV-EAGSAGPSMHLGHQ-------------------------SQRLVQNCLWTLRNLSDAATKSSDIEGLLQMLVQLLASN-----------DINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTI-----------------LQAGDREDITEPAVCALRHLTSRHGEAEMAQNAVRLHYGLPVLVKLL--------------HPPS---------RWPLIKAVVGLIRNLALCPANHAPLREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAYVDGVRMEEIVEGTVGALHIMAREAHNRAVI-------RGLNC---------ISLFAQLLYSPIDNIQRVAAGVLCELAADKEGAEMIEQEGT-TAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 693
BLAST of beta-catenin vs. uniprot
Match: gi|399056|sp|Q02453|ARM_MUSDO (RecName: Full=Armadillo segment polarity protein [Musca domestica])

HSP 1 Score: 451.055 bits (1159), Expect = 8.61331e-141
Identity = 292/755 (38.68%), Postives = 417/755 (55.23%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISIN--DNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRIN-FDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YLVDSGI+S T S+S + ED+ + + ++ NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A+ NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L ++P P RL+ NCLWTLRNLSDAAT+++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLT+RH ++E Q ++ GLS++++LL P + W LIKA IGL+RN+A+ N A +RE G + ++ L+ RA D AT S + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 22 TLMWQQNSYLVDSGIHSGAVTQAPSLSGK--------EDEEMEGDPLMFDLDTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAITNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL---------------------SNPSP----RLVQNCLWTLRNLSDAATKVDGLEPLLQSLVQVLAST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTTRHADSEMAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAAIGLVRNLALCPANAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTGSQQPAAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 673
BLAST of beta-catenin vs. uniprot
Match: gi|114162|sp|P18824|ARM_DROME (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 451.44 bits (1160), Expect = 1.0436e-140
Identity = 294/755 (38.94%), Postives = 417/755 (55.23%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISIN--DNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + ED+ + + ++ NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGK--------EDEEMEGDPLMFDLDTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. uniprot
Match: gi|221222436|sp|Q29I35|ARM_DROPS (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 451.055 bits (1159), Expect = 1.22283e-140
Identity = 296/753 (39.31%), Postives = 415/753 (55.11%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAID-ALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + DE D D + NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKE--DEEMEGDPLMFDL----DTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. uniprot
Match: gi|122106728|sp|Q17GS9|ARM_AEDAE (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 443.351 bits (1139), Expect = 1.16223e-137
Identity = 293/756 (38.76%), Postives = 419/756 (55.42%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNI--SINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAID-ALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRIN-FDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLF-NHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + D + +D + ++ + NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++++ +T + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+V LLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S QRL+ NCLWTLRNLSDAAT+++ + LL LV +L SS D N V CAAGILSNLTCNNQ NK+ + ++GGVEAL+ I N E+I EP +CALRHLTSRH E+E+ Q + GL ++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ +A D ATN S + +++I+E T GALH+L+K+ +L ++LI Q+ I + LLF N +E+IQRVA G+L EL+ ++ EMI + T L E+++S +E V+TYA+A+L + +E+K+ Y
Sbjct: 30 TLMWQQNSYLGDSGIHSGAVTQVPSLSGK---------DDDMEDDPLMFDMDQGFSQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRALSQSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALAMHL-----GNPS--------------------QRLVQNCLWTLRNLSDAATKVDGLETLLSGLVTVLGSS-----------DVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTI-----------------INAGDREEITEPAVCALRHLTSRHPESESAQNIVRNGYGLPVIVKLLN--------------PPS---------RWPLIKAVIGLIRNLALCPSNAAPLREHGAIHLLVRLLFKAFQDTQRQRSSVATNGSQPPGAYADGVRMEEIVEGTVGALHILSKE----------ELNRQLIRQ------QNVISIFVQLLFYNDIENIQRVAAGVLCELAVDKEVAEMIEAEGA-TAPLTELLNSANEGVATYAAAVLFKMSEDKSMDY 681
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45551205|ref|NP_726775.2| (armadillo, isoform C [Drosophila melanogaster])

HSP 1 Score: 450.284 bits (1157), Expect = 1.15358e-142
Identity = 296/753 (39.31%), Postives = 415/753 (55.11%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAID-ALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + DE D D + NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKE--DEEMEGDPLMFDL----DTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|17136376|ref|NP_476666.1| (armadillo, isoform A [Drosophila melanogaster])

