slit, Pgr_016847 (mRNA) Phagocata gracilis

Overview
Nameslit
Unique NamePgr_016847
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length9736
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of slit vs. RefSeq Human
Match: gi|11321571|ref|NP_003053.1| (slit homolog 3 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 767.689 bits (1981), Expect = 0
Identity = 502/1586 (31.65%), Postives = 774/1586 (48.80%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSNVSDVC-------------SEPEMCK-----NGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCL 4642
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ ++KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C CTCS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ + E C + CP+ C C +VDC+ L +P ++ LP+ + + LS NK++EV + + ++ L+ N+++ + VF LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC L W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + L +L + LS N I+ L + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCKNNG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ C ++N C + C L D + C C PG+ GK C + DDC ++C++ A CVD +NGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + D C MCK G +C +ND ++ + C+C+ GFSG+ C ++ C ++++ I+ +C + +V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGCG---------------------PQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 2 Score: 767.689 bits (1981), Expect = 0
Identity = 502/1586 (31.65%), Postives = 774/1586 (48.80%), Query Frame = -2
Query: 5095 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSNVSDVC-------------SEPEMCK-----NGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCL 9549
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ ++KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C CTCS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ + E C + CP+ C C +VDC+ L +P ++ LP+ + + LS NK++EV + + ++ L+ N+++ + VF LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC L W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + L +L + LS N I+ L + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCKNNG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ C ++N C + C L D + C C PG+ GK C + DDC ++C++ A CVD +NGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + D C MCK G +C +ND ++ + C+C+ GFSG+ C ++ C ++++ I+ +C + +V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGCG---------------------PQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 3 Score: 215.312 bits (547), Expect = 7.77633e-55
Identity = 140/473 (29.60%), Postives = 245/473 (51.80%), Query Frame = 2
Query:  185 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 1591
+CP C+C+ ++C ++ L +P +PE L L N ++V+ T F K+ NL+ + LSNN+I + G FD + + +L L N ++ + +F L L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCHLAWL ++++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C KG++++P+ +P + EL L N + + + LS ++L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+ + + + +++F C + + C+ C N TCT + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE-LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCTQDPVE 937

HSP 4 Score: 215.312 bits (547), Expect = 7.77633e-55
Identity = 140/473 (29.60%), Postives = 245/473 (51.80%), Query Frame = -2
Query: 8146 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 9552
+CP C+C+ ++C ++ L +P +PE L L N ++V+ T F K+ NL+ + LSNN+I + G FD + + +L L N ++ + +F L L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCHLAWL ++++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C KG++++P+ +P + EL L N + + + LS ++L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+ + + + +++F C + + C+ C N TCT + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE-LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCTQDPVE 937

HSP 5 Score: 179.104 bits (453), Expect = 9.31168e-44
Identity = 121/484 (25.00%), Postives = 217/484 (44.83%), Query Frame = 2
Query: 1541 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
P ++CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL ++L+ N+++ + + FR + D++ L+L +N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C +E S N + CP+ C C + VDC L +IP +P E+ L++N++K + +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFT--LCMAPVHLRGFNVADVQKKEYVC-PAPHSEPPSCN-------------------ANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 179.104 bits (453), Expect = 9.31168e-44
Identity = 121/484 (25.00%), Postives = 217/484 (44.83%), Query Frame = -2
Query: 6958 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8196
P ++CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL ++L+ N+++ + + FR + D++ L+L +N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C +E S N + CP+ C C + VDC L +IP +P E+ L++N++K + +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFT--LCMAPVHLRGFNVADVQKKEYVC-PAPHSEPPSCN-------------------ANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. RefSeq Human
Match: gi|429836873|ref|NP_001258875.1| (slit homolog 3 protein isoform 1 precursor [Homo sapiens])

HSP 1 Score: 763.451 bits (1970), Expect = 0
Identity = 502/1592 (31.53%), Postives = 774/1592 (48.62%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCT------EETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSNVSDVC-------------SEPEMCK-----NGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCL 4642
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ ++KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C CTCS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ + E C + CP+ C C +VDC+ L +P ++ LP+ + + LS NK++EV + + ++ L+ N+++ + VF LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC L W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + L +L + LS N I+ L + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCKNNG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ C ++N C + C L D + C C PG+ GK C + DDC ++C++ A CVD +NGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + D C MCK G +C +ND ++ + C+C+ GFSG+ C ++ C ++++ I+ +C + +V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGCG---------------------PQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1527

HSP 2 Score: 763.451 bits (1970), Expect = 0
Identity = 502/1592 (31.53%), Postives = 774/1592 (48.62%), Query Frame = -2
Query: 5095 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCT------EETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSNVSDVC-------------SEPEMCK-----NGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCL 9549
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ ++KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C CTCS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ + E C + CP+ C C +VDC+ L +P ++ LP+ + + LS NK++EV + + ++ L+ N+++ + VF LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC L W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + L +L + LS N I+ L + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCKNNG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ C ++N C + C L D + C C PG+ GK C + DDC ++C++ A CVD +NGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + D C MCK G +C +ND ++ + C+C+ GFSG+ C ++ C ++++ I+ +C + +V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGCG---------------------PQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1527

HSP 3 Score: 213.386 bits (542), Expect = 3.70253e-54
Identity = 133/440 (30.23%), Postives = 233/440 (52.95%), Query Frame = 2
Query:  185 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNC 1492
+CP C+C+ ++C ++ L +P +PE L L N ++V+ T F K+ NL+ + LSNN+I + G FD + + +L L N ++ + +F L L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCHLAWL ++++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C KG++++P+ +P + EL L N + + + LS ++L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+ + + + +++F C
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE-LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQC 905

HSP 4 Score: 213.386 bits (542), Expect = 3.70253e-54
Identity = 133/440 (30.23%), Postives = 233/440 (52.95%), Query Frame = -2
Query: 8245 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNC 9552
+CP C+C+ ++C ++ L +P +PE L L N ++V+ T F K+ NL+ + LSNN+I + G FD + + +L L N ++ + +F L L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCHLAWL ++++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C KG++++P+ +P + EL L N + + + LS ++L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+ + + + +++F C
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE-LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQC 905

HSP 5 Score: 178.718 bits (452), Expect = 1.26916e-43
Identity = 121/484 (25.00%), Postives = 217/484 (44.83%), Query Frame = 2
Query: 1541 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
P ++CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL ++L+ N+++ + + FR + D++ L+L +N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C +E S N + CP+ C C + VDC L +IP +P E+ L++N++K + +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFT--LCMAPVHLRGFNVADVQKKEYVC-PAPHSEPPSCN-------------------ANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 178.718 bits (452), Expect = 1.26916e-43
Identity = 121/484 (25.00%), Postives = 217/484 (44.83%), Query Frame = -2
Query: 6958 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8196
P ++CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL ++L+ N+++ + + FR + D++ L+L +N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C +E S N + CP+ C C + VDC L +IP +P E+ L++N++K + +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFT--LCMAPVHLRGFNVADVQKKEYVC-PAPHSEPPSCN-------------------ANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. RefSeq Human
Match: gi|188528675|ref|NP_003052.2| (slit homolog 1 protein precursor [Homo sapiens])

HSP 1 Score: 758.829 bits (1958), Expect = 0
Identity = 498/1582 (31.48%), Postives = 762/1582 (48.17%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEE------QDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS--GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGC----KVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEP---EMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYM---CRR-KMIKNHIKDPDTT---CLSLRRVRYRYCEGSCADSKMQSDIQKSFFH-----------KPVETASSR-------CCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 4639
+ CP C C +++C L+ +P+++P T +L L GN I + K DF+ + L++LQL N+I +E G FD + +L +LRLNRN + LP+ LF + L +LDL +N +Q I F G +LKNL LD+N+I I E R + L T + N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + C C CTCS GIV C GKG+ ++P +LP ++ E+ L N I + A S Y+ L++I L+ N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L+ ++ L+L NP C+C L WL+ FLR E SG A C P+ L + + I+S +F C+ +E+ +D + + E C + CP C C VV+C+ L+ +P+ + ST + L+ N++ + L +L KI+LS N++ I+ F + E++L +N+L+ + + FR L L TL L +N I+CI SF N++ L+L NP +CNCQL W+ W R I G CQ+P L+ PL + F+C E C +CP +C C T V CS L +P GIP N TELYLD N TL + L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L ND++T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P++M+ K + + F C A + AKCD C+ SPC+N G C Y+C CP + G++CE +++C PC+NGG C + + C CP GF GP C N +DC DH C NG C D V Y C C + GK C C D+NPC + C PD RC C PG+ G NC++N DDC+ + C+N A C+D VN Y C C GY G+LC+ P P +S C +C N CV QG+ + C+C G+ G +C+ L S+ F D+Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + ++ LNS +++GG P + AA + + + T F GC++ L INN+ DF K + V PGC K+ + + + H + P C +G Q + Y C C+DG+SG CN+ + CR + + H + T C+ CE +S+ + D + F +P+ R CCQ + + R+ F+C G + V +C C
Sbjct: 30 GASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSE-CNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEGQEEGG----------------------CLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPA-------------------------PKSPCEGTECQNGANCVD--QGN-RPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDNF----GKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHG---QCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCE---QESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530

