frizzled-like, Pgr_020264 (mRNA) Phagocata gracilis

Overview
Namefrizzled-like
Unique NamePgr_020264
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2179
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of frizzled-like vs. RefSeq Human
Match: gi|6005762|ref|NP_009128.1| (frizzled-10 precursor [Homo sapiens])

HSP 1 Score: 369.777 bits (948), Expect = 5.91237e-117
Identity = 202/549 (36.79%), Postives = 314/549 (57.19%), Query Frame = 2
Query:   50 LIMQIAALPSEKGSNDVYK----QCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGK---MCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRC--DADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPA-LPSVEMRMLRIFMNLVIGITSGIWIWGNK 1666
L++Q+ + S D+ + +C I P+C+D+ Y TRMPN MG +Q EA+ ++ ++ PL+ C +L+ FLCS+Y P+C + +T P+ C+ C+ + +C P M +N WP+ LDC KLP +C+ + D EP LF L + ++ + H LK G P + + + + +C C D+ ++ +DK FA +WL W++LC SS FT++TF + RF YPE+PI+FLSMCY +S G L+ G ++ C QL Y++ G E+T C + FL+LY+F AS+LWWV+LT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG C+VG+ D +AL GF+L+P YL+IG +F+ G+ ++ +R+ N +LEKLM +IG+FS+LY VP TC I Y + Y+ + L A ++ + T K +D + A +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct: 10 LVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSD-----EPTRGSG---LFPPLFRPQRPHSAQEHP---LKDGGPGRGGCDNPGKFHHVE-KSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQT---------KTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503835|ref|NP_003499.1| (frizzled-9 precursor [Homo sapiens])

HSP 1 Score: 355.525 bits (911), Expect = 1.83429e-111
Identity = 202/550 (36.73%), Postives = 300/550 (54.55%), Query Frame = 2
Query:   44 GILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRCDADIR--FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLD--YLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNKKSFQN 1681
G ++I E+G C + P+C+ + Y TRMPN +G SQ EA+ + ++ PL+ C +L+ FLCS+Y P+C + +T P+ +P C+ + RC P M +N WP+ LDC +LP P + + +E K L R +L AG S TC + + +C RC + ++ DK FA +W+ WS LC S+ FT++TF +RF YPE+PI+FLSMCY +S L+ A+ G ++V C D++ Y++ G E T C + FL+LY+F AS+LWWV+LT+TWFL+A + WG+EAIE+ S H+ +WG+PALK+I +L L K+ DELTG C+V + D AL GF+LVP YL++G +FL G+ ++ +RK +N ++LEKLM KIGVFSILY VP TC IV YV + ++ L C G + + ++P+V + ML+IFM+LV+GITSG+W+W + K+FQ
Sbjct: 19 GGAALEIGRFDPERGRGAA--PCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRP---MCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRND----PHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPG----DLGPGAG--GSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC---DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWR-----LRATEQPCAAAAGPGGR--RDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVW-SSKTFQT 536
BLAST of frizzled-like vs. RefSeq Human
Match: gi|22547161|ref|NP_036325.2| (frizzled-4 precursor [Homo sapiens])

HSP 1 Score: 335.495 bits (859), Expect = 1.88675e-104
Identity = 194/565 (34.34%), Postives = 296/565 (52.39%), Query Frame = 2
Query:   74 PSEKGSNDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLP---GTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRCDADIR-FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQNCGRGAKKDGQQQCEMKQIEVVNP 1750
P+ ++ ++C I +CQ++ Y T+MPN +G Q +A ++ + PLI CS L+ FLCS+Y P+C + + P + PC C VK RCEP + + WP L+C K P MC+ D+EV P +T + ++ +D+ + L C+ +C D ++ K F IW+ W+ LC IS+ FT++TF +++RF YPE+PI+FLSMCY +S ++ +GR + C + L+ G + T C I FL++YFF AS++WWVILT+TWFL+A WG+EAIE SS H+ +W IPA+K+I +LI+ +DADELTG C+VGN + DAL GF++ P YL+IG F+ G ++ K+R + + D + +LE+LM KIGVFS+LY VP TC I Y ++++ AL+ YS+D ++ + ML+IFM+L++GITSG+WIW K ++Q C G+ + E + V P
Sbjct: 33 PARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEK--INIP-IGPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFPPQNDHNHMCMEGPG---DEEV---PLPHKTPIQPGEECHSVGTNSDQYIWVKRSLN------------------------CVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQK-----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACY--------FYEISNWALFRYSAD---------------------DSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKP 529
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 331.257 bits (848), Expect = 1.20044e-101
Identity = 187/528 (35.42%), Postives = 273/528 (51.70%), Query Frame = 2
Query:  110 CTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLP--GTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCL--PSQINMGQLPNTTCMHRCDAD-----IRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK 1666
C I+ P+C D+ Y T MPN +G +Q +A V +YPL+ +QCS LK FLCSMY P+C ++ PC+ C+ + CE M + + WP+ L CEK P G G++C+ Q+ P S + + + G F+ L PS +N L C C+ + F ++ F+ W+ WS+LC S+LFT++T+ + RF YPE+PI+FLS CY + + G +L R V F E V G + C I F+MLYFFS AS++WWVIL++TWFL+A WG+EAIE+ S HL +W +PA+K+I +L L ++D D L+G CFVG N+ DAL GF+L P VYL IG +FL G+ S+ ++R + ++ D + ++LEKLM +IGVFS+LY VP T I Y ++ + D ++ S P P + M++ M L++GITSG WIW K
Sbjct: 116 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC----TVLEQALPPCRSLCERARQGCEALM-NKFGFQWPDTLKCEKFPVHGAGELCV-----GQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIR-TIMKH----DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACY---FYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGK 625
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503827|ref|NP_001457.1| (frizzled-2 precursor [Homo sapiens])

