piwi-1, Pgr_018001 (mRNA) Phagocata gracilis

Overview
Namepiwi-1
Unique NamePgr_018001
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2744
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of piwi-1 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 276.174 bits (705), Expect = 4.52726e-78
Identity = 227/837 (27.12%), Postives = 376/837 (44.92%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFYVIEPSLQPEL---IVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVK----MPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIK--ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWT-KEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRI--NTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRL--RVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGD---DKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKT-GKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDG----NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
+E +A+RGG ++ F+ + + + L K G G V L +N+ P+ + Y + M + LR L + K FDG LF P + ++ E F N +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + N +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + S + +G ++S+ +Y++++YN +T KQP ++S+ +R + P ++ IP ELC+L G +D R++ N+ K L + P +R R++ ++ K + WGL ++ ++ GR L ++ + N + +D K I + ++ RN N I ++ + + ++ I + RT L + + + + DK A K +QCV R T + +A K +QM K+G + W V++ + M+ G+D +H T G+RSI V SI+ T++ S E D L +AA+ + +P R I+YRDGVGD QL YE L ++S+ N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + P +Q TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKC----HAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 276.174 bits (705), Expect = 4.52726e-78
Identity = 227/837 (27.12%), Postives = 376/837 (44.92%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFYVIEPSLQPEL---IVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVK----MPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIK--ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWT-KEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRI--NTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRL--RVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGD---DKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKT-GKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDG----NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
+E +A+RGG ++ F+ + + + L K G G V L +N+ P+ + Y + M + LR L + K FDG LF P + ++ E F N +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + N +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + S + +G ++S+ +Y++++YN +T KQP ++S+ +R + P ++ IP ELC+L G +D R++ N+ K L + P +R R++ ++ K + WGL ++ ++ GR L ++ + N + +D K I + ++ RN N I ++ + + ++ I + RT L + + + + DK A K +QCV R T + +A K +QM K+G + W V++ + M+ G+D +H T G+RSI V SI+ T++ S E D L +AA+ + +P R I+YRDGVGD QL YE L ++S+ N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + P +Q TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKC----HAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 276.174 bits (705), Expect = 4.52726e-78
Identity = 227/837 (27.12%), Postives = 376/837 (44.92%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFYVIEPSLQPEL---IVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVK----MPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIK--ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWT-KEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRI--NTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRL--RVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGD---DKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKT-GKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDG----NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
+E +A+RGG ++ F+ + + + L K G G V L +N+ P+ + Y + M + LR L + K FDG LF P + ++ E F N +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + N +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + S + +G ++S+ +Y++++YN +T KQP ++S+ +R + P ++ IP ELC+L G +D R++ N+ K L + P +R R++ ++ K + WGL ++ ++ GR L ++ + N + +D K I + ++ RN N I ++ + + ++ I + RT L + + + + DK A K +QCV R T + +A K +QM K+G + W V++ + M+ G+D +H T G+RSI V SI+ T++ S E D L +AA+ + +P R I+YRDGVGD QL YE L ++S+ N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + P +Q TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKC----HAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 276.174 bits (705), Expect = 4.52726e-78