HSP 2 Score: 758.829 bits (1958), Expect = 0
Identity = 498/1582 (31.48%), Postives = 762/1582 (48.17%), Query Frame = -2
Query: 5098 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEE------QDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS--GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGC----KVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEP---EMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYM---CRR-KMIKNHIKDPDTT---CLSLRRVRYRYCEGSCADSKMQSDIQKSFFH-----------KPVETASSR-------CCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 9561
+ CP C C +++C L+ +P+++P T +L L GN I + K DF+ + L++LQL N+I +E G FD + +L +LRLNRN + LP+ LF + L +LDL +N +Q I F G +LKNL LD+N+I I E R + L T + N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + C C CTCS GIV C GKG+ ++P +LP ++ E+ L N I + A S Y+ L++I L+ N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L+ ++ L+L NP C+C L WL+ FLR E SG A C P+ L + + I+S +F C+ +E+ +D + + E C + CP C C VV+C+ L+ +P+ + ST + L+ N++ + L +L KI+LS N++ I+ F + E++L +N+L+ + + FR L L TL L +N I+CI SF N++ L+L NP +CNCQL W+ W R I G CQ+P L+ PL + F+C E C +CP +C C T V CS L +P GIP N TELYLD N TL + L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L ND++T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P++M+ K + + F C A + AKCD C+ SPC+N G C Y+C CP + G++CE +++C PC+NGG C + + C CP GF GP C N +DC DH C NG C D V Y C C + GK C C D+NPC + C PD RC C PG+ G NC++N DDC+ + C+N A C+D VN Y C C GY G+LC+ P P +S C +C N CV QG+ + C+C G+ G +C+ L S+ F D+Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + ++ LNS +++GG P + AA + + + T F GC++ L INN+ DF K + V PGC K+ + + + H + P C +G Q + Y C C+DG+SG CN+ + CR + + H + T C+ CE +S+ + D + F +P+ R CCQ + + R+ F+C G + V +C C
Sbjct: 30 GASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSE-CNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEGQEEGG----------------------CLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPA-------------------------PKSPCEGTECQNGANCVD--QGN-RPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDNF----GKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHG---QCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCE---QESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530
BLAST of slit vs. RefSeq Human
Match: gi|574281850|ref|NP_001276064.1| (slit homolog 2 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 751.125 bits (1938), Expect = 0
Identity = 498/1587 (31.38%), Postives = 788/1587 (49.65%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISE-----------------DISRLK--------NLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSE----------------------PEMCK----NGGV-CQEQND--------EKKKYKCI----------CKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 4639
CP C C +++C LR+VP ++P T +L+L GN I + KTDF+ + +L++LQL N+I+TIE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q I F G ++KNL LD N+I I + +I+RL L T + N L C+CHLAWL+ +++ +P+V C P L ++ + EF C SD + ++ P + C CTCS IV C GKG+ +P +LP +I E+ L N I V+ A S YK L++I L+ N++ ++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T +PL+ ++ ++L NP C+C L WL+ +L E SG A C P+ L + + I+S +F C+ E+ ++ DC ++CP+ C C VDC+ L+ +P+++ LP + + S NK+ ++ + + +I L+ N ++++ +F LK + L SNR+ CV N +F L + L L DN I + G+F ++ L L NP +CNC L W+ +W R I G CQ P L+ P+ + + F C + N++ S C + RCP +C C T V CS L+ +P GIP + TELYLD N TL ++L + LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P G F DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + F+C D I AKC+ C+ +PCKN+G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N++DC D+ CEN ++C D +N Y C+C + G+ C K FC +D+NPC + C P ++C C PG++G++C+ + DDC+ N+CKN AHC D VNGY C C GY G C+ + P ++ LP + S C C N C+ + + C+C GY G++C+ L S+ F + +SY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L +S +++GG P A+L + ++ T F GC++ L IN++ DF K + + PGC+ + + + + +C + CK +GGV C E+ D + K KC C G++G SC+R+ CR + I+++ + ++ Y C+ + S+++ + P + + R+ F+C G + V V +C C
Sbjct: 28 CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVC-SDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSG-DCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVN-EILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--NDDNS--------------------CSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPPMV----------LPRT-----------SPCDNFDCQNGAQCIVRI---NEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDRE-ISCRGERIRDYYQ---------KQQGYAACQTTKKVSRLECRGGCAGGQCC---------GPLRSKRRKYSFECTDGSSFVDEVEKVVKCGC 1520

HSP 2 Score: 751.125 bits (1938), Expect = 0
Identity = 498/1587 (31.38%), Postives = 788/1587 (49.65%), Query Frame = -2
Query: 5098 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISE-----------------DISRLK--------NLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSE----------------------PEMCK----NGGV-CQEQND--------EKKKYKCI----------CKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 9549
CP C C +++C LR+VP ++P T +L+L GN I + KTDF+ + +L++LQL N+I+TIE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q I F G ++KNL LD N+I I + +I+RL L T + N L C+CHLAWL+ +++ +P+V C P L ++ + EF C SD + ++ P + C CTCS IV C GKG+ +P +LP +I E+ L N I V+ A S YK L++I L+ N++ ++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T +PL+ ++ ++L NP C+C L WL+ +L E SG A C P+ L + + I+S +F C+ E+ ++ DC ++CP+ C C VDC+ L+ +P+++ LP + + S NK+ ++ + + +I L+ N ++++ +F LK + L SNR+ CV N +F L + L L DN I + G+F ++ L L NP +CNC L W+ +W R I G CQ P L+ P+ + + F C + N++ S C + RCP +C C T V CS L+ +P GIP + TELYLD N TL ++L + LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P G F DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + F+C D I AKC+ C+ +PCKN+G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N++DC D+ CEN ++C D +N Y C+C + G+ C K FC +D+NPC + C P ++C C PG++G++C+ + DDC+ N+CKN AHC D VNGY C C GY G C+ + P ++ LP + S C C N C+ + + C+C GY G++C+ L S+ F + +SY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L +S +++GG P A+L + ++ T F GC++ L IN++ DF K + + PGC+ + + + + +C + CK +GGV C E+ D + K KC C G++G SC+R+ CR + I+++ + ++ Y C+ + S+++ + P + + R+ F+C G + V V +C C
Sbjct: 28 CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVC-SDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSG-DCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVN-EILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--NDDNS--------------------CSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPPMV----------LPRT-----------SPCDNFDCQNGAQCIVRI---NEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDRE-ISCRGERIRDYYQ---------KQQGYAACQTTKKVSRLECRGGCAGGQCC---------GPLRSKRRKYSFECTDGSSFVDEVEKVVKCGC 1520

HSP 3 Score: 182.57 bits (462), Expect = 8.24231e-45
Identity = 127/487 (26.08%), Postives = 214/487 (43.94%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENA--SSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
V +CP C+C+ VDC+G L +P N+ +T+ + L+ N + +T + ++ L+ N + +F+ KL ++L+ N+++ + + FR D++ L+L N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R +G +T C P+ L+G ++ + ++ F C + + + +C +L CPA C C + VDC L +IP +P TE+ L++N +K + +F + L+ + LS N I+EL + LR+L +LV+ + NK+ C+ DAF+ L NL +L L N + TI GTF LR + + L QNPF CDC++KWL + ++ + C SP + K I K F C+ D
Sbjct: 23 VAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLR-QRPRVGLYTQ--CMGPSHLRGHNVAEVQKREFVCSDEEEGHQSFMAPSC-------------------SVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTED 487

HSP 4 Score: 182.57 bits (462), Expect = 8.24231e-45
Identity = 127/487 (26.08%), Postives = 214/487 (43.94%), Query Frame = -2
Query: 6958 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENA--SSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8199
V +CP C+C+ VDC+G L +P N+ +T+ + L+ N + +T + ++ L+ N + +F+ KL ++L+ N+++ + + FR D++ L+L N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R +G +T C P+ L+G ++ + ++ F C + + + +C +L CPA C C + VDC L +IP +P TE+ L++N +K + +F + L+ + LS N I+EL + LR+L +LV+ + NK+ C+ DAF+ L NL +L L N + TI GTF LR + + L QNPF CDC++KWL + ++ + C SP + K I K F C+ D
Sbjct: 23 VAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLR-QRPRVGLYTQ--CMGPSHLRGHNVAEVQKREFVCSDEEEGHQSFMAPSC-------------------SVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTED 487
BLAST of slit vs. RefSeq Human
Match: gi|574281382|ref|NP_001276065.1| (slit homolog 2 protein isoform 3 precursor [Homo sapiens])

HSP 1 Score: 748.043 bits (1930), Expect = 0
Identity = 496/1587 (31.25%), Postives = 786/1587 (49.53%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISE-----------------DISRLK--------NLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSE----------------------PEMCK----NGGV-CQEQND-----EKKKYK-------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 4639
CP C C +++C LR+VP ++P T +L+L GN I + KTDF+ + +L++LQL N+I+TIE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q I F G ++KNL LD N+I I + +I+RL L T + N L C+CHLAWL+ +++ +P+V C P L ++ + EF C+ ++ P + C CTCS IV C GKG+ +P +LP +I E+ L N I V+ A S YK L++I L+ N++ ++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T +PL+ ++ ++L NP C+C L WL+ +L E SG A C P+ L + + I+S +F C+ E+ ++ DC ++CP+ C C VDC+ L+ +P+++ LP + + S NK+ ++ + + +I L+ N ++++ +F LK + L SNR+ CV N +F L + L L DN I + G+F ++ L L NP +CNC L W+ +W R I G CQ P L+ P+ + + F C + N++ S C + RCP +C C T V CS L+ +P GIP + TELYLD N TL ++L + LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P G F DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + F+C D I AKC+ C+ +PCKN+G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N++DC D+ CEN ++C D +N Y C+C + G+ C K FC +D+NPC + C P ++C C PG++G++C+ + DDC+ N+CKN AHC D VNGY C C GY G C+ + P ++ LP + S C C N C+ + + C+C GY G++C+ L S+ F + +SY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L +S +++GG P A+L + ++ T F GC++ L IN++ DF K + + PGC+ + + + + +C + CK +GGV C E+ D + K K C C G++G SC+R+ CR + I+++ + ++ Y C+ + S+++ + P + + R+ F+C G + V V +C C
Sbjct: 28 CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSGH-----QSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSG-DCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVN-EILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--NDDNS--------------------CSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPPMV----------LPRT-----------SPCDNFDCQNGAQCIVRI---NEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDRE-ISCRGERIRDYYQ---------KQQGYAACQTTKKVSRLECRGGCAGGQCC---------GPLRSKRRKYSFECTDGSSFVDEVEKVVKCGC 1516