HSP 1 Score: 324.709 bits (831), Expect = 4.55928e-100
Identity = 187/539 (34.69%), Postives = 277/539 (51.39%), Query Frame = 2
Query:   77 SEKG-SNDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLP--GTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRC-----DADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPAL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1666
EKG S + C I+ P+C D+ Y T MPN +G +Q +A V +YPL+ +QCS L+ FLCSMY P+C ++ PC+ C+ + CE M + + WP L CE P G ++C+ + S+D + + L+ +PS ++ L C C D + F+ ++ FA +W++ WS+LC S+ FT+ T+ + RF YPE+PI+FLS CY S + G +L R V F E V G + C I F+MLYFFS AS++WWVIL++TWFL+A WG+EAIE+ S HL +W +PA+K+I +L + +ID D L+G CFVG N D L GF+L P VYL IG +FL G+ S+ ++R + ++ D + ++LE+LM +IGVFS+LY VP T I Y +++ + +E S K L+ C P + P + M++ M L++GITSG WIW K
Sbjct: 27 GEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQ----AIPPCRSICERARQGCEALM-NKFGFQWPERLRCEHFPRHGAEQICVG-QNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIR-TIMKH----DGTKTEKLERLMVRIGVFSVLYTVPATIVIACY--------FYEQAFREHWERSWVSQHCKSLA---IPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGK 543
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15029711 (SmedSxlregen_c141340_g1_i1|m.45153|m.4173)

HSP 1 Score: 741.11 bits (1912), Expect = 0
Identity = 332/530 (62.64%), Postives = 422/530 (79.62%), Query Frame = 2
Query:   95 DVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNKKSFQNC 1684
D+YKQC I EP CQDV Y++T MPN +G YSQ EASKR RD+ PLIN++CS+YLKLFLCS+YFP+C+ + + S+ +V+PC+ C HVK RCEP M T+ + W ELDCEK P GK+CLTPDSFSQD+ + ++ ++L+++L + N ++E+ +K CLPS++N+GQ PN +C C A+++FN DK FA+IWL+GWS+LC S L TII FSCNTNRF+YPEKPIVFLS+CYFF++ G+L GAILGR V CR F+++ D++VG G ETTWCKINFLM+YFF SASALWWV+LT+TWFLSASRHWGYEAIESISS+LHL+SW IPALKSIF+LILHKIDADELTGQCFVGN++ L GF++VP ++YL IG+ FL +GY S+LKVR+SFL++P CID +NLKRLEKLMAKIGVFSILY++PV CTIVSY++D +K FD+ LKAL+ +S +C+ G++WS KCV+I+QP LPSVEMRMLRIFMNLVIGITSGIWIWGNKK+ ++C
Sbjct: 45 DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSC 574
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15005387 (SmedAsxldir_c106380_g2_i1|m.75515|m.16659)

HSP 1 Score: 372.859 bits (956), Expect = 3.20327e-118
Identity = 210/613 (34.26%), Postives = 343/613 (55.95%), Query Frame = 2
Query:   26 MFFLWSGILIM-------QIAAL--PSEKGSNDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQ------LDKARKKNDKNMHQMEL-LKKAGSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTN-RFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLD--YLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCI---DPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSP 1798
M L++G +++ +++A+ S DVY +C I + +CQ ++Y TRMPN +GI +Q +++KR+ DY+PLIN QCS+Y + FLC+ YFP+C + T ++ PC+ C+ V+ RCEPFM + + + WP EL+C+K P ++C+ P ++ D+ ++ N + +K+ + + +D K N + E+ LK S S + N + + +C+ +CD++I ++ DK A IW W++LCLISS+ I TF + RF+YPE+PI+F+ +CY +L L R+ ++C+ + L+ G E+ C + FL +Y+F +ALWW++L ++ +L++ R W E +E IS+ +H++SW +PA+ + VLILHKID DEL G C+VG + + + FIL+P+I+ L+G L L + S++ +R++ + N + LEK +AK G+F +Y VP+TC I + ++ + +CV GL WS C+ + LP VE+R+L IF LVIGITSG+W+W NKK+ N R + C K+ NPI N LK + SP
Sbjct: 1 MIILFNGFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFMKA-FKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVK--SAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGL--PLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLV--SEITCRNKE----NPIMNYSIPLKDAHPLSP 601
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15014534 (SmedAsxldir_c94917_g1_i1|m.35515|m.3335)