HSP 1 Score: 451.44 bits (1160), Expect = 1.20468e-141
Identity = 294/755 (38.94%), Postives = 417/755 (55.23%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISIN--DNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + ED+ + + ++ NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGK--------EDEEMEGDPLMFDLDTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|19549863|ref|NP_599100.1| (armadillo, isoform B [Drosophila melanogaster])

HSP 1 Score: 451.44 bits (1160), Expect = 1.20468e-141
Identity = 294/755 (38.94%), Postives = 417/755 (55.23%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISIN--DNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + ED+ + + ++ NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGK--------EDEEMEGDPLMFDLDTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|24639204|ref|NP_476665.2| (armadillo, isoform D [Drosophila melanogaster])

HSP 1 Score: 451.44 bits (1160), Expect = 1.20468e-141
Identity = 294/755 (38.94%), Postives = 417/755 (55.23%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISIN--DNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + ED+ + + ++ NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGK--------EDEEMEGDPLMFDLDTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45553932|ref|NP_996328.1| (armadillo, isoform E [Drosophila melanogaster])

HSP 1 Score: 451.44 bits (1160), Expect = 1.20468e-141
Identity = 294/755 (38.94%), Postives = 417/755 (55.23%), Query Frame = 1
Query:  184 TRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDQNKKDWKCLSNISIN--DNFANDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDANKSECDKEFGLDIDKLE----------------------AESAIPDLIKLIKDEDDAVVINGATRMVFQLSKLDAI-DALINSKEMISCLIDAMNKAEHTDTVRYLAGTIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEILKNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFASLXXXXXXXXXXXXXTFSEDILEPCICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQPVTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLINRAQID--------ATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMALEMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRY 2346
T +WQQN YL DSGI+S T S+S + ED+ + + ++ NF D + + S ++ AM L G + ++ D + + +L A AIP+LIKL+ DED VV++ A MV QLSK +A A++NS +M++ L+ A++ + ++ + GT++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++ + K+VTLLQ+NN+KFL I TDCLQILA+ +Q SK+ IL + GP L+ I++SY+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L GN S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N V CAAGILSNLTCNNQ NK + ++GGV+AL+R I N E+I EP +CALRHLTSRH ++E Q ++ GLS++++LL P + W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D AT S + + +++I+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E V+TYA+A+L R +E+K + Y
Sbjct: 32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGK--------EDEEMEGDPLMFDLDTGFPQNFTQD-QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----GN--------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL--------------HPPS---------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