HSP 2 Score: 748.043 bits (1930), Expect = 0
Identity = 496/1587 (31.25%), Postives = 786/1587 (49.53%), Query Frame = -2
Query: 5098 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISE-----------------DISRLK--------NLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSE----------------------PEMCK----NGGV-CQEQND-----EKKKYK-------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 9549
CP C C +++C LR+VP ++P T +L+L GN I + KTDF+ + +L++LQL N+I+TIE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q I F G ++KNL LD N+I I + +I+RL L T + N L C+CHLAWL+ +++ +P+V C P L ++ + EF C+ ++ P + C CTCS IV C GKG+ +P +LP +I E+ L N I V+ A S YK L++I L+ N++ ++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T +PL+ ++ ++L NP C+C L WL+ +L E SG A C P+ L + + I+S +F C+ E+ ++ DC ++CP+ C C VDC+ L+ +P+++ LP + + S NK+ ++ + + +I L+ N ++++ +F LK + L SNR+ CV N +F L + L L DN I + G+F ++ L L NP +CNC L W+ +W R I G CQ P L+ P+ + + F C + N++ S C + RCP +C C T V CS L+ +P GIP + TELYLD N TL ++L + LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P G F DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + F+C D I AKC+ C+ +PCKN+G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N++DC D+ CEN ++C D +N Y C+C + G+ C K FC +D+NPC + C P ++C C PG++G++C+ + DDC+ N+CKN AHC D VNGY C C GY G C+ + P ++ LP + S C C N C+ + + C+C GY G++C+ L S+ F + +SY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L +S +++GG P A+L + ++ T F GC++ L IN++ DF K + + PGC+ + + + + +C + CK +GGV C E+ D + K K C C G++G SC+R+ CR + I+++ + ++ Y C+ + S+++ + P + + R+ F+C G + V V +C C
Sbjct: 28 CPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSGH-----QSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSG-DCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVN-EILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--NDDNS--------------------CSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPPMV----------LPRT-----------SPCDNFDCQNGAQCIVRI---NEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDRE-ISCRGERIRDYYQ---------KQQGYAACQTTKKVSRLECRGGCAGGQCC---------GPLRSKRRKYSFECTDGSSFVDEVEKVVKCGC 1516

HSP 3 Score: 181.8 bits (460), Expect = 1.30794e-44
Identity = 127/485 (26.19%), Postives = 213/485 (43.92%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
V +CP C+C+ VDC+G L +P N+ +T+ + L+ N + +T + ++ L+ N + +F+ KL ++L+ N+++ + + FR D++ L+L N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R +G +T C P+ L+G ++ + ++ F C + + S + +L CPA C C + VDC L +IP +P TE+ L++N +K + +F + L+ + LS N I+EL + LR+L +LV+ + NK+ C+ DAF+ L NL +L L N + TI GTF LR + + L QNPF CDC++KWL + ++ + C SP + K I K F C+ D
Sbjct: 23 VAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLR-QRPRVGLYTQ--CMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCS---------------------VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTED 483

HSP 4 Score: 181.8 bits (460), Expect = 1.30794e-44
Identity = 127/485 (26.19%), Postives = 213/485 (43.92%), Query Frame = -2
Query: 6958 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8199
V +CP C+C+ VDC+G L +P N+ +T+ + L+ N + +T + ++ L+ N + +F+ KL ++L+ N+++ + + FR D++ L+L N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R +G +T C P+ L+G ++ + ++ F C + + S + +L CPA C C + VDC L +IP +P TE+ L++N +K + +F + L+ + LS N I+EL + LR+L +LV+ + NK+ C+ DAF+ L NL +L L N + TI GTF LR + + L QNPF CDC++KWL + ++ + C SP + K I K F C+ D
Sbjct: 23 VAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLR-QRPRVGLYTQ--CMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCS---------------------VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTED 483
BLAST of slit vs. Smed Unigenes AA
Match: SMU15036778 (dd_smedV4_12111_0_1|m.4973|m.1592)

HSP 1 Score: 1946.4 bits (5041), Expect = 0
Identity = 948/1527 (62.08%), Postives = 1201/1527 (78.65%), Query Frame = 2
Query:   92 NIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVN-ENEVISESVCAYHQCLNDGLCVS-DLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGC-KVIGT--ESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDT--TCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
+I F F ++LL ++ S+ W +D + + ICPNGCQC++YS+ECKHRL NVP + EKT +LNLLGNRINV+RK+DF K+ NLK+LQLSNNRIT+IE G FD L L KLRLNRNLIQYLPD LFSKL LQKLDLRDNQLQCIN+N+F L LK L L+ NKIFWISE IS+LK+L+ L I NKLNCNCHLAWLN F+K + +IKP SVLC+TPFRLS IPISSLSSYEFQCAS+ K +LEN+C KK+CSK C CS +GIVKCVGK + ++PQDLPT+++ELDL DN I +L+Q LSKYK LKKI+L N M+DIEPGAF GL QLTS+YLN N LK+IRKNA GL SLMFLY+ NDIECLPKDT RL+LLHLSENKLT+LKKET P LRYLYLVHNPLNC+C++ W+ +++ KE + +PVA+CLQP+NL G P+R +Q Y F C +E E ETHDE+CVPK+SCP CTC+ +VV+C+ + L +P+++ PSTK +I+S+N L+++ + PNL+K+DLS+N+I+ ++ DVF ++ KL+EINLNSNRLKC+NN+TF+ L +LE L+LS+N I+CIV SF+ N N+K+L LN+N HC+C+LKWMS+W+R HY LG H CQSP +L+ TP++ LD+KYF C N + ++ +C ++ + C ++ EC K +CP+KC+CESTKVDCS +QL++IP IP +TTELYLDRN+L++LNE+SFK L NLKTLVLSYNGITELNKNVLTPL++LETLV+SFNKLQCI +DAFK L NLKVLILQSNDV+TIP+ F DL+NLNNIALGQNPFHCDCNIKWLNQFF++RFLDNGISLCASPE MKLKSIYHSKPTDF C+EET+DAYITAKCD+C++ PCK+NGKCSL+THH YQC CP+PFHGKNC+KRINACFG PC+NGGICKN+DNYGNYECVCP+GFRGPKC N++DC + C NGA+C+D N Y+C C+ GFRGK+C++KF +C DINPC N+G C+ LP+NDY+C C GW GK C +N DDCKYN CK+ + CVDL N Y C CRPGY+GK C+ PAWKPTVLKT +SRRD+ N ENEVISESVCAYH+CLN+G+C++ D +QKSYC+CK GYSG CQ+L+S++F +SYIEISPPSRGFLMPRGNI+L F TNSSSGL+LYQG ++ YL VNLY+GH+RI YN+GDKV+GPEGYSM +NDSR H+L IEI+GENLTMYL+GR HCTLKS Y + NRY+AL++GIFIGGAP I+++A+ K+H+E+++ F+GC++ L IN KKIDF KY+ +++NV PGC K+I T S K + + I + T TT ++VC P +CKN GVC+ KKK++CICK+GF G+ C ++ MC ++HI DPD+ TC S+ R +YR C G+C+ S+MQSD+ K+F+HKP++ +SSRCCQP K+ T I+FKC++GR Y R + + CKC+ NC
Sbjct: 7 DITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKE-TNTPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTCCSIGNE-ECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQSEMTYENLENEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANC 1531

HSP 2 Score: 1946.4 bits (5041), Expect = 0
Identity = 948/1527 (62.08%), Postives = 1201/1527 (78.65%), Query Frame = -2
Query: 5086 NIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVN-ENEVISESVCAYHQCLNDGLCVS-DLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGC-KVIGT--ESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDT--TCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9645
+I F F ++LL ++ S+ W +D + + ICPNGCQC++YS+ECKHRL NVP + EKT +LNLLGNRINV+RK+DF K+ NLK+LQLSNNRIT+IE G FD L L KLRLNRNLIQYLPD LFSKL LQKLDLRDNQLQCIN+N+F L LK L L+ NKIFWISE IS+LK+L+ L I NKLNCNCHLAWLN F+K + +IKP SVLC+TPFRLS IPISSLSSYEFQCAS+ K +LEN+C KK+CSK C CS +GIVKCVGK + ++PQDLPT+++ELDL DN I +L+Q LSKYK LKKI+L N M+DIEPGAF GL QLTS+YLN N LK+IRKNA GL SLMFLY+ NDIECLPKDT RL+LLHLSENKLT+LKKET P LRYLYLVHNPLNC+C++ W+ +++ KE + +PVA+CLQP+NL G P+R +Q Y F C +E E ETHDE+CVPK+SCP CTC+ +VV+C+ + L +P+++ PSTK +I+S+N L+++ + PNL+K+DLS+N+I+ ++ DVF ++ KL+EINLNSNRLKC+NN+TF+ L +LE L+LS+N I+CIV SF+ N N+K+L LN+N HC+C+LKWMS+W+R HY LG H CQSP +L+ TP++ LD+KYF C N + ++ +C ++ + C ++ EC K +CP+KC+CESTKVDCS +QL++IP IP +TTELYLDRN+L++LNE+SFK L NLKTLVLSYNGITELNKNVLTPL++LETLV+SFNKLQCI +DAFK L NLKVLILQSNDV+TIP+ F DL+NLNNIALGQNPFHCDCNIKWLNQFF++RFLDNGISLCASPE MKLKSIYHSKPTDF C+EET+DAYITAKCD+C++ PCK+NGKCSL+THH YQC CP+PFHGKNC+KRINACFG PC+NGGICKN+DNYGNYECVCP+GFRGPKC N++DC + C NGA+C+D N Y+C C+ GFRGK+C++KF +C DINPC N+G C+ LP+NDY+C C GW GK C +N DDCKYN CK+ + CVDL N Y C CRPGY+GK C+ PAWKPTVLKT +SRRD+ N ENEVISESVCAYH+CLN+G+C++ D +QKSYC+CK GYSG CQ+L+S++F +SYIEISPPSRGFLMPRGNI+L F TNSSSGL+LYQG ++ YL VNLY+GH+RI YN+GDKV+GPEGYSM +NDSR H+L IEI+GENLTMYL+GR HCTLKS Y + NRY+AL++GIFIGGAP I+++A+ K+H+E+++ F+GC++ L IN KKIDF KY+ +++NV PGC K+I T S K + + I + T TT ++VC P +CKN GVC+ KKK++CICK+GF G+ C ++ MC ++HI DPD+ TC S+ R +YR C G+C+ S+MQSD+ K+F+HKP++ +SSRCCQP K+ T I+FKC++GR Y R + + CKC+ NC
Sbjct: 7 DITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKE-TNTPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTCCSIGNE-ECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQSEMTYENLENEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANC 1531
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006140 (SmedAsxldir_c107649_g2_i1|m.84323|m.17798)