Identity = 227/837 (27.12%), Postives = 376/837 (44.92%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFYVIEPSLQPEL---IVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVK----MPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIK--ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWT-KEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRI--NTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRL--RVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGD---DKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKT-GKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDG----NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
+E +A+RGG ++ F+ + + + L K G G V L +N+ P+ + Y + M + LR L + K FDG LF P + ++ E F N +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + N +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + S + +G ++S+ +Y++++YN +T KQP ++S+ +R + P ++ IP ELC+L G +D R++ N+ K L + P +R R++ ++ K + WGL ++ ++ GR L ++ + N + +D K I + ++ RN N I ++ + + ++ I + RT L + + + + DK A K +QCV R T + +A K +QM K+G + W V++ + M+ G+D +H T G+RSI V SI+ T++ S E D L +AA+ + +P R I+YRDGVGD QL YE L ++S+ N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + P +Q TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKC----HAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 276.174 bits (705), Expect = 4.52726e-78
Identity = 227/837 (27.12%), Postives = 376/837 (44.92%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFYVIEPSLQPEL---IVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVK----MPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIK--ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWT-KEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRI--NTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRL--RVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGD---DKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKT-GKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDG----NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
+E +A+RGG ++ F+ + + + L K G G V L +N+ P+ + Y + M + LR L + K FDG LF P + ++ E F N +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + N +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + S + +G ++S+ +Y++++YN +T KQP ++S+ +R + P ++ IP ELC+L G +D R++ N+ K L + P +R R++ ++ K + WGL ++ ++ GR L ++ + N + +D K I + ++ RN N I ++ + + ++ I + RT L + + + + DK A K +QCV R T + +A K +QM K+G + W V++ + M+ G+D +H T G+RSI V SI+ T++ S E D L +AA+ + +P R I+YRDGVGD QL YE L ++S+ N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + P +Q TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKC----HAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 1223.76 bits (3165), Expect = 0
Identity = 573/795 (72.08%), Postives = 684/795 (86.04%), Query Frame = 3
Query:  147 KRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHK-EDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIR-DKVHLALVFIGDDKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2525
+RGGLQ+RF +IEP+LQP+ + DK+GKDGR V+LKSNYANF + +GPF+MYDV M KS+R KLELL + A++K + QPFCFDGRRLFT S+WH ED E IKD E+SIR L TF++N+EEYYQMINI+FNNIQ+FMGQE+IGR FFLGSNC + GP+FFK DNFKILGG+ TT+TRGTN++GTA TLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITKYNNKTYRISDIKE+DV++E++L KISY +YFKQRYNI L KQPFVISR++R + KE EN+PE P E DQSLSIPGELC+LCGFSDSERSNINLQK+LG+VLKREPRERL DI DFC WT GK+ +M+ WG+ +E QP+TI GREL V++FSN+ +INTK DDWKFGE+KFD+P GT HRFG+LVV+RNP FN FI+DVKRE+ RLR+++T+ S+ SCR+NE+ED LTDFIR KVH+ALVFI DDK+YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTM+ GLDTFHSKTGKRS+QASVFSIS+KF+QY+SFVNSSKGK+E+H+NL +NF A+ F++KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K+IE +YENQ LPQIIY++VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+KT + + + PS LQ TY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG PP I+DRIRERLFYL*
Sbjct: 58 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 906.36 bits (2341), Expect = 0
Identity = 453/818 (55.38%), Postives = 602/818 (73.59%), Query Frame = 3
Query:  138 KVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQP--FCFDGRRLFTPSQWHKE-DIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNC--NESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISR----MRR-------IGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKASPFM-EKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRDK---VHLALVFIGDDKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQN--LPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2525