HSP 1 Score: 298.901 bits (764), Expect = 3.23276e-89
Identity = 181/565 (32.04%), Postives = 282/565 (49.91%), Query Frame = 2
Query:   71 LPSEKGSNDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKA-RKKNDKNMHQM-----------ELLKKAGS--FASTTCLPSQINMGQLPNT-----------TCMHRCDADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQ----LDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPAL----PSVEMRMLRIFMNLVIGITSGIWIWGNK 1666
L S+ + D K C +I P+C+D+ Y T MPN +Q+EA +YPL+ ++CS L+ FLCS+Y PIC + S P PC+ C+ VK C+P + Y WP +++C++ P + +K + E N S L + A +++ND N Q+ +L ++ S F +C I++ ++ C C + + D+ F WL W+++CL+S+ + TFS + R+ YPE+PI+F+S+CYF S G L+ ++G ++ C + L L G+ C I FL++Y+F A++LWWV+LT+TWFL+A WG EAI S + H ++W +P +KSI L + +D D ++G C+VGN LI F+L P +VYL IG L G+ S+ ++R Q ++LEKLM +IGVFS+LY P IV+ +I YE + ++ LS C D + L PS + M + FM + +G+TSG WIW K
Sbjct: 31 LKSDNTNRDKGK-CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLP---PCRSVCERVKKGCDPLL-QKYTFKWPEKMNCDQFPVYN---------NPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTG----GKTEKLEKLMIRIGVFSVLYTAPAA-VIVACII---------------YELQNRAEWYQNLS---CDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKK 558
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15040087 (dd_smedV4_7210_0_1|m.35691|m.13357)

HSP 1 Score: 293.893 bits (751), Expect = 6.65191e-89
Identity = 181/521 (34.74%), Postives = 265/521 (50.86%), Query Frame = 2
Query:  119 ITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLP---GTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICR--PFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK 1666
I P CQ++ Y T MPN + + +Q EA +++ + LI +CS L FLCS+Y P+CD S + PCQ C+ V+ CE M +N+PWP L+C + P G MC+ + P S E FQ + K + IN Q C+ +C A+I F +DDK A IWL + LC ISS+FTI+TF NT+RF YPE+P++FL++CY +S + R++ C P Q L G + T C I FL+ +FFS+AS +WWVILTV W L+A W EAI S HL +W I +L ++ VL+L +DADEL G C VG + L+ F+++P I++L+IG FL G ++++VR+ D ++LE LM +IG+FS+L++VP + V+ YEY++ K P++E+ ML+IFM+ V+GITSG+W+W K
Sbjct: 51 ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDP---ISNYLIGPCQPLCEEVRDSCERIM-RPFNLPWPVTLNCSRFPVRNAEGSMCM------------EGPGPSVKSTENFQTMCGGMKNPRLFIF--------------------INRTQ----KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQF-ILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHVKN-----DGIKTEKLEILMVRIGLFSVLFLVPSS----------------TVLGCNFYEYANRDHWLKS-------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIK 496
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15036199 (SmedSxlregen_c90692_g1_i1|m.42870|m.18187)

HSP 1 Score: 292.352 bits (747), Expect = 6.28878e-88
Identity = 193/595 (32.44%), Postives = 287/595 (48.24%), Query Frame = 2
Query:  104 KQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQN---------CGRGAKKDGQ------------------------QQCEMKQIEVVNPITNNYS-YLKH 1780
+C I P+C+++ Y T MPN+ +Q EA V +YPL+ + CS L+LFLCS+Y PIC +Q C+ C+ + C P M +TY WP +DC+KL + CL D+ K VTK P+ K + + F S G + N C C + F DK+F + WL W++LC +SS T++TF + +RF YPE+PIVFLS CY S G ++ +G + C ++L Y C I FL++YFF A+++WWVILT+TWFLSA WG EAI S + H ++W + +KSI L L ID D + G C++GN + L F++VP VYLLIG FL G+ +++ +RK+ + S +LEKLM +IG+F +LY VP I ++ ++V + +E S++C + + + P + ML+ FM LV+GITSG WIW +K S+ N CG+ K Q +QC + Q ++NP T+ + Y +H
Sbjct: 57 NKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPIC---LPNWPKPIQACRSVCESARDGCAPVM-NTYGFKWPKSMDCDKLT-ENQACLKKDT----KNVTKPPS----------------KGCECKCRSPYIYDNKPQFNSVI-------TGGVAN--CFQSCHS-ANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACD--GDKLRYGT---TGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAK----GESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHL--------YEVKNREFWEKSNNCYCNRNIK-------SQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQH 592
BLAST of frizzled-like vs. uniprot
Match: gi|17433077|sp|Q9PWH2|FZD10_CHICK (RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-10; Flags: Precursor [Gallus gallus])