HSP 1 Score: 136.346 bits (342), Expect = 1.56469e-31
Identity = 114/364 (31.32%), Postives = 157/364 (43.13%), Query Frame = 2
Query: 2786 YITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKD----------------------INPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISE---------------SVCAYHQCLNDGLC--VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVN 3760
Y + + C+ +PCKNNG C+ + + Y+C C F GKNCE I AC PCKNGG+C+ VD Y C C G+ G C C+ + C NGA C + C C K F GK C +C + N C G C S + C C PG+ G +C +IDDCK N CKN C+D +N ++C C G+ GK C+E +K+ + L HS + N+ I E S+C + CLN G C +S L G Q C C G+ G CQ L +I+ P R L + + N + GF+ K+ +N
Sbjct: 462 YCDKEINECVPNPCKNNGVCT-DSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDT--GYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERT--DYCIKSPCMNYGVCLRHSDEL-YNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ---CHCNQGWIGTVCQFL---------HIDFQPCRRKNLCKNEGVCINVGYNDFT-CHCKPGFEGKHCDIN 805

HSP 2 Score: 136.346 bits (342), Expect = 1.56469e-31
Identity = 114/364 (31.32%), Postives = 157/364 (43.13%), Query Frame = -2
Query: 5977 YITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKD----------------------INPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISE---------------SVCAYHQCLNDGLC--VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVN 6951
Y + + C+ +PCKNNG C+ + + Y+C C F GKNCE I AC PCKNGG+C+ VD Y C C G+ G C C+ + C NGA C + C C K F GK C +C + N C G C S + C C PG+ G +C +IDDCK N CKN C+D +N ++C C G+ GK C+E +K+ + L HS + N+ I E S+C + CLN G C +S L G Q C C G+ G CQ L +I+ P R L + + N + GF+ K+ +N
Sbjct: 462 YCDKEINECVPNPCKNNGVCT-DSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDT--GYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERT--DYCIKSPCMNYGVCLRHSDEL-YNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ---CHCNQGWIGTVCQFL---------HIDFQPCRRKNLCKNEGVCINVGYNDFT-CHCKPGFEGKHCDIN 805

HSP 3 Score: 122.865 bits (307), Expect = 1.83777e-27
Identity = 102/347 (29.39%), Postives = 153/347 (44.09%), Query Frame = 2
Query: 2615 QNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIR-----SPCKNNGKCS--LVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNG-YNCVCKKGFRGKFCNLKF----SFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD-------EPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQH 3598
+NP C C W F E MK H D T ++ + CD + +PCKN G C L Y+C CP F G++CE I+ CF +PCK G K+ G + C C + G C+++ + C + C+NG C NG C+C++G++G C+L S CK C +S DY+C C+PG+ GK C++ I++C N CKNN C D +N Y C C + GK C+ +P V + + K + N I ++ C+ + CLN C + +Q YC C + G++C+H
Sbjct: 259 ENPGECRCRAGWQGTF--------------CDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSK---GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ----IQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKC-KTGYTGTNCEIYKTGCSPNPCLNGAYCYTI---NQDFYCHCNKEFWGKRCEH 578

HSP 4 Score: 122.865 bits (307), Expect = 1.83777e-27
Identity = 102/347 (29.39%), Postives = 153/347 (44.09%), Query Frame = -2
Query: 6139 QNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIR-----SPCKNNGKCS--LVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNG-YNCVCKKGFRGKFCNLKF----SFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD-------EPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQH 7122
+NP C C W F E MK H D T ++ + CD + +PCKN G C L Y+C CP F G++CE I+ CF +PCK G K+ G + C C + G C+++ + C + C+NG C NG C+C++G++G C+L S CK C +S DY+C C+PG+ GK C++ I++C N CKNN C D +N Y C C + GK C+ +P V + + K + N I ++ C+ + CLN C + +Q YC C + G++C+H
Sbjct: 259 ENPGECRCRAGWQGTF--------------CDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSK---GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ----IQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKC-KTGYTGTNCEIYKTGCSPNPCLNGAYCYTI---NQDFYCHCNKEFWGKRCEH 578

HSP 5 Score: 117.472 bits (293), Expect = 9.27501e-26
Identity = 86/274 (31.39%), Postives = 131/274 (47.81%), Query Frame = 2
Query: 2804 DACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGIC-KNVDN-YGNYECVCPLGFRGPKCN-ENINDCADHKCENGASCD--DSVNGYNCVCKKGFRGKFC---NLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHL 3601
D C +PCKN G C + + + ++C C + F GK CE+R + C PC N G+C ++ D Y ++ C C + G C+ + C + C NG SC ++NG+ C C +G+ G C ++ F C+ N C N G+C ++ ND+ C CKPG+ GK+C+ N ++C N C N C+D +N Y C C G+ G C +N +E CA C +CV + + CRC G G+ C H+
Sbjct: 643 DDCKTNPCKNGGIC-IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQ-------------------------LNYDE------CASFPCAYGAICVDRIDDFE---CRCPEGRDGKLCDHV 881

HSP 6 Score: 117.472 bits (293), Expect = 9.27501e-26
Identity = 86/274 (31.39%), Postives = 131/274 (47.81%), Query Frame = -2
Query: 6136 DACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGIC-KNVDN-YGNYECVCPLGFRGPKCN-ENINDCADHKCENGASCD--DSVNGYNCVCKKGFRGKFC---NLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHL 6933
D C +PCKN G C + + + ++C C + F GK CE+R + C PC N G+C ++ D Y ++ C C + G C+ + C + C NG SC ++NG+ C C +G+ G C ++ F C+ N C N G+C ++ ND+ C CKPG+ GK+C+ N ++C N C N C+D +N Y C C G+ G C +N +E CA C +CV + + CRC G G+ C H+
Sbjct: 643 DDCKTNPCKNGGIC-IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQ-------------------------LNYDE------CASFPCAYGAICVDRIDDFE---CRCPEGRDGKLCDHV 881

HSP 7 Score: 85.8853 bits (211), Expect = 3.42832e-16
Identity = 67/180 (37.22%), Postives = 83/180 (46.11%), Query Frame = 2
Query: 2810 CIRSPCKNNGKCS-LVTHHQYQCQCPHPFHGKNCE---------KRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCV 3319
C +PC N G CS L T + +QC C + G C+ +R N C KN G+C NV Y ++ C C GF G C+ N N+C + C NG C D +N Y C+C KGF G C L + C PC IC D D+ C C G GK C D K NE CV
Sbjct: 726 CDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLC-----KNEGVCINV-GYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASF-PCAYGAICVDRID-DFECRCPEGRDGKLC----DHVKNNESPQPPSCV 893

HSP 8 Score: 85.8853 bits (211), Expect = 3.42832e-16
Identity = 67/180 (37.22%), Postives = 83/180 (46.11%), Query Frame = -2
Query: 6418 CIRSPCKNNGKCS-LVTHHQYQCQCPHPFHGKNCE---------KRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCV 6927
C +PC N G CS L T + +QC C + G C+ +R N C KN G+C NV Y ++ C C GF G C+ N N+C + C NG C D +N Y C+C KGF G C L + C PC IC D D+ C C G GK C D K NE CV
Sbjct: 726 CDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLC-----KNEGVCINV-GYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASF-PCAYGAICVDRID-DFECRCPEGRDGKLC----DHVKNNESPQPPSCV 893

HSP 9 Score: 73.9442 bits (180), Expect = 1.50741e-12
Identity = 70/247 (28.34%), Postives = 102/247 (41.30%), Query Frame = 2
Query: 2960 CKNVDNYGNYEC------VCPLGFRGPKCNENINDCADHK----CEN-----------GASCDDSV------------NGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPD--NDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
CKN N G+Y+C VC G+ G CN I H+ CEN G CD+ + + + C C+ + G+FC+ ++C + NPC N GICE+L Y+C C G+ G++C ID C N CK C+ + C+C + GKLCD+ S+C + C N G C D G+++ C C+ GY G +C
Sbjct: 216 CKN--NGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQ-------------------------------DTSICDQNSCQNGGQCGKDENGNRR--CICQQGYKGSECH 424

HSP 10 Score: 73.9442 bits (180), Expect = 1.50741e-12
Identity = 70/247 (28.34%), Postives = 102/247 (41.30%), Query Frame = -2
Query: 6142 CKNVDNYGNYEC------VCPLGFRGPKCNENINDCADHK----CEN-----------GASCDDSV------------NGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPD--NDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6777
CKN N G+Y+C VC G+ G CN I H+ CEN G CD+ + + + C C+ + G+FC+ ++C + NPC N GICE+L Y+C C G+ G++C ID C N CK C+ + C+C + GKLCD+ S+C + C N G C D G+++ C C+ GY G +C
Sbjct: 216 CKN--NGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQ-------------------------------DTSICDQNSCQNGGQCGKDENGNRR--CICQQGYKGSECH 424

HSP 11 Score: 72.0182 bits (175), Expect = 6.93005e-12
Identity = 72/297 (24.24%), Postives = 108/297 (36.36%), Query Frame = 2
Query: 2825 CKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCN----------------------------------------------------LKFSFCKDINPCNNTGICESLPDNDYRCACKP-------------------GWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRP--GYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAY 3496
CKN G C V ++ + C C F GK+C+ N C +PC NGG C +D +Y C+C GF G C N ++CA C GA C D ++ + C C +G GK C+ L+ + D C +C S P N RC P W G ++ DC+ N KN+ +C ++ ++ K P + +CD + + + R L S ++NEN +V Y
Sbjct: 775 CKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKC--IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPG----ESHKDCQPNSIKNHNYCAKIILTFNKKNVPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIY 1065