K+ RGGL++ F ++EP+LQP I +K G GR V L+SN+ F V F MYD L K++L + V + + P FCFDGRRLFT +WH E DI+ F+ ++++++R ++T + TEEYYQMIN++ NN+QV +GQERIG+ +FL N +E GPTFF+ ++FK+LGGF TTL RGT G TLLY+ERINRVLN+NSV YN+ +D LIGRD+ITKYNNKTYRIS+IKE++V E+ E+ G +SY +YFK+RYNI LT G QPFV++R MRR G+ +++ E + EAP+E D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI +CNW K A+ M KW L+++N+P+ I GREL +V S +IN K DDWKFG V+FDI +H +++V+RN Q+ F++DV++E+ +R+ +G V +C N++E L D R +ALVF+ DD++YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTM+ G+DT+H+K+ K+SIQASVFSI+S FTQY+SFVNS KG+ E+H+ L +NF A+ F+ +++ LPQR +++RDGVGD+QL FTK +E DA+ +IE++Y+ +PQIIY+IVKKR+ K F GNNPNPGT+VD+++VKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L +K G P+ P++LQ TYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP I++RIR RLFYL*
Sbjct: 21 KMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 250.366 bits (638), Expect = 1.68917e-69
Identity = 211/752 (28.06%), Postives = 348/752 (46.28%), Query Frame = 3
Query:  390 CFDGRRLFTPSQW-HKEDIETFNIKDEEVSIRFLATFIENT--EEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIY--------NKNQL-----DLLIGRDVITKYNNKTYRISDIK-ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLS--IPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFC-NWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEV-FSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNP-GQFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRD---KVHLALVFIG---DDKIYARVKNFT-ISTGLLTQCV---TVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGK-RSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDG-------NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2525
FDG L+ P +KE I N ++ + F N E + N++F I+ + +IGR +F R +I G+ T++ N DG LL + ++V+ +SVY+I NK Q+ + L+G+ V+T +NN+ YRI+DI + E + G KISY DYFK Y + + +QP ++S+ + P+ KE D L IP ELC L G +D + L + L + P++R + +F N +A + WG+ +E V I ++N + F N+ ++ ++K + G + IL+ ++ + N + + + R+ V ++ + E++L + R+ V L + + +D+ Y +K F + + +Q V T++ G + VA +Q+ AKLG + W V++ + MV GLD +H G+ RS+ A V S ++ T++ S + + E L + + + ++ N LP+ +YRDGV D QL + +K E + K+ ES + P ++Y +V+KRI+ + + NNPNPGTIVD V + N Y+F+LVSQ +GT TPT+Y VL D + P Q+Q Y H+Y+NW GT+RVP P YAH+LA +VG + ++ D RLFYL*
Sbjct: 265 AFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEK---------KIVLDRRRMEIWPGYVTSIQ---NFDGG--LLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSN-----SRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-----VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFES-FSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 114.775 bits (286), Expect = 8.50121e-26
Identity = 111/451 (24.61%), Postives = 194/451 (43.02%), Query Frame = 3
Query: 1233 FMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVV--ERNPGQFNQFIDDVKREMSRLRVSHTIGSVLS-------CRTNEIEDFLTDFIRD------KVHLALVFIGDDKIYARVKNF-TISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPT------------MVAGLDTFHSKTGK----RSIQASVFSISSKFTQYLSFVNSSKGKSE------YHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFF---------KDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLA 2444
F++ + +E++ + + + R L+G E QR W KF P + + V ER+ + ++ + D++ ++ ++ +G + IE TD IR+ K+ L + + +D+ Y VK F + G++TQC+ + T + ++++ KLG GV ++ P MV G+D H + + +S+ A V S+ + T Y + + K E + + + ++ P+R I YRDGV + Q K+E A+ + + E P I YI+V+KR ++FF + GN P+ GT+VD+ + ++FYL S +GT+ P +Y+VL D N D +LQ FTY L H+Y ++ P PT+YAH A
Sbjct: 540 FLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPG--AANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLG----GVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPS-GTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFD---ENNWGSD-------ELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAA 970
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15002348 (Asxlregen_comp67380_c1_seq2|m.28664|m.41329)

HSP 1 Score: 110.538 bits (275), Expect = 1.45148e-24
Identity = 95/328 (28.96%), Postives = 152/328 (46.34%), Query Frame = 3
Query: 1557 IRDKVHLALVFIGDDKIYARVKNF-TISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE-LKMVPT----MVAGLDTFHSKTG---KRSIQASVFSISSKFTQYLSFVN---SSKGKS------EYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKF----FKDG----NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTV 2462
I++ + L +V + +D Y VK+ I G++TQC+ N + + + + ++++ AKLG W ++ ++ P MV G+D H +S+ A V SI+ T Y + + S GK E D + + K +L + K LP I YRDGV + Q +E A+ E +N P+I YIIV+KR +++F +D N PG ++D + ++FYL S +GT+ P +Y V++D N + LQ FTY L ++ F +I P PTHYAH LA G +
Sbjct: 627 IKEDLDLLVVVVRNDVEYKLVKDIGDIELGIVTQCICYENLCRQKNLSQYM--GNLMLKVNAKLGGVNWEIKNIEYAPIKGLFMVFGVDVTHPSNNDGLSKSVAAVVGSINKTATIYSAVIKKQLSKDGKDAVEIVVEMEDMVQRLIKVFYDLNQSK---LPDHLIFYRDGVSEGQFEIVFNHEIAAIQYACEKFKKNYK-PKITYIIVQKRHNIRFCPITLEDSVGRCKNVLPGVVIDNDITHSREFDFYLCSHEGIQGTSKPVHYYVILDENRWN----------SNDLQEFTYFLCYVCFRCTRSISYPAPTHYAH-LAAFRGRI 937
BLAST of piwi-1 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 1224.15 bits (3166), Expect = 0
Identity = 572/794 (72.04%), Postives = 683/794 (86.02%), Query Frame = 3