HSP 1 Score: 372.474 bits (955), Expect = 1.30624e-117
Identity = 203/534 (38.01%), Postives = 311/534 (58.24%), Query Frame = 2
Query:  107 QCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGK---MCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCL-PSQINMGQLPNTTCMHRC--DADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVD-IIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQN 1681
+C I P+C+D+ Y TRMPN MG +Q EA+ ++ ++ PL+ C +LK FLCS+Y P+C + +T P+ C+ C+ + +C P M +N WP+ LDC KLP +C+ + D+ P S + +F R + H ++ K S + T+C P + + + + +C C D+ ++ DDK FA IW+ WS+LC SS FT++TF + RF YPE+PI+FLSMCY +S G ++ G ++ C QL Y++ G E+T C I FL+LY+F AS+LWWVILT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG C+VG+ D +AL GF+L+P YL+IG +F+ G+ ++ +R+ N +LEKLM +IGVFS+LY VP TC I Y + Y+ ++ K + K +D ++ ++P+VE+ M++IFM LV+GITSG+WIW +K +S+QN
Sbjct: 37 RCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEP----PRGSSMLPPMF------RPQRPSTGHDLQQHKD--SLSRTSCENPGKFHHVE-KSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQL-YVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVASQQ----------KCKMNNQTKNLDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQN 537
BLAST of frizzled-like vs. uniprot
Match: gi|17433096|sp|Q9W742|FZ10B_XENLA (RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=Xfz10-B; AltName: Full=Frizzled-9; Short=Fz-9; Short=Xfz9; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 371.318 bits (952), Expect = 3.20239e-117
Identity = 202/533 (37.90%), Postives = 309/533 (57.97%), Query Frame = 2
Query:  107 QCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGK---MCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRCDA--DIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVD-IIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQN 1681
+C I P+C+D+ Y TRMPN MG +Q EA+ ++ ++ PL+ C +LK FLCS+Y P+C + +T P+ C+ C+ + +C P M +N WP+ LDC KLP +C+ + D+ P +S + +F R + + H+M G ++C S + +C C + D+ ++ +DK FA IW+ WSLLC SS FT++TF + RF YPE+PI+FLSMCY +S G ++ G ++ C QL Y++ G E+T C I FL+LY+F AS+LWWVILT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG C+VG+ D +AL GF+L+P YL+IG +F+ G+ ++ +R+ N +LEKLM +IGVFS+LY VP TC I Y + ++ ++ + D S K +D + ++P+VE+ M++IFM LV+GITSG+WIW +K +S+QN
Sbjct: 33 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDEA----PRSSSILPPIF------RPQRPNSGHEMYPKDPKGR---SSCENSGKFHHVEKSASCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILA------TQDKCKMD----SQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTVQSWQN 532
BLAST of frizzled-like vs. uniprot
Match: gi|52782829|sp|Q8BKG4|FZD10_MOUSE (RecName: Full=Frizzled-10; Short=Fz-10; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 370.548 bits (950), Expect = 6.54442e-117
Identity = 201/546 (36.81%), Postives = 317/546 (58.06%), Query Frame = 2
Query:  107 QCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGK---MCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRC--DADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVD-IIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQN-CGRGAKKDGQQQ 1717
+C + P+C+D+ Y TRMPN MG +Q EA+ ++ ++ PL+ C +L+ FLCS+Y P+C + +T P+ C+ C+ + +C P M + WP+ LDC KLP +C+ + D EP+ M F L + ++ + H LK G + P + + + + +C C D+ ++ DDK FA +WL WS+LC SS FT++TF + +RF YPE+PI+FLSMCY +S G ++ G ++ C QL Y++ G E+T C + FL+LY+F AS+LWWV+LT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG C+VG+ D +AL GF+LVP YL+IG +F+ G+ ++ +R+ N +LEKLM +IGVFS+LY VP TC I Y + Y+ ML ++ + T K D ++ ++P+VE+ M+++ M LV+GITSG+W+W +K +S+Q+ C RG K+ +++
Sbjct: 34 KCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSD-----EPSRGSGM---FPPLFRPQRPHSAQEHP---LKDGGPGRAGCDNPGKFHHVE-KSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWK-MLATQHKCKMNNQT---------KTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGLKRKSRRK 547
BLAST of frizzled-like vs. uniprot
Match: gi|17433043|sp|Q9DEB5|FZ10A_XENLA (RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=Xfz10-A; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 370.548 bits (950), Expect = 9.06638e-117
Identity = 201/537 (37.43%), Postives = 306/537 (56.98%), Query Frame = 2
Query:  107 QCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGK---MCLTPDSFSQDKEVTKEPNNSETMKELF--QQLDKARKKNDKNMHQMELLKKAGSF----ASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVD-IIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQN 1681
+C I P+C+D+ Y TRMPN MG +Q EA+ ++ ++ PL+ C +LK FLCS+Y P+C + +T P+ C+ C+ + +C P M +N WP+ LDC KLP +C+ + D+ P S + +F Q+ + K+ + +G F S +C P + D+ ++ DDK FA IW+ WS+LC SS FT++TF + RF YPE+PI+FLSMCY +S G ++ G ++ C QL Y++ G E+T C I FL+LY+F AS+LWWVILT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG C+VG+ D +AL GF+L+P YL+IG +F+ G+ ++ +R+ N +LEKLM +IGVFS+LY VP TC I Y + ++ ++ + D S K +D + ++P+VE+ M++IFM LV+GITSG+WIW +K +S+QN
Sbjct: 39 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDET----PRGSSMLPPIFRPQRPSSGHEIYPKDPTSRSSCENSGKFHHVEKSASCAP-------------LCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILA------TQDKCKMD----SQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTVQSWQN 538
BLAST of frizzled-like vs. uniprot
Match: gi|17433091|sp|Q9ULW2|FZD10_HUMAN (RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz10; AltName: Full=FzE7; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 369.777 bits (948), Expect = 1.56657e-116