The following BLAST results are available for this feature:
BLAST of beta-catenin vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|4503131|ref|NP_001895.1|5.987570e-13438.46catenin beta-1 [Homo sapiens][more]
gi|148227672|ref|NP_001091680.1|5.987570e-13438.46catenin beta-1 [Homo sapiens][more]
gi|148233338|ref|NP_001091679.1|5.987570e-13438.46catenin beta-1 [Homo sapiens][more]
gi|530371928|ref|XP_005264943.1|5.987570e-13438.46PREDICTED: catenin beta-1 isoform X1 [Homo sapiens... [more]
gi|578805674|ref|XP_006713046.1|7.299270e-13438.46PREDICTED: catenin beta-1 isoform X2 [Homo sapiens... [more]
back to top
BLAST of beta-catenin vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 3
Match NameE-valueIdentityDescription
SMU150315480.000000e+070.51SmedSxlregen_c67076_g1_i1|m.10982|m.22691[more]
SMU150066645.724630e-4429.06SmedAsxldir_c108529_g1_i1|m.90628|m.5971[more]
SMU150407346.728540e-1323.53dd_smedV4_9667_0_1|m.42039|m.41887[more]
back to top
BLAST of beta-catenin vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|461856|sp|P35224|CTNB_URECA4.769620e-14640.21RecName: Full=Catenin beta; AltName: Full=Beta-cat... [more]
gi|399056|sp|Q02453|ARM_MUSDO8.613310e-14138.68RecName: Full=Armadillo segment polarity protein [... [more]
gi|114162|sp|P18824|ARM_DROME1.043600e-14038.94RecName: Full=Armadillo segment polarity protein[more]
gi|221222436|sp|Q29I35|ARM_DROPS1.222830e-14039.31RecName: Full=Armadillo segment polarity protein[more]
gi|122106728|sp|Q17GS9|ARM_AEDAE1.162230e-13738.76RecName: Full=Armadillo segment polarity protein[more]
back to top
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|45551205|ref|NP_726775.2|1.153580e-14239.31armadillo, isoform C [Drosophila melanogaster][more]
gi|17136376|ref|NP_476666.1|1.204680e-14138.94armadillo, isoform A [Drosophila melanogaster][more]
gi|19549863|ref|NP_599100.1|1.204680e-14138.94armadillo, isoform B [Drosophila melanogaster][more]
gi|24639204|ref|NP_476665.2|1.204680e-14138.94armadillo, isoform D [Drosophila melanogaster][more]
gi|45553932|ref|NP_996328.1|1.204680e-14138.94armadillo, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_027642 ID=Pgr_027642|Name=beta-catenin|organism=Phagocata gracilis|type=mRNA|length=3271bp
TTTTTTTTTAAAAATGATTTCTTTCGATAATGGTAAATATTTATGATTCA
AATAATTTGTATTATTTATTAATTTAATTTAATGTTTTTTGAAAGCTTTA
TTGATATTTATTGAGTTATGAATGAACAGATGAATATTGTAAATTCGCCA
CTATCAGATGATATTAATGATAAATCAAATTTTACAAGGTTATGGCAACA
AAATCAATATTTGGTTGACTCTGGAATAAATTCAGCTTTGGAAACTCATA
CACATAGCGTTAGTAGTAGGCATGGATATGATGAAATGGATTCAGAAGAC
CAGAACAAAAAAGACTGGAAATGCTTGTCTAATATAAGCATAAATGATAA
TTTTGCAAATGATATTTGTATGCTAACACCAGACTCGCCTGGAAGTAATA
TATGTGGTAGACAAGGCGGTGAAGCTATGGCTGATGTAAATTTAACTTCT