Query:  147 KRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHK-EDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIR-DKVHLALVFIGDDKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2522
+RGGLQ+RF +IEP+LQP+ + DK+GKDGR V+LKSNYANF + +GPF+MYDV M KS+R KLELL + A++K + QPFCFDGRRLFT S+WH ED E IKD E+SIR L TF++N+EEYYQMINI+FNNIQ+FMGQE+IGR FFLGSNC + GP+FFK DNFKILGG+ TT+TRGTN++GTA TLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITKYNNKTYRISDIKE+DV++E++L KISY +YFKQRYNI L KQPFVISR++R + KE EN+PE P E DQSLSIPGELC+LCGFSDSERSNINLQK+LG+VLKREPRERL DI DFC WT GK+ +M+ WG+ +E QP+TI GREL V++FSN+ +INTK DDWKFGE+KFD+P GT HRFG+LVV+RNP FN FI+DVKRE+ RLR+++T+ S+ SCR+NE+ED LTDFIR KVH+ALVFI DDK+YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTM+ GLDTFHSKTGKRS+QASVFSIS+KF+QY+SFVNSSKGK+E+H+NL +NF A+ F++KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K+IE +YENQ LPQIIY++VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+KT + + + PS LQ TY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG PP I+DRIRERLFYL
Sbjct: 15 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808
BLAST of piwi-1 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 928.317 bits (2398), Expect = 0
Identity = 450/806 (55.83%), Postives = 594/806 (73.70%), Query Frame = 3
Query:  138 KVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQP--FCFDGRRLFTPSQWHK-EDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNES--LSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKASPFME-KWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRDK---VHLALVFIGDDKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQ--NLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2522
++ +RGGLQKRF ++EP LQP DK+G G+ V L+SN+ F V + MYD L KL+L V K N P FC+DGRRLFT W + DI+ F I +++VS+R ++TF+ +TEEYYQMIN++ NN+Q+ MGQE+IG+ +FLGSN N+ + GPTFF+ +NFK+LGGF TTL RGT +G TLLY+ERINRVLN+NSV YN+ +D LIGRD++TKYNNKTYRIS+IKE++++E E+ G +SY YFK+RYNI LTT +QPFV++R+++I K N+ EAP++ D +L+I GELCFLCGFSD E+SNI+LQK+LG VLKR PRERL DI FC+W K S M KWGL+++N P+ I GREL +V S QRIN K DDWKFG+V+F++ G +H +++V+RN Q+ F++DV+ E+ +LR IG VL C N++E L D +R +ALVF+ DD++YA+VK+FTISTGLLTQCVT RNGTNR+D+RR+VV+ K+VMQ+F+K GYDPW +++KM PTM+ G+DTFH+K K+SI ASVFSI+S F+QY+SF NS KGK E+HD LS NFKAA+ F+ + LP R ++YRDGVGDSQL FTK++E DA+ ++E++Y+ +PQIIY+IVKKRI K F G+N NPGTIVD+++VKPNF+EF+LVSQR T+GTA+PTNYNVL DT+ N K G I P++LQ TY LTHLYFNWMGTIRVPVP HYAH+LAEL+G VH+G+ P +I++RIR RLFYL
Sbjct: 14 RIERRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818
BLAST of piwi-1 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 901.353 bits (2328), Expect = 0
Identity = 451/814 (55.41%), Postives = 596/814 (73.22%), Query Frame = 3
Query:  138 KVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQP--FCFDGRRLFTPSQWHKE-DIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNC--NESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISR----MRR---IGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKASPFM-EKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRDK---VHLALVFIGDDKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSF-VNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQN--LPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2522
K+ RGGL+ F ++EP+LQP I +K G GR V L+SN+ F V F MYD L K++L + V + + P FCFDGRRLFT +WH E DI+ F+ ++++++R ++T + TEEYYQMIN++ NN+QV +GQERIG+ +FL N +E GPTFF+ ++FK+LGGF TTL RGT G TLLY+ERINRVLN+NSV YN+ +D LIGRD+ITKYNNKTYRIS+IKE++V E+ E+ G +SY +YFK+RYNI LT G QPFV++R MRR + E + EAP+E D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI +CNW K A+ M KW L+++N+P+ I GREL +V S +IN K DDWKFG V+FDI +H +++V+RN Q+ F++DV++E+ +R+ +G V +C N++E L D R +ALVF+ DD++YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTM+ G+DT+H+K+ K+SIQASVFSI+S FTQY+SF VNS KG+ E+H+ L +NF A+ F+ +++ LPQR +++RDGVGD+QL FTK +E DA+ +IE++Y+ +PQIIY+IVKKR+ K F GNNPNPGT+VD+++VKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L +K G P+ P++LQ TYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP I++RIR RLFYL
Sbjct: 21 KMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833
BLAST of piwi-1 vs. uniprot
Match: gi|226701015|sp|A6N7Y9|PIWL1_CHICK (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 284.263 bits (726), Expect = 2.27885e-80
Identity = 231/841 (27.47%), Postives = 390/841 (46.37%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFYVIEPSLQ---PELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDV----KMPMKSLRGKLELLYS--VASTKADNQPFCFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIKELDVSEEIEL---NGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKA-SPFMEKWGLELENQPVTIMGRELNGVEVF--SNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMSRLRVSHTIGSVLSC--RTNEIEDFLTDFIRDKVHLALVFIGD---DKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFH-SKTGKRSIQASVFSISSKFTQYLS-FVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