Identity = 202/549 (36.79%), Postives = 314/549 (57.19%), Query Frame = 2
Query:   50 LIMQIAALPSEKGSNDVYK----QCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGK---MCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKAGSFASTTCLPSQINMGQLPNTTCMHRC--DADIRFNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPA-LPSVEMRMLRIFMNLVIGITSGIWIWGNK 1666
L++Q+ + S D+ + +C I P+C+D+ Y TRMPN MG +Q EA+ ++ ++ PL+ C +L+ FLCS+Y P+C + +T P+ C+ C+ + +C P M +N WP+ LDC KLP +C+ + D EP LF L + ++ + H LK G P + + + + +C C D+ ++ +DK FA +WL W++LC SS FT++TF + RF YPE+PI+FLSMCY +S G L+ G ++ C QL Y++ G E+T C + FL+LY+F AS+LWWV+LT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG C+VG+ D +AL GF+L+P YL+IG +F+ G+ ++ +R+ N +LEKLM +IG+FS+LY VP TC I Y + Y+ + L A ++ + T K +D + A +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct: 10 LVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSD-----EPTRGSG---LFPPLFRPQRPHSAQEHP---LKDGGPGRGGCDNPGKFHHVE-KSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQT---------KTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 308.531 bits (789), Expect = 4.13823e-93
Identity = 203/618 (32.85%), Postives = 290/618 (46.93%), Query Frame = 2
Query:   92 NDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTG---KMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKA-----------------------RKKNDKNMHQMELLKKAGSFASTTCLPSQINMG---------QLPNTTCMHR---------------CDADIR---FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQNCGR----GAKKDGQQQCEMKQIEVVNPITNNYS 1768
D +C IT P+C+ + Y T PN+M +Q+EA V ++PL+ ++CS LK FLCSMY PIC + P C+ C+ +S C P M Y+ WP + CE LP G +C+ S+++ + + + R +N KN + K +G S +C I +G Q+P H C + F+ D+K FA +W+ WS LC S+L T+ TF +T RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWVIL+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G C+VGN + D L F+L P VYL+IG TFL G+ S+ ++R +Q +LEKLM +IG+FS+LY VP T I Y +++ YF+ +KAL + C KG P + ML+ FM L +GITSG+WIW K +S++ R + G Q +KQ PI + Y+
Sbjct: 58 KDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP---PIPHPYA 645
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 308.531 bits (789), Expect = 4.13823e-93
Identity = 203/618 (32.85%), Postives = 290/618 (46.93%), Query Frame = 2
Query:   92 NDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTG---KMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKA-----------------------RKKNDKNMHQMELLKKAGSFASTTCLPSQINMG---------QLPNTTCMHR---------------CDADIR---FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQNCGR----GAKKDGQQQCEMKQIEVVNPITNNYS 1768
D +C IT P+C+ + Y T PN+M +Q+EA V ++PL+ ++CS LK FLCSMY PIC + P C+ C+ +S C P M Y+ WP + CE LP G +C+ S+++ + + + R +N KN + K +G S +C I +G Q+P H C + F+ D+K FA +W+ WS LC S+L T+ TF +T RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWVIL+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G C+VGN + D L F+L P VYL+IG TFL G+ S+ ++R +Q +LEKLM +IG+FS+LY VP T I Y +++ YF+ +KAL + C KG P + ML+ FM L +GITSG+WIW K +S++ R + G Q +KQ PI + Y+
Sbjct: 58 KDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP---PIPHPYA 645
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 308.531 bits (789), Expect = 4.13823e-93
Identity = 203/618 (32.85%), Postives = 290/618 (46.93%), Query Frame = 2
Query:   92 NDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTG---KMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKA-----------------------RKKNDKNMHQMELLKKAGSFASTTCLPSQINMG---------QLPNTTCMHR---------------CDADIR---FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQNCGR----GAKKDGQQQCEMKQIEVVNPITNNYS 1768
D +C IT P+C+ + Y T PN+M +Q+EA V ++PL+ ++CS LK FLCSMY PIC + P C+ C+ +S C P M Y+ WP + CE LP G +C+ S+++ + + + R +N KN + K +G S +C I +G Q+P H C + F+ D+K FA +W+ WS LC S+L T+ TF +T RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWVIL+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G C+VGN + D L F+L P VYL+IG TFL G+ S+ ++R +Q +LEKLM +IG+FS+LY VP T I Y +++ YF+ +KAL + C KG P + ML+ FM L +GITSG+WIW K +S++ R + G Q +KQ PI + Y+
Sbjct: 58 KDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP---PIPHPYA 645
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|221512906|ref|NP_001137971.1| (frizzled 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 308.531 bits (789), Expect = 4.13823e-93
Identity = 203/618 (32.85%), Postives = 290/618 (46.93%), Query Frame = 2
Query:   92 NDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTG---KMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKA-----------------------RKKNDKNMHQMELLKKAGSFASTTCLPSQINMG---------QLPNTTCMHR---------------CDADIR---FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQNCGR----GAKKDGQQQCEMKQIEVVNPITNNYS 1768
D +C IT P+C+ + Y T PN+M +Q+EA V ++PL+ ++CS LK FLCSMY PIC + P C+ C+ +S C P M Y+ WP + CE LP G +C+ S+++ + + + R +N KN + K +G S +C I +G Q+P H C + F+ D+K FA +W+ WS LC S+L T+ TF +T RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWVIL+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G C+VGN + D L F+L P VYL+IG TFL G+ S+ ++R +Q +LEKLM +IG+FS+LY VP T I Y +++ YF+ +KAL + C KG P + ML+ FM L +GITSG+WIW K +S++ R + G Q +KQ PI + Y+
Sbjct: 58 KDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP---PIPHPYA 645
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|442633300|ref|NP_001262036.1| (frizzled 2, isoform E [Drosophila melanogaster])