GGCTATGATGCTAATAAATCCGAATGTGATAAGGAGTTTGGACTAGATAT
CGATAAGCTGGAAGCAGAGAGTGCTATACCTGATTTAATAAAATTGATTA
AGGATGAGGATGACGCTGTAGTAATTAATGGAGCAACTCGAATGGTTTTT
CAATTAAGTAAATTGGACGCTATTGATGCTTTGATTAATTCAAAAGAAAT
GATCTCATGTCTTATTGATGCAATGAATAAAGCAGAACACACCGATACTG
TTAGATATTTGGCAGGAACTATTTACAATATGTCTCAAAAGAAATATGGA
TTAAAGGTTATTTTTGAGGCGAATGTAATACCTTGTCTGGTCAAACTTCT
TGGATTTTCGATGGAATCTGTTTTATTTTATGCGATTACAACGTTGCACA
ATTTACTTTTATACCAAGAAGGAGGGAAAGAAGCAGTCAGAATAAGTAGT
TGTATTCCGAAACTTGTTACACTTCTTCAGAAAAATAATATGAAATTTTT
AACAATTTGTACTGATTGTTTACAGATTCTTGCATTTAATCATCAACCAA
GCAAAATAGAAATCTTAAAAAATTGTGGACCTCTTCATTTAATTCACATT
ATTAAAAGTTATAATTATGAAAAATTGCTATGGACGGCTACTCGGGTTCT
GAAGGTGTTGAGTGTTTGTTCAGCAAATAAACCAGTGATAATTAGGGAAG
GAGGAATAGAAGCTTTGACAAATATATTATATCATACAATTCAAGGAAAT
TCATCTGTAACTCCGTATCAACCAGATTCTACTAACGAAAACAATGATCC
ACATCCACAATTTAGTCAGAGATTGTTACATAATTGCCTGTGGACTTTGA
GAAATCTCTCCGATGCAGCAACTCGAATAAATTTTGATCATTTATTAAAG
GTCTTGGTCCAAATCCTAATGAGTTCTTACAATTCATTTCAGAGACAGAA
TATACATATTGACGCCAATGCAGTTAATTGTGCAGCAGGAATTTTATCCA
ACCTAACTTGTAATAATCAATACAATAAAATTGCTCTATTCAAGCTTGGG
GGCGTGGAAGCACTAATTAGAGTAATCGAATGGAACTTTGCTTCTCTCAA
TAATCCAAATCCACCGAATAAAATAAATTCAAATAACACTTTCTCAGAAG
ACATATTAGAACCTTGTATATGTGCATTGCGTCATTTAACCAGTAGACAC
GAGGAGGCAGAAGCAGTCCAAGCTTCTCTTGTTCAATTTCAGGGACTGTC
TTTGTTGATTCGTTTACTTGAGATGCAGCTAGGCCAAGATCTCTTTTATA
TGCAAACTCAGCAACCCGTTACGTCTAACCTATTTATGTCGTACAAAATT
AACTGGAGTCTCATCAAGGCTATAATTGGTCTAATTAGGAATATGGCAAT
GTCGTCGTGTAATTTTGCTGCGATTCGCGAACGTGGTTTCGTTTGGCCCA
TGATCGTACTTATAAACCGAGCACAGATTGATGCTACAAATAAGAGTCCT
GGTTCAACAGTATCTTCAAAAGATAAATTACTTGACGATATTATGGAAGT
AACATGTGGCGCGCTGCACATGCTCGCCAAAGATCCGGGAATACGAGCGC
AGATTATATCGATAAAACTTTGGCAGCGACTGATATATTGTCCACAGCAA
ATTGGTATTCAATCTGCGATTTATGTAATTGCCAGTCTCTTATTCAATCA
CTTGGAATCTATTCAACGAGTGGCTATAGGTTTATTGGTGGAATTATCGG
CTGAAAGAATGGCATTAGAAATGATAATGAGCCACATGGTGATCACAAAT
AGGCTTAATGAAATGGTCCACTCAAAAAGTGAAGCAGTCTCAACTTATGC
GTCTGCGATATTGATTCGAGCCACGGAAGAGAAGAATAAGCGCTATACAC
CATGTCATAATTACAATGCACCACTGCAGAATTCAGCTTGTTCAAGACCC
AATCTGTCGATAGCCCTATCCAATAATCAGTCACACAATAGTCCCGGATT
CCTTAACTCTATTCTACATTCACCGGTTATGCACAATCAACCTCCTTGTG
TTAGTCATCGGCACATACCCTCGCAATGTGGAGATCAGAATTATATAAAC
AGCGAGCTGCTGGGTCAGATCGGAGACATGGACGTGTCGGACATGCAGAT
GAACTACGGTCCACCGATGACCCCTCAAACACGGTATCCGTACAACCCAG
GTTATATGGATAGTGGTGGTGGTTGTCCCTCATCAGGGTCGTCGTCGGGC
ATTCAGGCCGACATGAGGTACTTCAAACAAACAGGCGACTGTCACTTGCA
GGACACACAGAAGGGGGGGCCCTATGCCTCCAAAAGCAAGGGCAAAGACT
CGATGGACCTGTGCATGGCTGAGGGCCCCGACTGGCCCGACTCAGGCTCT
GACTTCTCGCAGGCACACTCCCACAAACCGTAGCAAACACACATGATCGG
GTCGCCGCCGCCAGCCAATGGAATGACGTCATTTTATTTATTTACGCAGT
TTCGTTATTATTATTATCATTATTATTTATTATTATTATTATTATTTCGT
GATGTGATTGTGATTTCGAGTATCATGTGAGTGTATATTAGTGACTGGCG
GGCCTTTGCATGCCTCTCTTTGTCGTCGTGGCCCTCTAGCCAGTCCCAGT
GGTCCTCTAGGGATCGACACCGGGAGATTGTGCCTTTAGCAATTGTTTTT
TTTCGGTAGTTTGCACTTTGTATACTAATATAGATATTTCGTTTCGAGCT
CCCGCTACTGACTCCCGGGACCGATGTGTGTAAATAAACTCTGTGTACTC
TGTATGAGCTTACTTATTGTA