+E +A RGG ++ F+ + + + + K G G + L +N+ P+ + Y V +M + LR L + + T A FDG LF P + + E + N +D ++I + Q NIIF + M ++IGR ++ + P + GF +++ + +L + +++L +V Y++Y + + LIG V+TKYNN+TYR+ DI + D + + +G +ISY DY+K++YN ++ QP +IS+ RR ++ N+ P + IP ELC+L G ++ R++ N+ K L + P +R R+I + K+ + + WGL ++ ++ GR + ++ N N + +D + V I A + ++ RN N + ++ + + + +++ RT L I ++ + + DK A K + +QCV R T + + K +QM K+G + W VE+ + M+ G+D +H + +GK+SI V S++ K T++ S V S+G+ E D L + A+ + LP R I+YRDGVGD QL YE L +++V ++ N P++ I+VKKR+S +FF NP PGT+VD +V +P +Y+F++VSQ G PT+YNV+ DT + + P +Q TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N ++SD RL+YL
Sbjct: 80 QELSLADRGGRRRDFHDLGVNTRQAIEHVRESKTGSSGAMIKLIANFFRLTSRPQWALYQYHVDYNPEMEARRLRSGLLFQHEDLIGKTHA------FDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYYNPKD---------PVSIPNHRLMVWPGFTSSILQYEES-----IMLCADVSHKILRSETVLDFMYSLYEQVEERRFRDACAKELIGVIVLTKYNNRTYRVDDI-DWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRR----KRGNVTVGP--------VVLIP-ELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGIRMNKATMIEVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQ-EIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN-PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDT----------SKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPN-LLLSD----RLYYL 867
BLAST of piwi-1 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 283.108 bits (723), Expect = 4.90117e-80
Identity = 222/820 (27.07%), Postives = 375/820 (45.73%), Query Frame = 3
Query:  129 EERKVAKRGGLQKRFY---VIEPSLQPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMY--DVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDI----ETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYN-IYNKNQ-----------LDLLIGRDVITKYNNKTYRISDIK-ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDF-CNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKS-SDDWKFGEVKFD-IPAGTQHRFGILVVERNPG---QFNQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIG---DDKIYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFH-SKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFK--DGN--NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTN 2477
++ K+ +RGG ++ F+ V L + K G G A+ L++N+ P + Y D K PM+S R + LL+ T + FDG LF P++ + ET N + E+++ ++ Q NI+F I + ++IGR ++ + P + I GF TT+ + + +L + ++VL +V + +Y+ Q L+G ++TKYNNKTYRI DI + + + +IS+ +YFK +Y + +T G Q ++S ++R+G + ++ +P E C+L G +D R++ N+ K L S + P +R I+ N + G + WGL EN+ +++ GR L + + + DW I + + + RN Q ++ V M +R+ + R + L + + + +V + DK K + +QCV R T + VA K +QM K+G + W VE+ + M+ G+D +H + GKRSI A V S++ +++ S E D L + + A+ + N+LP R I+YRDGVGD L YE +++ I+++ ++ P++ ++VKKRIS +FF DG NP PGT++D +V +P +Y+F++VSQ G PT+YNV+ D + + P +Q TY L H+Y+NW G +RVP P YAH+LA LVG ++H+ N
Sbjct: 70 QQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLG--KAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYESS-----IMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGR----------PPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMG-IRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 268.085 bits (684), Expect = 1.22595e-75
Identity = 218/808 (26.98%), Postives = 375/808 (46.41%), Query Frame = 3
Query:  198 PELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKM--PMKSLRGKLELLYS----VASTKADNQPFCFDGRRLFTPSQW-HKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKYNNKTYRISDIK-ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFC-NWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQF-NQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRD-----KVHLALVFIGDDKIYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGK-RSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
P+LI G G +V + NY F Y+V+ P+ S+ +++ L + TK FDG L+ P +K + +D E+ IR L E Q+ NI+F+ + + + R F S P ++ G+ T + + +L + +R+L + +V + Y ++ +L+G V+T+YNN+TY+I+DI + + + + E+ SY +Y+KQ +NI + QP + S + GI A +E Q IP ELC+L G D RS+ L + + + + P +R ++ F N + A + WGL L N I GR+++ +++ +K ++ S ++ V ++ I++ RN Q +D++K+ L ++ + +++S + I+ ++ R+ ++ + + D YA +K S + +Q + + N + V K V+QM KLG W V++ M+ G+D++H + + S+ A V SI+S ++Q+ S + E + LS +F+ A+ ++R + LP IIYRDG+GD QLY YE + E V N+ +I YI+V+KRI+ + F NP PGT+VD+ + K N Y+F+LVSQ +GT TPT+Y VL D P +Q +Y L LY+NW GT+R+P YAH+LA L+G ++ R +++ + E+LFYL
Sbjct: 117 PDLIY---GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT------FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLR----------DDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 268.085 bits (684), Expect = 1.22595e-75