HSP 1 Score: 308.531 bits (789), Expect = 4.13823e-93
Identity = 203/618 (32.85%), Postives = 290/618 (46.93%), Query Frame = 2
Query:   92 NDVYKQCTVITEPVCQDVRYTHTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDAEAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTG---KMCLTPDSFSQDKEVTKEPNNSETMKELFQQLDKA-----------------------RKKNDKNMHQMELLKKAGSFASTTCLPSQINMG---------QLPNTTCMHR---------------CDADIR---FNLDDKTFASIWLIGWSLLCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRRNVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWFLSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCFVGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCIDPSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALYEYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIWIWGNK--KSFQNCGR----GAKKDGQQQCEMKQIEVVNPITNNYS 1768
D +C IT P+C+ + Y T PN+M +Q+EA V ++PL+ ++CS LK FLCSMY PIC + P C+ C+ +S C P M Y+ WP + CE LP G +C+ S+++ + + + R +N KN + K +G S +C I +G Q+P H C + F+ D+K FA +W+ WS LC S+L T+ TF +T RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWVIL+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G C+VGN + D L F+L P VYL+IG TFL G+ S+ ++R +Q +LEKLM +IG+FS+LY VP T I Y +++ YF+ +KAL + C KG P + ML+ FM L +GITSG+WIW K +S++ R + G Q +KQ PI + Y+
Sbjct: 58 KDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP---PIPHPYA 645
The following BLAST results are available for this feature:
BLAST of frizzled-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|6005762|ref|NP_009128.1|5.912370e-11736.79frizzled-10 precursor [Homo sapiens][more]
gi|4503835|ref|NP_003499.1|1.834290e-11136.73frizzled-9 precursor [Homo sapiens][more]
gi|22547161|ref|NP_036325.2|1.886750e-10434.34frizzled-4 precursor [Homo sapiens][more]
gi|4503825|ref|NP_003496.1|1.200440e-10135.42frizzled-1 [Homo sapiens][more]
gi|4503827|ref|NP_001457.1|4.559280e-10034.69frizzled-2 precursor [Homo sapiens][more]
back to top
BLAST of frizzled-like vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150297110.000000e+062.64SmedSxlregen_c141340_g1_i1|m.45153|m.4173[more]
SMU150053873.203270e-11834.26SmedAsxldir_c106380_g2_i1|m.75515|m.16659[more]
SMU150145343.232760e-8932.04SmedAsxldir_c94917_g1_i1|m.35515|m.3335[more]
SMU150400876.651910e-8934.74dd_smedV4_7210_0_1|m.35691|m.13357[more]
SMU150361996.288780e-8832.44SmedSxlregen_c90692_g1_i1|m.42870|m.18187[more]
back to top
BLAST of frizzled-like vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17433077|sp|Q9PWH2|FZD10_CHICK1.306240e-11738.01RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-... [more]
gi|17433096|sp|Q9W742|FZ10B_XENLA3.202390e-11737.90RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=X... [more]
gi|52782829|sp|Q8BKG4|FZD10_MOUSE6.544420e-11736.81RecName: Full=Frizzled-10; Short=Fz-10; AltName: C... [more]
gi|17433043|sp|Q9DEB5|FZ10A_XENLA9.066380e-11737.43RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=X... [more]