Design Primers for beta-catenin

back to top

protein sequence

>Pgr_027642-protein ID=Pgr_027642-protein|Name=beta-catenin|organism=Phagocata gracilis|type=polypeptide|length=922bp
MNEQMNIVNSPLSDDINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSS
RHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQG
GEAMADVNLTSGYDANKSECDKEFGLDIDKLEAESAIPDLIKLIKDEDDA
VVINGATRMVFQLSKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAG
TIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ
EGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEIL
KNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEAL
TNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDA
ATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNN
QYNKIALFKLGGVEALIRVIEWNFASLNNPNPPNKINSNNTFSEDILEPC
ICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQP
VTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLIN
RAQIDATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIK
LWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMAL
EMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRYTPCHNYN
APLQNSACSRPNLSIALSNNQSHNSPGFLNSILHSPVMHNQPPCVSHRHI
PSQCGDQNYINSELLGQIGDMDVSDMQMNYGPPMTPQTRYPYNPGYMDSG
GGCPSSGSSSGIQADMRYFKQTGDCHLQDTQKGGPYASKSKGKDSMDLCM
AEGPDWPDSGSDFSQAHSHKP*
back to top

coding sequence

>Pgr_027642.118.2883 ID=Pgr_027642.118.2883|Name=Pgr_027642.118.2883|organism=Phagocata gracilis|type=CDS|length=2766bp
ATGAATGAACAGATGAATATTGTAAATTCGCCACTATCAGATGATATTAA
TGATAAATCAAATTTTACAAGGTTATGGCAACAAAATCAATATTTGGTTG
ACTCTGGAATAAATTCAGCTTTGGAAACTCATACACATAGCGTTAGTAGT
AGGCATGGATATGATGAAATGGATTCAGAAGACCAGAACAAAAAAGACTG
GAAATGCTTGTCTAATATAAGCATAAATGATAATTTTGCAAATGATATTT
GTATGCTAACACCAGACTCGCCTGGAAGTAATATATGTGGTAGACAAGGC
GGTGAAGCTATGGCTGATGTAAATTTAACTTCTGGCTATGATGCTAATAA
ATCCGAATGTGATAAGGAGTTTGGACTAGATATCGATAAGCTGGAAGCAG
AGAGTGCTATACCTGATTTAATAAAATTGATTAAGGATGAGGATGACGCT
GTAGTAATTAATGGAGCAACTCGAATGGTTTTTCAATTAAGTAAATTGGA
CGCTATTGATGCTTTGATTAATTCAAAAGAAATGATCTCATGTCTTATTG
ATGCAATGAATAAAGCAGAACACACCGATACTGTTAGATATTTGGCAGGA
ACTATTTACAATATGTCTCAAAAGAAATATGGATTAAAGGTTATTTTTGA
GGCGAATGTAATACCTTGTCTGGTCAAACTTCTTGGATTTTCGATGGAAT
CTGTTTTATTTTATGCGATTACAACGTTGCACAATTTACTTTTATACCAA
GAAGGAGGGAAAGAAGCAGTCAGAATAAGTAGTTGTATTCCGAAACTTGT