Identity = 218/808 (26.98%), Postives = 375/808 (46.41%), Query Frame = 3
Query:  198 PELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKM--PMKSLRGKLELLYS----VASTKADNQPFCFDGRRLFTPSQW-HKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKYNNKTYRISDIK-ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFC-NWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQF-NQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRD-----KVHLALVFIGDDKIYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGK-RSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
P+LI G G +V + NY F Y+V+ P+ S+ +++ L + TK FDG L+ P +K + +D E+ IR L E Q+ NI+F+ + + + R F S P ++ G+ T + + +L + +R+L + +V + Y ++ +L+G V+T+YNN+TY+I+DI + + + + E+ SY +Y+KQ +NI + QP + S + GI A +E Q IP ELC+L G D RS+ L + + + + P +R ++ F N + A + WGL L N I GR+++ +++ +K ++ S ++ V ++ I++ RN Q +D++K+ L ++ + +++S + I+ ++ R+ ++ + + D YA +K S + +Q + + N + V K V+QM KLG W V++ M+ G+D++H + + S+ A V SI+S ++Q+ S + E + LS +F+ A+ ++R + LP IIYRDG+GD QLY YE + E V N+ +I YI+V+KRI+ + F NP PGT+VD+ + K N Y+F+LVSQ +GT TPT+Y VL D P +Q +Y L LY+NW GT+R+P YAH+LA L+G ++ R +++ + E+LFYL
Sbjct: 117 PDLIY---GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT------FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLR----------DDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 268.085 bits (684), Expect = 1.22595e-75
Identity = 218/808 (26.98%), Postives = 375/808 (46.41%), Query Frame = 3
Query:  198 PELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKM--PMKSLRGKLELLYS----VASTKADNQPFCFDGRRLFTPSQW-HKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKYNNKTYRISDIK-ELDVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFC-NWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQF-NQFIDDVKREMSRLRVSHTIGSVLSCRTNEIEDFLTDFIRD-----KVHLALVFIGDDKIYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHSKTGK-RSIQASVFSISSKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2522
P+LI G G +V + NY F Y+V+ P+ S+ +++ L + TK FDG L+ P +K + +D E+ IR L E Q+ NI+F+ + + + R F S P ++ G+ T + + +L + +R+L + +V + Y ++ +L+G V+T+YNN+TY+I+DI + + + + E+ SY +Y+KQ +NI + QP + S + GI A +E Q IP ELC+L G D RS+ L + + + + P +R ++ F N + A + WGL L N I GR+++ +++ +K ++ S ++ V ++ I++ RN Q +D++K+ L ++ + +++S + I+ ++ R+ ++ + + D YA +K S + +Q + + N + V K V+QM KLG W V++ M+ G+D++H + + S+ A V SI+S ++Q+ S + E + LS +F+ A+ ++R + LP IIYRDG+GD QLY YE + E V N+ +I YI+V+KRI+ + F NP PGT+VD+ + K N Y+F+LVSQ +GT TPT+Y VL D P +Q +Y L LY+NW GT+R+P YAH+LA L+G ++ R +++ + E+LFYL
Sbjct: 117 PDLIY---GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT------FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLR----------DDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 264.618 bits (675), Expect = 1.44884e-74
Identity = 214/793 (26.99%), Postives = 367/793 (46.28%), Query Frame = 3
Query:  195 QPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKM--PMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDE-----EVSIRFLATFIENTE-EYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKYNNKTYRISDIKELDVSEE-IELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKAS-PFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWK--FGEVK-FDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMS----RLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKI--YARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHS-KTGKRSIQASVFSIS-SKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNL--PQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2459
+P +V K G DG V L++N+ K P+ Y V+ +++ R ++ +L + A+ + FDG +LFT ++ +E I + K + ++SI+F+ FI E + Q++N+I + E +GR F + +K FK ++ G+ T++ R +D LL E ++V+ ++Y+I + N LDL+ V+T YNN+TYRI+D+ + G IS+ +Y+ +YNI + QP +IS+ R D A + + + ELC + G + RSN L +++ S + P++R + F + + S + W +EL+ + GR + + + ++ + DW+ F + + P+ R+ ++ +RN + +D + R S R+R + RT + D +R L L + +D Y+ +K + + TQ VT++ NR +A K +Q+ KLGY PW +EL + M G D S + KR+ A + S+ + + Y S V + L A+ ++ + LP R + YRDGV L ++E +++ +++ Y L PQ+ YI+V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT +PT+YNVL + + P ++Q TY + HLY+NW GT RVP YA +LA LVGT
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNR------------DKALKTNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEF-IIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 264.618 bits (675), Expect = 1.44884e-74
Identity = 214/793 (26.99%), Postives = 367/793 (46.28%), Query Frame = 3