HSP 12 Score: 72.0182 bits (175), Expect = 6.93005e-12
Identity = 72/297 (24.24%), Postives = 108/297 (36.36%), Query Frame = -2
Query: 6241 CKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCN----------------------------------------------------LKFSFCKDINPCNNTGICESLPDNDYRCACKP-------------------GWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRP--GYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAY 6912
CKN G C V ++ + C C F GK+C+ N C +PC NGG C +D +Y C+C GF G C N ++CA C GA C D ++ + C C +G GK C+ L+ + D C +C S P N RC P W G ++ DC+ N KN+ +C ++ ++ K P + +CD + + + R L S ++NEN +V Y
Sbjct: 775 CKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKC--IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPG----ESHKDCQPNSIKNHNYCAKIILTFNKKNVPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIY 1065
BLAST of slit vs. Smed Unigenes AA
Match: SMU15037114 (dd_smedV4_13823_0_1|m.8312|m.39635)

HSP 1 Score: 131.724 bits (330), Expect = 3.48914e-30
Identity = 79/218 (36.24%), Postives = 105/218 (48.17%), Query Frame = 2
Query: 2807 ACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNI---------DDCKYNECKNNAHC--------VDLVNG---------YDCKCRPGYVGKLCDE 3382
+C +PC N +C ++C+CP F G+NCE + C PC NGG+C +D + CVCP+GF G +C N NDC C NGA C D N +C C G+ G+ CN + C PC N GIC P YRC C+ W G+ CN I C N C+N+ C V++ N Y CKC PG+ G LC++
Sbjct: 430 SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMC--IDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTP-GSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 644

HSP 2 Score: 131.724 bits (330), Expect = 3.48914e-30
Identity = 79/218 (36.24%), Postives = 105/218 (48.17%), Query Frame = -2
Query: 6355 ACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNI---------DDCKYNECKNNAHC--------VDLVNG---------YDCKCRPGYVGKLCDE 6930
+C +PC N +C ++C+CP F G+NCE + C PC NGG+C +D + CVCP+GF G +C N NDC C NGA C D N +C C G+ G+ CN + C PC N GIC P YRC C+ W G+ CN I C N C+N+ C V++ N Y CKC PG+ G LC++
Sbjct: 430 SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMC--IDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTP-GSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 644

HSP 3 Score: 128.642 bits (322), Expect = 2.82115e-29
Identity = 93/290 (32.07%), Postives = 136/290 (46.90%), Query Frame = 2
Query: 2747 PTDFSCTEETDDAYITAKCDACIRSP--CKNNGKC----SLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASC-DDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQ-CLNDGLCVSDLQGDQKSYCRCKAGYSGQQC 3592
P +C ++ + + C +P C+N G+C ++ T+ QY+C C F G +CEK + C + C NGG CK N Y C CP F G +C N C D+ C + C D +G+ C C GF G+ C + C PC N G+C P + C C G+ G C N +DC+ C N A C+D N DC+C G+ G++C++ N+NE CA +Q CLN+G+C+ D G + C+C+A +SGQ C
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQ-----------------------NINE--------CAINQPCLNNGICI-DTPGSYR--CQCQATWSGQFC 578

HSP 4 Score: 128.642 bits (322), Expect = 2.82115e-29
Identity = 93/290 (32.07%), Postives = 136/290 (46.90%), Query Frame = -2
Query: 6145 PTDFSCTEETDDAYITAKCDACIRSP--CKNNGKC----SLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASC-DDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQ-CLNDGLCVSDLQGDQKSYCRCKAGYSGQQC 6990
P +C ++ + + C +P C+N G+C ++ T+ QY+C C F G +CEK + C + C NGG CK N Y C CP F G +C N C D+ C + C D +G+ C C GF G+ C + C PC N G+C P + C C G+ G C N +DC+ C N A C+D N DC+C G+ G++C++ N+NE CA +Q CLN+G+C+ D G + C+C+A +SGQ C
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQ-----------------------NINE--------CAINQPCLNNGICI-DTPGSYR--CQCQATWSGQFC 578

HSP 5 Score: 124.02 bits (310), Expect = 7.54279e-28
Identity = 101/366 (27.60%), Postives = 152/366 (41.53%), Query Frame = 2
Query: 2621 PFHCDCNIKWLNQF--FMERFLDNGISLCASP-ENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSL-VTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNE-CKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDL-------------KLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFL 3664
P C+C KW F + N ++C + E + +I ++ C A+ CI + C N GKC + V ++Y C CP F+G C+ +C +PC C D ++C CP GF G C + ++C+ C NG C D +G+ CVC GF G C + + C+ ++ C N C N C C GW G+ CNQNI++C N+ C NN C+D Y C+C+ + G+ C+ P + + R+ L LP S N+ NE Y C+C G++G C+ + S Y E + GFL
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNI--NYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYT-------------------CKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFL 666

HSP 6 Score: 124.02 bits (310), Expect = 7.54279e-28
Identity = 101/366 (27.60%), Postives = 152/366 (41.53%), Query Frame = -2
Query: 6073 PFHCDCNIKWLNQF--FMERFLDNGISLCASP-ENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSL-VTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNE-CKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDL-------------KLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFL 7116
P C+C KW F + N ++C + E + +I ++ C A+ CI + C N GKC + V ++Y C CP F+G C+ +C +PC C D ++C CP GF G C + ++C+ C NG C D +G+ CVC GF G C + + C+ ++ C N C N C C GW G+ CNQNI++C N+ C NN C+D Y C+C+ + G+ C+ P + + R+ L LP S N+ NE Y C+C G++G C+ + S Y E + GFL
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNI--NYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYT-------------------CKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFL 666

HSP 7 Score: 70.4774 bits (171), Expect = 1.79564e-11
Identity = 78/298 (26.17%), Postives = 112/298 (37.58%), Query Frame = 2
Query: 2867 YQCQCPHPFHGKNCEKRINACFGHPCKNGGICK-NVDNYGNYEC------VCPLGFRGPKCNENI-------------NDCADHKCENGASCDDSVNGYNCV-------------------CKKGFRGKFCNLKFSFCK-DINPCNNTGICESL----PDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLV--NGYDCKCRPGYVGKLC--------DEP-AWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
++ C +HG+ C+K +CK + + G Y C +C G+ G C++ + N C G SCD + CV CKK + G FCN+ ++C + N C N G C + + YRC CKPG+ G +C + +C N+C N C V N Y C C + G C D P + S K P + N I E C+ CLN G+C+ G C C G+SG +CQ
Sbjct: 223 FRYTCSQNYHGEECDK--------------LCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGGCRFDERTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCP-PGFIGRNCEIDEDECSSKPCLNGGMCIDRPSG---FLCVCPVGFSGDRCQ 502

HSP 8 Score: 70.4774 bits (171), Expect = 1.79564e-11
Identity = 78/298 (26.17%), Postives = 112/298 (37.58%), Query Frame = -2
Query: 6142 YQCQCPHPFHGKNCEKRINACFGHPCKNGGICK-NVDNYGNYEC------VCPLGFRGPKCNENI-------------NDCADHKCENGASCDDSVNGYNCV-------------------CKKGFRGKFCNLKFSFCK-DINPCNNTGICESL----PDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLV--NGYDCKCRPGYVGKLC--------DEP-AWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6870
++ C +HG+ C+K +CK + + G Y C +C G+ G C++ + N C G SCD + CV CKK + G FCN+ ++C + N C N G C + + YRC CKPG+ G +C + +C N+C N C V N Y C C + G C D P + S K P + N I E C+ CLN G+C+ G C C G+SG +CQ
Sbjct: 223 FRYTCSQNYHGEECDK--------------LCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGGCRFDERTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCP-PGFIGRNCEIDEDECSSKPCLNGGMCIDRPSG---FLCVCPVGFSGDRCQ 502
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006317 (SmedAsxldir_c107934_g5_i1|m.86273|m.14433)

HSP 1 Score: 131.339 bits (329), Expect = 7.41405e-30
Identity = 93/266 (34.96%), Postives = 131/266 (49.25%), Query Frame = 2
Query: 2825 CKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD----EPAWKPTVLKTSMSRRDLKLPHSANVNE-----NEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
C+N G C + T YQC+C F+G+ CE I C CKNGG C +D G+Y CVCP + G C C C+NG C D Y C+C + GK C+ + CK INPC N G CES+ DY+C C+ G+ GK C +ID+C+ C N C++++ G C C PG+ G C+ E KP + + DL ++ + E N I+ C + CLN C + G C+C G+ G +C+
Sbjct: 185 CENGGTC-INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC--LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCK-INPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGG---FTCQCLQGFVGLRCE 441

HSP 2 Score: 131.339 bits (329), Expect = 7.41405e-30
Identity = 93/266 (34.96%), Postives = 131/266 (49.25%), Query Frame = -2
Query: 6142 CKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD----EPAWKPTVLKTSMSRRDLKLPHSANVNE-----NEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6912
C+N G C + T YQC+C F+G+ CE I C CKNGG C +D G+Y CVCP + G C C C+NG C D Y C+C + GK C+ + CK INPC N G CES+ DY+C C+ G+ GK C +ID+C+ C N C++++ G C C PG+ G C+ E KP + + DL ++ + E N I+ C + CLN C + G C+C G+ G +C+
Sbjct: 185 CENGGTC-INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC--LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCK-INPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGG---FTCQCLQGFVGLRCE 441