TACACTTCTTCAGAAAAATAATATGAAATTTTTAACAATTTGTACTGATT
GTTTACAGATTCTTGCATTTAATCATCAACCAAGCAAAATAGAAATCTTA
AAAAATTGTGGACCTCTTCATTTAATTCACATTATTAAAAGTTATAATTA
TGAAAAATTGCTATGGACGGCTACTCGGGTTCTGAAGGTGTTGAGTGTTT
GTTCAGCAAATAAACCAGTGATAATTAGGGAAGGAGGAATAGAAGCTTTG
ACAAATATATTATATCATACAATTCAAGGAAATTCATCTGTAACTCCGTA
TCAACCAGATTCTACTAACGAAAACAATGATCCACATCCACAATTTAGTC
AGAGATTGTTACATAATTGCCTGTGGACTTTGAGAAATCTCTCCGATGCA
GCAACTCGAATAAATTTTGATCATTTATTAAAGGTCTTGGTCCAAATCCT
AATGAGTTCTTACAATTCATTTCAGAGACAGAATATACATATTGACGCCA
ATGCAGTTAATTGTGCAGCAGGAATTTTATCCAACCTAACTTGTAATAAT
CAATACAATAAAATTGCTCTATTCAAGCTTGGGGGCGTGGAAGCACTAAT
TAGAGTAATCGAATGGAACTTTGCTTCTCTCAATAATCCAAATCCACCGA
ATAAAATAAATTCAAATAACACTTTCTCAGAAGACATATTAGAACCTTGT
ATATGTGCATTGCGTCATTTAACCAGTAGACACGAGGAGGCAGAAGCAGT
CCAAGCTTCTCTTGTTCAATTTCAGGGACTGTCTTTGTTGATTCGTTTAC
TTGAGATGCAGCTAGGCCAAGATCTCTTTTATATGCAAACTCAGCAACCC
GTTACGTCTAACCTATTTATGTCGTACAAAATTAACTGGAGTCTCATCAA
GGCTATAATTGGTCTAATTAGGAATATGGCAATGTCGTCGTGTAATTTTG
CTGCGATTCGCGAACGTGGTTTCGTTTGGCCCATGATCGTACTTATAAAC
CGAGCACAGATTGATGCTACAAATAAGAGTCCTGGTTCAACAGTATCTTC
AAAAGATAAATTACTTGACGATATTATGGAAGTAACATGTGGCGCGCTGC
ACATGCTCGCCAAAGATCCGGGAATACGAGCGCAGATTATATCGATAAAA
CTTTGGCAGCGACTGATATATTGTCCACAGCAAATTGGTATTCAATCTGC
GATTTATGTAATTGCCAGTCTCTTATTCAATCACTTGGAATCTATTCAAC
GAGTGGCTATAGGTTTATTGGTGGAATTATCGGCTGAAAGAATGGCATTA
GAAATGATAATGAGCCACATGGTGATCACAAATAGGCTTAATGAAATGGT
CCACTCAAAAAGTGAAGCAGTCTCAACTTATGCGTCTGCGATATTGATTC
GAGCCACGGAAGAGAAGAATAAGCGCTATACACCATGTCATAATTACAAT
GCACCACTGCAGAATTCAGCTTGTTCAAGACCCAATCTGTCGATAGCCCT
ATCCAATAATCAGTCACACAATAGTCCCGGATTCCTTAACTCTATTCTAC
ATTCACCGGTTATGCACAATCAACCTCCTTGTGTTAGTCATCGGCACATA
CCCTCGCAATGTGGAGATCAGAATTATATAAACAGCGAGCTGCTGGGTCA
GATCGGAGACATGGACGTGTCGGACATGCAGATGAACTACGGTCCACCGA
TGACCCCTCAAACACGGTATCCGTACAACCCAGGTTATATGGATAGTGGT
GGTGGTTGTCCCTCATCAGGGTCGTCGTCGGGCATTCAGGCCGACATGAG
GTACTTCAAACAAACAGGCGACTGTCACTTGCAGGACACACAGAAGGGGG
GGCCCTATGCCTCCAAAAGCAAGGGCAAAGACTCGATGGACCTGTGCATG
GCTGAGGGCCCCGACTGGCCCGACTCAGGCTCTGACTTCTCGCAGGCACA
CTCCCACAAACCGTAG
back to top
Gene Groups
beta-catenin is similar in sequence to the genes of this group: GG5233
Gene NameGene ID
SMU15031548SMU15031548
beta-cateninDdo_020132
beta-cateninGsp_006976
Pgr_020799Pgr_020799
beta-cateninPgr_027642
beta-cateninPmo_016711