Query:  195 QPELIVDKVGKDGRAVALKSNYANFKVGPKGPFFMYDVKM--PMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDE-----EVSIRFLATFIENTE-EYYQMINIIFNNIQVFMGQERIGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKYNNKTYRISDIKELDVSEE-IELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENLENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLRDISDFCNWTKEGKAS-PFMEKWGLELENQPVTIMGRELNGVEVFSNKQRINTKSSDDWK--FGEVK-FDIPAGTQHRFGILVVERNPGQFNQFIDDVKREMS----RLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKI--YARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMVAGLDTFHS-KTGKRSIQASVFSIS-SKFTQYLSFVNSSKGKSEYHDNLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIIESVYENQNL--PQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2459
+P +V K G DG V L++N+ K P+ Y V+ +++ R ++ +L + A+ + FDG +LFT ++ +E I + K + ++SI+F+ FI E + Q++N+I + E +GR F + +K FK ++ G+ T++ R +D LL E ++V+ ++Y+I + N LDL+ V+T YNN+TYRI+D+ + G IS+ +Y+ +YNI + QP +IS+ R D A + + + ELC + G + RSN L +++ S + P++R + F + + S + W +EL+ + GR + + + ++ + DW+ F + + P+ R+ ++ +RN + +D + R S R+R + RT + D +R L L + +D Y+ +K + + TQ VT++ NR +A K +Q+ KLGY PW +EL + M G D S + KR+ A + S+ + + Y S V + L A+ ++ + LP R + YRDGV L ++E +++ +++ Y L PQ+ YI+V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT +PT+YNVL + + P ++Q TY + HLY+NW GT RVP YA +LA LVGT
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNR------------DKALKTNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEF-IIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826
The following BLAST results are available for this feature:
BLAST of piwi-1 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|4.527260e-7827.12piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|4.527260e-7827.12PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|4.527260e-7827.12PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|4.527260e-7827.12PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|4.527260e-7827.12PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of piwi-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150261770.000000e+072.08SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159470.000000e+055.38SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150001111.689170e-6928.06Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150329888.501210e-2624.61SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
SMU150023481.451480e-2428.96Asxlregen_comp67380_c1_seq2|m.28664|m.41329[more]
back to top
BLAST of piwi-1 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000000e+072.04RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000000e+055.83RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000000e+055.41RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|226701015|sp|A6N7Y9|PIWL1_CHICK2.278850e-8027.47RecName: Full=Piwi-like protein 1[more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE4.901170e-8027.07RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221513719|ref|NP_001036627.2|1.225950e-7526.98argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|1.225950e-7526.98argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|1.225950e-7526.98argonaute 3, isoform F [Drosophila melanogaster][more]
gi|17136736|ref|NP_476875.1|1.448840e-7426.99piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|1.448840e-7426.99piwi, isoform B [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_018001 ID=Pgr_018001|Name=piwi-1|organism=Phagocata gracilis|type=mRNA|length=2744bp
AAAACATTGCCTGATGAGGACAATGTTGTTTAAATTGATTTCTCTTTGTC
AAAACTGGTTTGTTTTCTAAACTATATTTATAAATTGTTATTTACATAAT
TGTTATTGTTTTTGAATATTTCAAGATGGAGGAGAGAAAGGTAGCCAAAC
GAGGAGGATTACAAAAGAGATTTTATGTCATTGAACCGAGTCTTCAACCA
GAATTAATTGTTGATAAGGTTGGAAAAGATGGTCGTGCAGTTGCATTAAA
ATCTAATTATGCAAATTTTAAAGTGGGACCAAAAGGTCCTTTTTTTATGT
ATGACGTAAAAATGCCAATGAAAAGTCTACGGGGTAAGTTGGAATTATTA
TACAGTGTGGCGTCCACAAAGGCTGATAATCAACCTTTTTGTTTTGATGG
CCGTCGGCTTTTTACACCCTCACAATGGCATAAAGAAGACATTGAAACGT
TTAACATTAAAGACGAAGAGGTATCAATTAGATTTTTGGCTACTTTTATA
GAAAATACAGAAGAATATTATCAAATGATTAATATAATCTTTAATAATAT
TCAAGTTTTTATGGGACAAGAGCGTATTGGTAGAGCTTTTTTTCTTGGAT
CAAATTGCAATGAGAGCTTGTCTAAATGTGGACCCACATTTTTCAAGAGA
GATAATTTTAAAATATTAGGTGGTTTTTGTACGACTCTTACTAGAGGAAC
AAATCAAGACGGTACTGCTTGTACACTACTTTATTTGGAACGAATAAATC
GAGTCTTGAATGAAAATTCGGTTTATAACATTTATAATAAGAATCAACTT
GACTTACTAATTGGCCGTGATGTCATAACGAAATATAACAACAAGACATA
TCGAATTAGCGATATTAAAGAACTTGACGTATCTGAAGAAATTGAGTTAA
ATGGTGTTAAAATTAGTTATTTTGACTACTTTAAACAACGTTATAATATT
ACCTTAACCACCGGTAAGCAGCCATTCGTTATTTCTAGAATGAGAAGAAT
TGGAATTATCCAAAAGGAAAATCTAGAAAATGATCCTGAAGCCCCCAAAG
AAGCCGACCAAAGCTTGTCTATTCCAGGGGAGTTATGTTTCTTGTGTGGC
TTTTCGGACAGTGAAAGAAGTAATATTAATTTACAGAAAAGCTTAGGTTC