gi|17433091|sp|Q9ULW2|FZD10_HUMAN1.566570e-11636.79RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz1... [more]
back to top
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17737633|ref|NP_524155.1|4.138230e-9332.85frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|4.138230e-9332.85frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|4.138230e-9332.85frizzled 2, isoform C [Drosophila melanogaster][more]
gi|221512906|ref|NP_001137971.1|4.138230e-9332.85frizzled 2, isoform D [Drosophila melanogaster][more]
gi|442633300|ref|NP_001262036.1|4.138230e-9332.85frizzled 2, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_020264 ID=Pgr_020264|Name=frizzled-like|organism=Phagocata gracilis|type=mRNA|length=2179bp
AAAAGTCGGTATAAAAATGAGACAAATGTTTTTTTTATGGTCTGGAATTT
TAATAATGCAAATTGCCGCTTTACCGTCTGAGAAAGGATCGAATGACGTG
TACAAGCAGTGTACAGTGATCACTGAACCGGTTTGCCAGGACGTCAGGTA
TACTCATACGAGAATGCCCAATCAAATGGGAATTTATTCCCAGAATGAGG
CTAGCAAACGAGTCCGGGACTACTATCCGTTGATTAATCTCCAATGTAGT
CATTATTTGAAATTATTTCTCTGTTCGATGTACTTTCCCATTTGTGATGC
GGAAGCTGCGACATCGACTCCATCGGTGCAACCCTGTCAACGGTTCTGTC
AGCATGTGAAGTCCCGCTGTGAGCCCTTTATGACGAGCACTTATAATGTA
CCGTGGCCTAATGAACTGGACTGTGAGAAACTTCCTGGAACCGGGAAAAT
GTGCTTGACCCCAGATTCATTCAGTCAAGACAAAGAAGTCACCAAAGAGC
CAAATAATTCAGAGACAATGAAAGAACTCTTCCAGCAACTGGATAAGGCA
CGAAAGAAAAATGACAAAAACATGCATCAAATGGAATTGTTGAAGAAGGC
CGGTTCATTTGCAAGTACAACGTGTCTACCATCTCAGATCAATATGGGTC
AGTTGCCAAACACAACATGTATGCATCGGTGTGACGCCGATATACGGTTC
AACCTAGACGATAAGACATTTGCCAGTATTTGGCTGATTGGATGGAGCCT
CTTGTGTTTGATATCGTCACTCTTCACCATCATCACGTTTTCCTGCAACA
CTAACAGATTCATGTATCCAGAGAAGCCAATTGTCTTCCTGTCAATGTGC
TACTTTTTCCATTCTTGCGGCAGTCTTTTAGGTGCTATATTAGGGCGACG
GAACGTCATTTGTCGTCCGTTCGACGAGCAGTTGGACTACTTGGTCGGTT
ATGGCAATGAGACGACCTGGTGTAAGATTAACTTCCTAATGTTGTACTTC
TTCAGTTCTGCCAGCGCCCTGTGGTGGGTGATATTAACGGTCACGTGGTT
TCTTTCAGCGTCTAGACATTGGGGCTACGAGGCCATTGAGTCCATCAGCA
GTGTACTACATCTCATTAGTTGGGGTATTCCAGCACTGAAATCCATTTTT
GTGCTTATTCTCCATAAAATCGACGCCGATGAATTGACTGGCCAGTGTTT
TGTTGGTAACAACGACAAAGACGCTTTGATTGGCTTTATATTGGTCCCGC
AAATCGTATATTTGCTCATTGGGGTCACATTTCTTGGACTAGGATACTAC
TCAATACTCAAGGTCAGAAAATCATTTCTGCGACAGCCTAGTTGTATAGA
TCCGTCAAATTTAAAGCGGCTTGAGAAGTTGATGGCAAAAATTGGGGTTT
TCTCCATTCTTTACATAGTGCCAGTGACTTGCACTATTGTCAGCTATGTT
ATAGACGTCTTCAAGACCCCATACTTTGACGTAATGCTGAAGGCCCTCTA
TGAATACTCCTCAGATTGTGTGACTTTCAAAGGTCTGTCCTGGTCCTTGG
CCAAGTGTGTCGATATAATCCAGCCCGCGCTGCCATCTGTGGAGATGAGG
ATGCTAAGAATATTCATGAATCTTGTCATTGGGATCACGTCTGGAATATG
GATCTGGGGCAACAAAAAATCGTTTCAAAATTGCGGTAGAGGGGCCAAAA
AAGATGGCCAACAACAGTGTGAGATGAAACAGATCGAAGTTGTGAATCCG
ATCACGAATAATTACTCATATCTGAAGCACAGTGACTGTAGTAGTCCAAC
CCAGGGCTGGAATTACGCCCCAGTATCAGAGTCCCAGTCAACTCGAGGCG
TCACATCCCAGACACCCATTGAGGGAATCGTGGCGCCACACAATTCATCA
ATCAGCGAAGCATCCAGTAGGCATTGAAGAATAAAAAGATCTCCCAGGTT
TTCAGCCAACAAACACACACACACACAAATACGTCAATTGCGCTACAACT
TCGACTTTTCGTCAATAATGAAAATAAGAATATTTCGATTTTTATTTAAA
TTTTTGACATTTGTGATAATACTTTGAACCTTGACTACGTTTTCATCCGT
CAAATGTTGACTACATTTACTTATTAATGCCGTAGATTTAGAGTTCTTTT
TTTGTGAATAGATTTTTTTTTCGTTAAAA