Gene Group Protein Sequences

>SMU15031548

MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSV
SSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSC
LRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPM
IVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSA
ERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVA
PHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVS
HRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPN
FVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKS
PSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWS
PINK*
>Ddo_020132 beta-catenin
MMNESMNIVNSPQTDDFIIDKTTFTRSWQQNQYLIDSGINSALESHSHSV
SSKHGYDEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGSSG
CLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLI
SDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEA
VRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLH
NLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQP
SKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIRE
GGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTL
RNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILS
NLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPD
DIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFH
MQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCW
PMIVLINRAQIDLLNKNACSSISPKDKLLEEIIEVSCGALHMLAKDPGIR
AQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEV
SAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY
ASSHSYNVVPQNPNNLRNNLSISLPNNQNTNPGYLSSILNSPILHNQSPC
ISHRHNTVAQCGDQTVSNEPICQLNDVEVPDYHMNYSNTLQPQNRYPYNS
NYIDPNYSLINQPGNSDLTMRHFKQLGPINISNECVNQDVQKNFSNTSFK
SPSSHSLSLSGNLCSSSDNSKKEIMDVCMLDTDWIETCSEFSQGHSQKSW
SPINK*
>Gsp_006976 beta-catenin
MMNESMNIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSAIESHSHSV
SSKHGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSC
LRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNVPNKINQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPM
IVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSA
ERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYTA
SHNYNVPQNPNNLRNNLSISLPANQVSNPGYLNSILNSPIMHNQPSCVGH
RHNSVTQCGDQNISTNETCQINDVDVSDYHMTFSNTLQPQNRYSYASNYL
DPNYSLLNQTVNPEISMRQHFKQLGPINISNECINQDIQKTFTNPSFKNP
TSHQMPLTGNLCPSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSP
INK*
>Pgr_020799 Pgr_020799
MSEQMSAMNSPLSEDLINDKTMLTRAWQQNQYLVDSGINSAFETQTHSVS
SRNCCDEMESEDHNKTDWKCLSNINVHDNFLNDVCMLTPDSSSSNLCGRQ
RVDSVSETYSTLNCHITKSGFEKKISLEIDKNEAESAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSQEMISCIIGAMNKADHAETIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLY
QEGGKEAVRLNGCIPKLVTHLQKNNIKFLTICTDCLQILAFNHQPSKIEI
LNNGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHSVQRNSTSSSCQVEVSYEFDESHPQFSQRLLHNCLWTLRNLSD
AATRINFDDLLKILVQILMGSYNSFQKQNMHIDTNAVTCAAGILSNLTCN
NPFNKMALFKVGGVEALIRVIEWNYASLANPYHQNKMNANSNFSEDILEP
CICALRHLTSRHEEAESVQASLIQYQGLSILLRIIEMQLGPDLFHMQPNQ
AVMSNLFISYYEINWNLIKAIIGLIRNMGMSQCNFGFIREKGFVWPMVVL
INRAHIDSVNKNVSSSGTSKDKLLDEIIEVACGALHLLAKDPGIRTQIIS
IKLWQRFINCPQQVGIQSGIYVIASLLYSHLESIQRVAVGLLVELSADRM
ALEMIMSHMVINNKLNEMVHSKSEAVSTYVSAILIRFSEEKNKRYAQIHN
YNVALPNSSNTRTNLAVPLTNNPPNNSTGFLNSILHSPILHNQSTCIGHR
RMPSQCEDQNYINNELLVQINDMDVADIHMNLMSPEDNNRYSYNPNYADI
TCNVVNQPSSVDMRYFKQLSSICPGNENHIRDAVVPYSNATKGRLNNQNV
SNTMNIITTITDNSKMKVSMDMNMYDVDWGETCSEFSHTNSH*
>Pgr_027642 beta-catenin
MNEQMNIVNSPLSDDINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSS
RHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQG
GEAMADVNLTSGYDANKSECDKEFGLDIDKLEAESAIPDLIKLIKDEDDA
VVINGATRMVFQLSKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAG
TIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ
EGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEIL
KNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEAL
TNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDA
ATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNN
QYNKIALFKLGGVEALIRVIEWNFASLNNPNPPNKINSNNTFSEDILEPC
ICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQP
VTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLIN
RAQIDATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIK
LWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMAL
EMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRYTPCHNYN
APLQNSACSRPNLSIALSNNQSHNSPGFLNSILHSPVMHNQPPCVSHRHI
PSQCGDQNYINSELLGQIGDMDVSDMQMNYGPPMTPQTRYPYNPGYMDSG
GGCPSSGSSSGIQADMRYFKQTGDCHLQDTQKGGPYASKSKGKDSMDLCM
AEGPDWPDSGSDFSQAHSHKP*
>Pmo_016711 beta-catenin
MNEQMNIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVS
SRHGYDEMDSEDHNKKDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQ
GGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSNEMISCIIEAMNKAEHADAIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLY
QEGGKEAVRSSSCIPKLVTLLLKNNTKFLTICTDCLQILAFNHQPSKIEI
LKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSD
AATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCN
NQFNKIALFKLGGVEALIKVIEWNFASLNNPNAQNKNNSNNAFSEDILEP
CICALRHLTSRHEEAEAVQTALVQLQGLSLLIRLLEMQLGQDLYYMQTQQ
PVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLI
NRAQIDVANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIIS
IKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERM
ALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEKK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.