CGTTTTAAAACGAGAACCGCGTGAACGTTTGCGAGATATTAGTGATTTTT
GTAACTGGACAAAGGAAGGAAAGGCATCTCCTTTTATGGAAAAATGGGGA
TTGGAATTAGAAAATCAACCTGTTACAATCATGGGTAGAGAACTCAATGG
TGTTGAGGTGTTTTCAAACAAGCAACGTATTAATACGAAATCATCGGACG
ATTGGAAATTTGGGGAAGTTAAATTTGATATCCCCGCTGGTACACAACAT
AGATTTGGAATATTAGTCGTTGAAAGAAATCCAGGGCAGTTCAATCAATT
CATTGACGATGTTAAAAGAGAAATGAGTAGATTAAGAGTCAGTCACACAA
TTGGATCTGTTTTGTCATGCAGAACGAATGAAATCGAAGATTTCCTTACA
GATTTCATACGTGATAAGGTTCATTTGGCTCTTGTATTTATTGGAGATGA
TAAAATATATGCAAGAGTTAAAAATTTTACCATAAGTACTGGTTTGTTGA
CACAATGTGTAACTGTTCGGAATGGCACAAATCGCGATGATCGAAGGAGA
AAAGTAGTTGCGGATAAAAGTGTAATGCAAATGTTTGCTAAGTTGGGGTA
TGATCCATGGGGAGTTGAATTAAAAATGGTACCAACTATGGTTGCAGGAT
TGGATACGTTTCATAGTAAAACTGGCAAGCGGTCTATACAAGCCTCTGTA
TTTAGTATAAGCTCTAAATTTACACAATATTTAAGTTTTGTTAATTCATC
GAAAGGGAAAAGTGAATATCACGATAATTTGAGTCAAAATTTCAAGGCCG
CAATAAATTTATTTAGAGATAAATTTAATACCTTGCCTCAGCGGTTTATA
ATTTACCGTGATGGAGTTGGTGATTCTCAATTGTATTTTACAAAGAAGTA
CGAAACGGATGCGGTTTTGAAAATCATTGAATCTGTTTATGAAAATCAAA
ACCTTCCACAAATTATATACATAATCGTTAAAAAAAGAATTAGTGTTAAA
TTTTTTAAAGATGGTAACAATCCAAATCCAGGCACAATTGTTGATGAAAA
AGTTGTTAAACCAAATTTCTATGAATTCTATCTTGTTTCACAGCGAACCA
CTAAAGGTACTGCAACGCCAACAAACTACAATGTTTTGATGGACACGCAA
TTAACTAATCGTAAGACGGGCGATAAAGCTCCAATTCCACCTAGTCAATT
GCAACATTTTACATATGCGTTGACTCATTTATATTTCAACTGGATGGGTA
CTATACGTGTTCCTGTACCAACACATTATGCTCATCGTTTGGCTGAGCTG
GTTGGTACTGTGCACCGTGGCACCAATCCACCGGTTATCTCTGACCGAAT
ACGAGAGCGATTGTTTTATCTTTAAAACATTAATCAAGTGTTAAATGTTT
TTCTGTTGTCTCTGGTAAATACATTTTTGTATTAACAAATTTATATTAGA
CTAATTGTAGACCTTGTTGTTCTATGTGTTGCATGTTATTTAGAATTTTT
TTGCTTTATGTTTATTAATATAATTAATTGTGTGATATTTACTTTTAATT
TTGTCATTACGTTTACTTTAATATATTTATTTGGTATTTACAAA

Design Primers for piwi-1

back to top

protein sequence

>Pgr_018001-protein ID=Pgr_018001-protein|Name=piwi-1|organism=Phagocata gracilis|type=polypeptide|length=800bp
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
back to top

coding sequence

>Pgr_018001.126.2525 ID=Pgr_018001.126.2525|Name=Pgr_018001.126.2525|organism=Phagocata gracilis|type=CDS|length=2400bp
ATGGAGGAGAGAAAGGTAGCCAAACGAGGAGGATTACAAAAGAGATTTTA
TGTCATTGAACCGAGTCTTCAACCAGAATTAATTGTTGATAAGGTTGGAA
AAGATGGTCGTGCAGTTGCATTAAAATCTAATTATGCAAATTTTAAAGTG
GGACCAAAAGGTCCTTTTTTTATGTATGACGTAAAAATGCCAATGAAAAG
TCTACGGGGTAAGTTGGAATTATTATACAGTGTGGCGTCCACAAAGGCTG
ATAATCAACCTTTTTGTTTTGATGGCCGTCGGCTTTTTACACCCTCACAA
TGGCATAAAGAAGACATTGAAACGTTTAACATTAAAGACGAAGAGGTATC
AATTAGATTTTTGGCTACTTTTATAGAAAATACAGAAGAATATTATCAAA
TGATTAATATAATCTTTAATAATATTCAAGTTTTTATGGGACAAGAGCGT
ATTGGTAGAGCTTTTTTTCTTGGATCAAATTGCAATGAGAGCTTGTCTAA
ATGTGGACCCACATTTTTCAAGAGAGATAATTTTAAAATATTAGGTGGTT
TTTGTACGACTCTTACTAGAGGAACAAATCAAGACGGTACTGCTTGTACA
CTACTTTATTTGGAACGAATAAATCGAGTCTTGAATGAAAATTCGGTTTA
TAACATTTATAATAAGAATCAACTTGACTTACTAATTGGCCGTGATGTCA
TAACGAAATATAACAACAAGACATATCGAATTAGCGATATTAAAGAACTT
GACGTATCTGAAGAAATTGAGTTAAATGGTGTTAAAATTAGTTATTTTGA
CTACTTTAAACAACGTTATAATATTACCTTAACCACCGGTAAGCAGCCAT
TCGTTATTTCTAGAATGAGAAGAATTGGAATTATCCAAAAGGAAAATCTA
GAAAATGATCCTGAAGCCCCCAAAGAAGCCGACCAAAGCTTGTCTATTCC
AGGGGAGTTATGTTTCTTGTGTGGCTTTTCGGACAGTGAAAGAAGTAATA
TTAATTTACAGAAAAGCTTAGGTTCCGTTTTAAAACGAGAACCGCGTGAA
CGTTTGCGAGATATTAGTGATTTTTGTAACTGGACAAAGGAAGGAAAGGC
ATCTCCTTTTATGGAAAAATGGGGATTGGAATTAGAAAATCAACCTGTTA
CAATCATGGGTAGAGAACTCAATGGTGTTGAGGTGTTTTCAAACAAGCAA
CGTATTAATACGAAATCATCGGACGATTGGAAATTTGGGGAAGTTAAATT
TGATATCCCCGCTGGTACACAACATAGATTTGGAATATTAGTCGTTGAAA
GAAATCCAGGGCAGTTCAATCAATTCATTGACGATGTTAAAAGAGAAATG
AGTAGATTAAGAGTCAGTCACACAATTGGATCTGTTTTGTCATGCAGAAC
GAATGAAATCGAAGATTTCCTTACAGATTTCATACGTGATAAGGTTCATT
TGGCTCTTGTATTTATTGGAGATGATAAAATATATGCAAGAGTTAAAAAT
TTTACCATAAGTACTGGTTTGTTGACACAATGTGTAACTGTTCGGAATGG
CACAAATCGCGATGATCGAAGGAGAAAAGTAGTTGCGGATAAAAGTGTAA
TGCAAATGTTTGCTAAGTTGGGGTATGATCCATGGGGAGTTGAATTAAAA
ATGGTACCAACTATGGTTGCAGGATTGGATACGTTTCATAGTAAAACTGG
CAAGCGGTCTATACAAGCCTCTGTATTTAGTATAAGCTCTAAATTTACAC
AATATTTAAGTTTTGTTAATTCATCGAAAGGGAAAAGTGAATATCACGAT
AATTTGAGTCAAAATTTCAAGGCCGCAATAAATTTATTTAGAGATAAATT
TAATACCTTGCCTCAGCGGTTTATAATTTACCGTGATGGAGTTGGTGATT
CTCAATTGTATTTTACAAAGAAGTACGAAACGGATGCGGTTTTGAAAATC
ATTGAATCTGTTTATGAAAATCAAAACCTTCCACAAATTATATACATAAT
CGTTAAAAAAAGAATTAGTGTTAAATTTTTTAAAGATGGTAACAATCCAA
ATCCAGGCACAATTGTTGATGAAAAAGTTGTTAAACCAAATTTCTATGAA
TTCTATCTTGTTTCACAGCGAACCACTAAAGGTACTGCAACGCCAACAAA
CTACAATGTTTTGATGGACACGCAATTAACTAATCGTAAGACGGGCGATA
AAGCTCCAATTCCACCTAGTCAATTGCAACATTTTACATATGCGTTGACT
CATTTATATTTCAACTGGATGGGTACTATACGTGTTCCTGTACCAACACA
TTATGCTCATCGTTTGGCTGAGCTGGTTGGTACTGTGCACCGTGGCACCA
ATCCACCGGTTATCTCTGACCGAATACGAGAGCGATTGTTTTATCTTTAA
back to top
Gene Groups
piwi-1 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.