Design Primers for frizzled-like

back to top

protein sequence

>Pgr_020264-protein ID=Pgr_020264-protein|Name=frizzled-like|organism=Phagocata gracilis|type=polypeptide|length=642bp
KVGIKMRQMFFLWSGILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRY
THTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDA
EAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKM
CLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKA
GSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSL
LCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRR
NVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWF
LSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCF
VGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCID
PSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALY
EYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIW
IWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSPT
QGWNYAPVSESQSTRGVTSQTPIEGIVAPHNSSISEASSRH*
back to top

coding sequence

>Pgr_020264.2.1927 ID=Pgr_020264.2.1927|Name=Pgr_020264.2.1927|organism=Phagocata gracilis|type=CDS|length=1926bp
AAAGTCGGTATAAAAATGAGACAAATGTTTTTTTTATGGTCTGGAATTTT
AATAATGCAAATTGCCGCTTTACCGTCTGAGAAAGGATCGAATGACGTGT
ACAAGCAGTGTACAGTGATCACTGAACCGGTTTGCCAGGACGTCAGGTAT
ACTCATACGAGAATGCCCAATCAAATGGGAATTTATTCCCAGAATGAGGC
TAGCAAACGAGTCCGGGACTACTATCCGTTGATTAATCTCCAATGTAGTC
ATTATTTGAAATTATTTCTCTGTTCGATGTACTTTCCCATTTGTGATGCG
GAAGCTGCGACATCGACTCCATCGGTGCAACCCTGTCAACGGTTCTGTCA
GCATGTGAAGTCCCGCTGTGAGCCCTTTATGACGAGCACTTATAATGTAC
CGTGGCCTAATGAACTGGACTGTGAGAAACTTCCTGGAACCGGGAAAATG
TGCTTGACCCCAGATTCATTCAGTCAAGACAAAGAAGTCACCAAAGAGCC
AAATAATTCAGAGACAATGAAAGAACTCTTCCAGCAACTGGATAAGGCAC
GAAAGAAAAATGACAAAAACATGCATCAAATGGAATTGTTGAAGAAGGCC
GGTTCATTTGCAAGTACAACGTGTCTACCATCTCAGATCAATATGGGTCA
GTTGCCAAACACAACATGTATGCATCGGTGTGACGCCGATATACGGTTCA
ACCTAGACGATAAGACATTTGCCAGTATTTGGCTGATTGGATGGAGCCTC
TTGTGTTTGATATCGTCACTCTTCACCATCATCACGTTTTCCTGCAACAC
TAACAGATTCATGTATCCAGAGAAGCCAATTGTCTTCCTGTCAATGTGCT
ACTTTTTCCATTCTTGCGGCAGTCTTTTAGGTGCTATATTAGGGCGACGG
AACGTCATTTGTCGTCCGTTCGACGAGCAGTTGGACTACTTGGTCGGTTA
TGGCAATGAGACGACCTGGTGTAAGATTAACTTCCTAATGTTGTACTTCT
TCAGTTCTGCCAGCGCCCTGTGGTGGGTGATATTAACGGTCACGTGGTTT
CTTTCAGCGTCTAGACATTGGGGCTACGAGGCCATTGAGTCCATCAGCAG
TGTACTACATCTCATTAGTTGGGGTATTCCAGCACTGAAATCCATTTTTG
TGCTTATTCTCCATAAAATCGACGCCGATGAATTGACTGGCCAGTGTTTT
GTTGGTAACAACGACAAAGACGCTTTGATTGGCTTTATATTGGTCCCGCA
AATCGTATATTTGCTCATTGGGGTCACATTTCTTGGACTAGGATACTACT
CAATACTCAAGGTCAGAAAATCATTTCTGCGACAGCCTAGTTGTATAGAT
CCGTCAAATTTAAAGCGGCTTGAGAAGTTGATGGCAAAAATTGGGGTTTT
CTCCATTCTTTACATAGTGCCAGTGACTTGCACTATTGTCAGCTATGTTA
TAGACGTCTTCAAGACCCCATACTTTGACGTAATGCTGAAGGCCCTCTAT
GAATACTCCTCAGATTGTGTGACTTTCAAAGGTCTGTCCTGGTCCTTGGC
CAAGTGTGTCGATATAATCCAGCCCGCGCTGCCATCTGTGGAGATGAGGA
TGCTAAGAATATTCATGAATCTTGTCATTGGGATCACGTCTGGAATATGG
ATCTGGGGCAACAAAAAATCGTTTCAAAATTGCGGTAGAGGGGCCAAAAA
AGATGGCCAACAACAGTGTGAGATGAAACAGATCGAAGTTGTGAATCCGA
TCACGAATAATTACTCATATCTGAAGCACAGTGACTGTAGTAGTCCAACC
CAGGGCTGGAATTACGCCCCAGTATCAGAGTCCCAGTCAACTCGAGGCGT
CACATCCCAGACACCCATTGAGGGAATCGTGGCGCCACACAATTCATCAA
TCAGCGAAGCATCCAGTAGGCATTGA
back to top
Gene Groups
frizzled-like is similar in sequence to the genes of this group: GG4852
Gene NameGene ID
SMU15029711SMU15029711
frizzled-likeDdo_014376
frizzled-likeGsp_021429
Pgr_015739Pgr_015739
frizzled-likePgr_020264
frizzled-likePmo_014048

Gene Group Protein Sequences

>SMU15029711

MCINLYLYIYKTIIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQC
VPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLK
LFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSE
ELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGN
RIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHD
KVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFY
ASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSA
SALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILIL
HKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLK
VRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAY
KMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRI
FMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTI
QNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIVPPPNN
SSISDDSSRH*
>Ddo_014376 frizzled-like
GVLQTQKRFSVFIFTKYFFGYYFFAVTIIMKSIILIVIGINLLFGFVSAK
LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLI
NIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMK
ESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYN
QLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICS
ANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIV
FLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINF
LMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPA
LKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFL
SLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCT
VVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLP
SVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQ
INQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYPNIEFALPSISVPS
EVVFPPPNNSSISDASSKH*
>Gsp_021429 frizzled-like
MMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPN
SVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQ
IVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESF
SLDDLDQQNQSQGDDVQQLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQ
CLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCF
LTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSY
DDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHW
GYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQN
VLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRL
EKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCV
TKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKT
LKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY
NNWKLNSSYPANEFGLATVSVPSEIIPPPNNSSISDLSSKH*
>Pgr_015739 Pgr_015739
MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRM
PNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTS
PPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPE
SFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSE
TKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLS
SLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR
PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASR
HWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNH
LPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLK
RLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPD
CVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK
KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQN
WTYCPSVLSEPTVCGIVNEPCEGIVAPNNSSKSETSSRH*
>Pgr_020264 frizzled-like
KVGIKMRQMFFLWSGILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRY
THTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDA
EAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKM
CLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKA
GSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSL
LCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRR
NVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWF
LSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCF
VGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCID
PSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALY
EYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIW
IWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSPT
QGWNYAPVSESQSTRGVTSQTPIEGIVAPHNSSISEASSRH*
>Pmo_014048 frizzled-like
KLSVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTR
MPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAI
STPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTP
DSFSLDKEVEKEPSHVDTMKNLLQKLELSLKQSDKDKSRIDLLMKAGLYA
SAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANIWLISWSLLCLV
SSLLTIITFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVIC
RPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSAS
RHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNS
DKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNL
KRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSA
DCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGN
KKSFRYCGRNKKDIQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGWSYVP
TLASEHAVGGLSQTPVEGIMAPNNSSISEVSSKH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.