HSP 3 Score: 129.798 bits (325), Expect = 2.15498e-29
Identity = 92/305 (30.16%), Postives = 129/305 (42.30%), Query Frame = 2
Query: 2810 CIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCE---------------------------------------KRINACFGHP---CKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDL-VNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
C SPC+N G C + H+Y+CQCP + G NCE I+ C + C+NGG C ++ G+Y+C C GF G +C +I DC + C+NG +C D + Y CVC + G C K + C ++ PC N GIC D DY+C C W GKNC+ + CK N CKNN C + Y C C+ G+ GK C+ TS+ C C N G C++ ++G + C C G+ G C+
Sbjct: 99 CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLC-ELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCE----------TSIDN---------------------CQKISCFNGGSCINMIEGGK---CNCLPGFEGNNCE 365

HSP 4 Score: 129.798 bits (325), Expect = 2.15498e-29
Identity = 92/305 (30.16%), Postives = 129/305 (42.30%), Query Frame = -2
Query: 6142 CIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCE---------------------------------------KRINACFGHP---CKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDL-VNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6927
C SPC+N G C + H+Y+CQCP + G NCE I+ C + C+NGG C ++ G+Y+C C GF G +C +I DC + C+NG +C D + Y CVC + G C K + C ++ PC N GIC D DY+C C W GKNC+ + CK N CKNN C + Y C C+ G+ GK C+ TS+ C C N G C++ ++G + C C G+ G C+
Sbjct: 99 CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLC-ELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCE----------TSIDN---------------------CQKISCFNGGSCINMIEGGK---CNCLPGFEGNNCE 365

HSP 5 Score: 124.405 bits (311), Expect = 9.68753e-28
Identity = 102/350 (29.14%), Postives = 140/350 (40.00%), Query Frame = 2
Query: 2804 DACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKN------------------------------------VDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESL-----------PD--------------------------NDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD----EPAWKPTVL------KTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAG---YSGQQCQ 3595
+ C +PCKNNG C V + Y+C C F GK CE I+ C C NGG C N +D +Y C CP G G C NI++C + C NGA C+D V G+ C C +GF G C K CK + PC IC ++ PD N+ +C C PG+ G+ C I++C N C++ + C DL N Y C C PG+ GK C+ E A P L + R LP+S N++ C + C ND +C+ + D +C C Y G +C+
Sbjct: 292 NPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKL---DPCNPNACYNDAICIPGNKYDSY-HCNCSTALGRYEGSKCE 637

HSP 6 Score: 124.405 bits (311), Expect = 9.68753e-28
Identity = 102/350 (29.14%), Postives = 140/350 (40.00%), Query Frame = -2
Query: 6142 DACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKN------------------------------------VDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESL-----------PD--------------------------NDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD----EPAWKPTVL------KTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAG---YSGQQCQ 6933
+ C +PCKNNG C V + Y+C C F GK CE I+ C C NGG C N +D +Y C CP G G C NI++C + C NGA C+D V G+ C C +GF G C K CK + PC IC ++ PD N+ +C C PG+ G+ C I++C N C++ + C DL N Y C C PG+ GK C+ E A P L + R LP+S N++ C + C ND +C+ + D +C C Y G +C+
Sbjct: 292 NPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKL---DPCNPNACYNDAICIPGNKYDSY-HCNCSTALGRYEGSKCE 637

HSP 7 Score: 107.457 bits (267), Expect = 1.30338e-22
Identity = 78/248 (31.45%), Postives = 117/248 (47.18%), Query Frame = 2
Query: 2867 YQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDND----YRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQ-GDQKSYCRCKAGYSGQQCQ 3595
++C+C F G+ CE IN C +PC N C +D+ +Y+C+C GF G C N NDC + C C D VNG+ C C + + G C C D NPC N G C + N Y C C+ G+ G C +D C+ N C + C ++ + CKC Y+G+ C+ + KT + ++ +NE + +C +H G C +D + G K C C++GY G C+
Sbjct: 719 FRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPC-DSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCE-------IKKTETCKS-----YAVEKFKNESLINKICKHH-----GNCFNDPETGGFK--CSCQSGYGGSFCE 944

HSP 8 Score: 107.457 bits (267), Expect = 1.30338e-22
Identity = 78/248 (31.45%), Postives = 117/248 (47.18%), Query Frame = -2
Query: 6142 YQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDND----YRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQ-GDQKSYCRCKAGYSGQQCQ 6870
++C+C F G+ CE IN C +PC N C +D+ +Y+C+C GF G C N NDC + C C D VNG+ C C + + G C C D NPC N G C + N Y C C+ G+ G C +D C+ N C + C ++ + CKC Y+G+ C+ + KT + ++ +NE + +C +H G C +D + G K C C++GY G C+
Sbjct: 719 FRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPC-DSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCE-------IKKTETCKS-----YAVEKFKNESLINKICKHH-----GNCFNDPETGGFK--CSCQSGYGGSFCE 944

HSP 9 Score: 104.76 bits (260), Expect = 7.9293e-22
Identity = 85/296 (28.72%), Postives = 130/296 (43.92%), Query Frame = 2
Query: 2819 SPCKN----NGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDN---DYRCACKPG---WLGKNCNQNIDDCKYNE--------------------CKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPH-------SANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
S CKN NG+C V + + +C C F G+ CE IN CF +PC++G C+++ + +Y C+C GF+G KC NIN+CA + C C D V G+ C C + G C K C + N C N IC +P N Y C C + G C +++D+C + C N+ C++ + CKC Y G+ C++P L + E I + C ++ C ND C+ + Q C C++G+SG+ C+
Sbjct: 485 SKCKNIVCINGQCVDVNNEE-KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC-NPNACYNDAIC--IPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQ---CICQSGFSGKNCE 771

HSP 10 Score: 104.76 bits (260), Expect = 7.9293e-22
Identity = 85/296 (28.72%), Postives = 130/296 (43.92%), Query Frame = -2
Query: 6142 SPCKN----NGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDN---DYRCACKPG---WLGKNCNQNIDDCKYNE--------------------CKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPH-------SANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6918
S CKN NG+C V + + +C C F G+ CE IN CF +PC++G C+++ + +Y C+C GF+G KC NIN+CA + C C D V G+ C C + G C K C + N C N IC +P N Y C C + G C +++D+C + C N+ C++ + CKC Y G+ C++P L + E I + C ++ C ND C+ + Q C C++G+SG+ C+
Sbjct: 485 SKCKNIVCINGQCVDVNNEE-KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC-NPNACYNDAIC--IPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQ---CICQSGFSGKNCE 771

HSP 11 Score: 103.219 bits (256), Expect = 2.8181e-21
Identity = 69/194 (35.57%), Postives = 97/194 (50.00%), Query Frame = 2
Query: 2810 CIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDD-SVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNE---CKNNAHCVDLVNGYDCKCRPGYVGKLCD 3379
C CKN C + +Y C+C + + G CE++ N C PC+NGG CK + GNY C C + G C E ++CA C NG C ++ Y C C K + G C L S C NPC G C D + +C C G+ G C+ +ID+C E C+N C++ V Y CKC+ G+ G+ C+
Sbjct: 24 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI--AGNYVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNS-CGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCE 212

HSP 12 Score: 103.219 bits (256), Expect = 2.8181e-21
Identity = 69/194 (35.57%), Postives = 97/194 (50.00%), Query Frame = -2
Query: 6358 CIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDD-SVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNE---CKNNAHCVDLVNGYDCKCRPGYVGKLCD 6927
C CKN C + +Y C+C + + G CE++ N C PC+NGG CK + GNY C C + G C E ++CA C NG C ++ Y C C K + G C L S C NPC G C D + +C C G+ G C+ +ID+C E C+N C++ V Y CKC+ G+ G+ C+
Sbjct: 24 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI--AGNYVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNS-CGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCE 212

HSP 13 Score: 102.064 bits (253), Expect = 6.41755e-21
Identity = 88/327 (26.91%), Postives = 133/327 (40.67%), Query Frame = 2
Query: 2804 DACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLG---FRGPKC-------------------------NENINDCA-DHKCEN--------------------------------GASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDL--QGDQKSYCRCKAGYSGQQCQ 3595
+ C +PC NG+C + + ++CQC P+ G C +++ C + C N IC + Y +Y C C + G KC N I C D++C N GA+CD+ +G+ C C GF G+ C ++ + C+ NPC+N C NDY+C C+ G+ GKNC N +DC + C + CVD VNG++CKC Y+G C+ LK P C + CLN G C++ Q C C+ G++G +C+
Sbjct: 560 NECAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQH-NPCSNDAKCIDHI-NDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEH----------------LKRP---------------CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE 852

HSP 14 Score: 102.064 bits (253), Expect = 6.41755e-21
Identity = 88/327 (26.91%), Postives = 133/327 (40.67%), Query Frame = -2
Query: 6142 DACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLG---FRGPKC-------------------------NENINDCA-DHKCEN--------------------------------GASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDL--QGDQKSYCRCKAGYSGQQCQ 6933
+ C +PC NG+C + + ++CQC P+ G C +++ C + C N IC + Y +Y C C + G KC N I C D++C N GA+CD+ +G+ C C GF G+ C ++ + C+ NPC+N C NDY+C C+ G+ GKNC N +DC + C + CVD VNG++CKC Y+G C+ LK P C + CLN G C++ Q C C+ G++G +C+
Sbjct: 560 NECAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQH-NPCSNDAKCIDHI-NDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEH----------------LKRP---------------CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE 852

HSP 15 Score: 101.293 bits (251), Expect = 1.03574e-20
Identity = 90/319 (28.21%), Postives = 131/319 (41.07%), Query Frame = 2
Query: 2759 SCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-------------DINPCNNTGICESLP-DNDYRCACKPGWLGKNCNQNIDDC-KYNE-----CKNNAHCVDLVN-------GYDCKCRPGYVGKLC-------------DEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
SC ++ D C PC N G+C T Y C+C F G NC+ N C+ + C G K +D N+ CVCP G G C ++ C +C+NG C + + + C C KGF GK C + CK PC+ TG E L + C+CK + GK C ID C K+ + C NN C++ + C C GY G+ C + +P + MS + + P E+ + C +C N+G CV+ G K+ C C G G++C+
Sbjct: 933 SCQSGYGGSFCEVNIDDCASQPCINGGECGDGTG-MYFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFK-CECPSGVGGLFCEIDYVNECLSTKCYNNGSCVN---GFGKAICHCNKGSCGEKCE 1243

HSP 16 Score: 101.293 bits (251), Expect = 1.03574e-20
Identity = 90/319 (28.21%), Postives = 131/319 (41.07%), Query Frame = -2
Query: 6142 SCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-------------DINPCNNTGICESLP-DNDYRCACKPGWLGKNCNQNIDDC-KYNE-----CKNNAHCVDLVN-------GYDCKCRPGYVGKLC-------------DEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6978
SC ++ D C PC N G+C T Y C+C F G NC+ N C+ + C G K +D N+ CVCP G G C ++ C +C+NG C + + + C C KGF GK C + CK PC+ TG E L + C+CK + GK C ID C K+ + C NN C++ + C C GY G+ C + +P + MS + + P E+ + C +C N+G CV+ G K+ C C G G++C+
Sbjct: 933 SCQSGYGGSFCEVNIDDCASQPCINGGECGDGTG-MYFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFK-CECPSGVGGLFCEIDYVNECLSTKCYNNGSCVN---GFGKAICHCNKGSCGEKCE 1243

HSP 17 Score: 98.9821 bits (245), Expect = 4.7353e-20
Identity = 90/339 (26.55%), Postives = 143/339 (42.18%), Query Frame = 2
Query: 2414 ELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWL--NQFFMERFLDNGISLCASPENMKLKSIYHSKPTDF-SCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCE-KRINACFGHP-------------CKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD 3379
E+N+ P N + N QCI + F G N ++ + + + G D N F C CN ++ N ++R D+ + C + + + + + P +C K D C +PC + G C ++C+C + G+ CE K+ C + CK+ G C N G ++C C G+ G C NI+DCA C NG C D Y C C+ GF+G C + + C N CN + + N++ C C G G+ C +D CK EC+N C +++ ++C C G+ GKLC+
Sbjct: 735 EINECQHNPCSNDAKCIDHINDYQCICQSGFSG-KNCEINDNDCTESSCLGHGQCVD---------KVNGFECKCNENYIGTNCEHLKRPCDS--NPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCK-TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYS-NSCNTGKCIDQI--NNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 1057

HSP 18 Score: 98.9821 bits (245), Expect = 4.7353e-20
Identity = 90/339 (26.55%), Postives = 143/339 (42.18%), Query Frame = -2
Query: 6358 ELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWL--NQFFMERFLDNGISLCASPENMKLKSIYHSKPTDF-SCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCE-KRINACFGHP-------------CKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCD 7323
E+N+ P N + N QCI + F G N ++ + + + G D N F C CN ++ N ++R D+ + C + + + + + P +C K D C +PC + G C ++C+C + G+ CE K+ C + CK+ G C N G ++C C G+ G C NI+DCA C NG C D Y C C+ GF+G C + + C N CN + + N++ C C G G+ C +D CK EC+N C +++ ++C C G+ GKLC+
Sbjct: 735 EINECQHNPCSNDAKCIDHINDYQCICQSGFSG-KNCEINDNDCTESSCLGHGQCVD---------KVNGFECKCNENYIGTNCEHLKRPCDS--NPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCK-TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYS-NSCNTGKCIDQI--NNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 1057

HSP 19 Score: 98.2117 bits (243), Expect = 9.42736e-20
Identity = 88/275 (32.00%), Postives = 129/275 (46.91%), Query Frame = 2
Query: 2795 AKCDACIR-SPCKNNGKCSLV--THHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCV--DLVNGYDCKCRPG---YVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 3595
K D C + +PCK C V T Y+C CP +NC+K ++ C C NG C +V+N +C+C GF G C IN+C ++ C++G+ C D N Y C+C GF+GK C + + C NPC G C +RC C + G C +D C N C N+A C+ + + Y C C Y G C++ V + ++ R L L A V+S S CLND C++ + C+C + Y G+QC+
Sbjct: 442 TKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNN--EEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAH-NPCGLNGQCID-EVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEK-----DVDECNLDRTQLALYGLA------VLSMSNSQIGPCLNDNQCINT---NGSFICKCSSQYEGRQCE 695

HSP 20 Score: 98.2117 bits (243), Expect = 9.42736e-20
Identity = 88/275 (32.00%), Postives = 129/275 (46.91%), Query Frame = -2
Query: 6142 AKCDACIR-SPCKNNGKCSLV--THHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCV--DLVNGYDCKCRPG---YVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ 6942
K D C + +PCK C V T Y+C CP +NC+K ++ C C NG C +V+N +C+C GF G C IN+C ++ C++G+ C D N Y C+C GF+GK C + + C NPC G C +RC C + G C +D C N C N+A C+ + + Y C C Y G C++ V + ++ R L L A V+S S CLND C++ + C+C + Y G+QC+
Sbjct: 442 TKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNN--EEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAH-NPCGLNGQCID-EVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEK-----DVDECNLDRTQLALYGLA------VLSMSNSQIGPCLNDNQCINT---NGSFICKCSSQYEGRQCE 695

HSP 21 Score: 79.337 bits (194), Expect = 4.5228e-14
Identity = 60/200 (30.00%), Postives = 99/200 (49.50%), Query Frame = 2
Query: 3038 INDCADHKCENGASCDDSVNG-YNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDL-VNGYDCKCRPGYVGKLCDEP-----------AWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQH 3598
+N C +HKC+NGA+C +NG Y C C G++G +C K S C I PC N G C+ + N Y C C W+G+ C + +C + C+N C L ++ Y+C+C Y+G C+ P K + + ++ N N++ + C N G C++ + Q C+CKAG++G++C++
Sbjct: 21 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCP-ITPCQNGGTCKLIAGN-YVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQ---CKCKAGFNGERCEN 213

HSP 22 Score: 79.337 bits (194), Expect = 4.5228e-14
Identity = 60/200 (30.00%), Postives = 99/200 (49.50%), Query Frame = -2
Query: 6139 INDCADHKCENGASCDDSVNG-YNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDL-VNGYDCKCRPGYVGKLCDEP-----------AWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQH 6699
+N C +HKC+NGA+C +NG Y C C G++G +C K S C I PC N G C+ + N Y C C W+G+ C + +C + C+N C L ++ Y+C+C Y+G C+ P K + + ++ N N++ + C N G C++ + Q C+CKAG++G++C++
Sbjct: 21 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCP-ITPCQNGGTCKLIAGN-YVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQ---CKCKAGFNGERCEN 213

HSP 23 Score: 53.9138 bits (128), Expect = 2.06137e-06
Identity = 89/343 (25.95%), Postives = 130/343 (37.90%), Query Frame = 2
Query: 2744 KPTDF--SCTEETDDAYITAKCDACIR------SPCKNNGKC------SLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICK--NVDNYGNYECVCPLGFRGPKCN-ENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAH---CVDLVNGYDCKCRPGYVGKLCDEPAWK---PTVLKTSMSRRDLKLPHSANVN----ENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ-HLDSLFFSTDSYIEISPPSRGFLMPRGNITL 3688
+P F SC + Y + D C + PC NNG C + ++ + C CP+ + G+ C+ C + CKN GIC+ +D+ +++C CP G G C + +N+C KC N SC + C C KG G+ C + S CN I S D I DC+ N+C + A C N Y C G+ G C K + + + ++ S N+ N + C CL DG D G C Y+ QCQ +++ S D I SR +P G I L
Sbjct: 1093 RPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGS------ACNLASIDNSQTYQD----------------EISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIE--SRNSTIPGGIILL 1407

HSP 24 Score: 53.9138 bits (128), Expect = 2.06137e-06
Identity = 89/343 (25.95%), Postives = 130/343 (37.90%), Query Frame = -2
Query: 6049 KPTDF--SCTEETDDAYITAKCDACIR------SPCKNNGKC------SLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICK--NVDNYGNYECVCPLGFRGPKCN-ENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAH---CVDLVNGYDCKCRPGYVGKLCDEPAWK---PTVLKTSMSRRDLKLPHSANVN----ENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQ-HLDSLFFSTDSYIEISPPSRGFLMPRGNITL 6993
+P F SC + Y + D C + PC NNG C + ++ + C CP+ + G+ C+ C + CKN GIC+ +D+ +++C CP G G C + +N+C KC N SC + C C KG G+ C + S CN I S D I DC+ N+C + A C N Y C G+ G C K + + + ++ S N+ N + C CL DG D G C Y+ QCQ +++ S D I SR +P G I L
Sbjct: 1093 RPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGS------ACNLASIDNSQTYQD----------------EISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIE--SRNSTIPGGIILL 1407
BLAST of slit vs. Smed Unigenes AA
Match: SMU15026192 (SmedSxldir_c80425_g1_i1|m.21927|m.13931)

HSP 1 Score: 108.997 bits (271), Expect = 2.95505e-23
Identity = 81/258 (31.40%), Postives = 118/258 (45.74%), Query Frame = 2
Query: 2786 YITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNG-YNCVCKKGFRGKFCNLKFSFC-----KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNID-----DCKYNECKNNAHCVDLVNGYD-CKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC 3523
++ C PC N GKC +++C C H + G+ CE+ +N C +PCKNGG C + N + C C F G C N C + CENG +C+ NG + C C+ GF G+FC ++ C K CNN G C+ P+ C C PG+ G C++ + CK + C N C L NG C+C+ + GK C P LK + + + NE ++I + + C D LC
Sbjct: 18 WVIVSSKLCSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP------LKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC--DNLC 264

HSP 2 Score: 108.997 bits (271), Expect = 2.95505e-23
Identity = 81/258 (31.40%), Postives = 118/258 (45.74%), Query Frame = -2
Query: 6214 YITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNG-YNCVCKKGFRGKFCNLKFSFC-----KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNID-----DCKYNECKNNAHCVDLVNGYD-CKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC 6951
++ C PC N GKC +++C C H + G+ CE+ +N C +PCKNGG C + N + C C F G C N C + CENG +C+ NG + C C+ GF G+FC ++ C K CNN G C+ P+ C C PG+ G C++ + CK + C N C L NG C+C+ + GK C P LK + + + NE ++I + + C D LC
Sbjct: 18 WVIVSSKLCSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP------LKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC--DNLC 264
BLAST of slit vs. uniprot
Match: gi|33302576|sp|P24014|SLIT_DROME (RecName: Full=Protein slit; Short=dSlit; Contains: RecName: Full=Protein slit N-product; Contains: RecName: Full=Protein slit C-product; Flags: Precursor)

HSP 1 Score: 777.319 bits (2006), Expect = 0
Identity = 482/1529 (31.52%), Postives = 771/1529 (50.43%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +LRLN N ++ +P+ + +L +LD+ +N + + VF G +L++L LD N+I + E + L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L E SG A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSG---ARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 777.319 bits (2006), Expect = 0
Identity = 482/1529 (31.52%), Postives = 771/1529 (50.43%), Query Frame = -2
Query: 5086 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9549
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +LRLN N ++ +P+ + +L +LD+ +N + + VF G +L++L LD N+I + E + L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L E SG A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSG---ARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 3 Score: 286.96 bits (733), Expect = 1.96734e-76
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 2131
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 315 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 927

HSP 4 Score: 286.96 bits (733), Expect = 1.96734e-76
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = -2
Query: 7606 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 9561
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 315 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 927

HSP 5 Score: 168.318 bits (425), Expect = 4.76462e-40
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXX---------------XXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 2803
+ + CP+ C+CT VDC+ L+ +P + L ++ + N Q++ + + S +L+++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 6 Score: 168.318 bits (425), Expect = 4.76462e-40
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = -2
Query: 6934 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXX---------------XXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 8199
+ + CP+ C+CT VDC+ L+ +P + L ++ + N Q++ + + S +L+++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537
BLAST of slit vs. uniprot
Match: gi|45477220|sp|O88280|SLIT3_RAT (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 776.933 bits (2005), Expect = 0
Identity = 508/1589 (31.97%), Postives = 787/1589 (49.53%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNE--SSFKELENLKTLV-LSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAA-----------------TEVLKIGHMST--TTTMSNVSDVCSEPEMCKNGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 4639
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ +KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C+CS IV C GKG+ +P +LP I+E+ L N+I + A +YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ E C + CP+ C C +VDC+ LS +P ++ LP+ + + LS N+++EV + + ++ L+ N+++ + +F LK + L SN + CVNN TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R I G CQ P L+ P+ + + F C N N C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + + S+F++L TL+ LS N I+ L + + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCKNNG CS QY+C CP+ + GK+C IN C +PC++GG C +++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y CVC + G+ C+ +C ++N C + C SL D +RC C PG+ GK C + DDC ++C++ A CVD VNGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + +GH + T + S VC E G +C ++ND ++ + C+C+ GFSG C ++ C ++++ I+ +C + +V C G C S+CCQP + + R+ F+C G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEEN-----------------------SCQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSHGTCVATGNSYVCKCAEG-YEGPLCDQKNDSANACSAFKCHHGQCHISDRGEPYCLCQPGFSGNHCEQEN-PCLGEIVREAIRRQKDYASCATASKVPIMVCRGGCG---------------------SQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 776.933 bits (2005), Expect = 0
Identity = 508/1589 (31.97%), Postives = 787/1589 (49.53%), Query Frame = -2
Query: 5098 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNE--SSFKELENLKTLV-LSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAA-----------------TEVLKIGHMST--TTTMSNVSDVCSEPEMCKNGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 9549
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ +KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C+CS IV C GKG+ +P +LP I+E+ L N+I + A +YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ E C + CP+ C C +VDC+ LS +P ++ LP+ + + LS N+++EV + + ++ L+ N+++ + +F LK + L SN + CVNN TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R I G CQ P L+ P+ + + F C N N C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + + S+F++L TL+ LS N I+ L + + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCKNNG CS QY+C CP+ + GK+C IN C +PC++GG C +++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y CVC + G+ C+ +C ++N C + C SL D +RC C PG+ GK C + DDC ++C++ A CVD VNGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + +GH + T + S VC E G +C ++ND ++ + C+C+ GFSG C ++ C ++++ I+ +C + +V C G C S+CCQP + + R+ F+C G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEEN-----------------------SCQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSHGTCVATGNSYVCKCAEG-YEGPLCDQKNDSANACSAFKCHHGQCHISDRGEPYCLCQPGFSGNHCEQEN-PCLGEIVREAIRRQKDYASCATASKVPIMVCRGGCG---------------------SQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 3 Score: 224.557 bits (571), Expect = 3.48521e-57
Identity = 144/473 (30.44%), Postives = 245/473 (51.80%), Query Frame = 2
Query:  185 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 1591
+CP C+C+ ++C ++ L +P +PE T L L N I V+ T F K+ NL+ + LSNNRI + G FD + + +L L N ++ + +F L L+ L LR N + C+N + F GL +++ L L N+I IS + L +L T+++ N NCNCH+AWL R+++ + +++ NP+ C PF L +IPI ++ +F C + +NS CQ + C + CTC E +V+C +G+ ++P+ +P + EL L N + + + LS ++ L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+++ + + +++F C + + C+ C N TC+ + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEENS----CQLSPR-CPEQCTC-VETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKE-LSTFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCSQDPVE 937

HSP 4 Score: 224.557 bits (571), Expect = 3.48521e-57
Identity = 144/473 (30.44%), Postives = 245/473 (51.80%), Query Frame = -2
Query: 8146 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 9552
+CP C+C+ ++C ++ L +P +PE T L L N I V+ T F K+ NL+ + LSNNRI + G FD + + +L L N ++ + +F L L+ L LR N + C+N + F GL +++ L L N+I IS + L +L T+++ N NCNCH+AWL R+++ + +++ NP+ C PF L +IPI ++ +F C + +NS CQ + C + CTC E +V+C +G+ ++P+ +P + EL L N + + + LS ++ L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+++ + + +++F C + + C+ C N TC+ + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEENS----CQLSPR-CPEQCTC-VETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKE-LSTFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCSQDPVE 937

HSP 5 Score: 179.489 bits (454), Expect = 1.96382e-43
Identity = 124/484 (25.62%), Postives = 212/484 (43.80%), Query Frame = 2
Query: 1541 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXI-----------------------KIDLSYNEIDHIDADVFMKNPKL------------------------KEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
P +CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL K + L++N + C+ + FR L DLE L L++N I+ I+ SF I+ L L+ N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C S P + + L CP+ C C + VDC L +IP +P E+ L++N++K++ +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TIGQFT--LCMAPVHLRGFSVADVQKKEYVC------PGPHSEAPACNANS--------------LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 179.489 bits (454), Expect = 1.96382e-43
Identity = 124/484 (25.62%), Postives = 212/484 (43.80%), Query Frame = -2
Query: 6958 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLI-----------------------KIDLSYNEIDHIDADVFMKNPKL------------------------KEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8196
P +CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL K + L++N + C+ + FR L DLE L L++N I+ I+ SF I+ L L+ N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C S P + + L CP+ C C + VDC L +IP +P E+ L++N++K++ +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TIGQFT--LCMAPVHLRGFSVADVQKKEYVC------PGPHSEAPACNANS--------------LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. uniprot
Match: gi|341942041|sp|Q9WVB4|SLIT3_MOUSE (RecName: Full=Slit homolog 3 protein; Short=Slit-3; Short=Slit3; Flags: Precursor)

HSP 1 Score: 775.007 bits (2000), Expect = 0
Identity = 513/1575 (32.57%), Postives = 788/1575 (50.03%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNE--SSFKELENLKTLV-LSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSN--VSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRK--------AYMCRRKMIKNHIKD-PDTTCLSLRRVRYRYC--EGSCADSKMQSDIQKSFFHKPVETAS------------SRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 4639
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ +KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C+CS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ E C + CP+ C C +VDC+ L+ +P ++ LP+ + + LS N+++EV + + ++ L+ N+++ + +F LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + + S+F++L TL+ LS N I+ L + + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCKNNG CS QY+C CP+ + GK+C IN C +PC++GG C +N + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ +C ++N C + C SL D +RC C PG+ GK C N DDC ++C++ A CVD VNGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E++ + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + V+ H T + + D C C++ G C D Y C C +G+ G C++K A+ C HI D + CL +C E C ++ I++ + TAS S+CCQP + + R+ F+C G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAK---VRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDS--VVCECHPGWTGPLCDQEARDPCLG-HSCRH-GTCMATGD---SYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQC--HISDRGEPYCLCQPGFSGHHCEQENPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 775.007 bits (2000), Expect = 0
Identity = 513/1575 (32.57%), Postives = 788/1575 (50.03%), Query Frame = -2
Query: 5098 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNE--SSFKELENLKTLV-LSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSN--VSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRK--------AYMCRRKMIKNHIKD-PDTTCLSLRRVRYRYC--EGSCADSKMQSDIQKSFFHKPVETAS------------SRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 9549
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ +KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C+CS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ E C + CP+ C C +VDC+ L+ +P ++ LP+ + + LS N+++EV + + ++ L+ N+++ + +F LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + + S+F++L TL+ LS N I+ L + + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCKNNG CS QY+C CP+ + GK+C IN C +PC++GG C +N + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ +C ++N C + C SL D +RC C PG+ GK C N DDC ++C++ A CVD VNGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E++ + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + V+ H T + + D C C++ G C D Y C C +G+ G C++K A+ C HI D + CL +C E C ++ I++ + TAS S+CCQP + + R+ F+C G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAK---VRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDS--VVCECHPGWTGPLCDQEARDPCLG-HSCRH-GTCMATGD---SYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQC--HISDRGEPYCLCQPGFSGHHCEQENPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 3 Score: 221.09 bits (562), Expect = 3.66069e-56
Identity = 141/473 (29.81%), Postives = 247/473 (52.22%), Query Frame = 2
Query:  185 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 1591
+CP C+C+ ++C ++ L +P +PE T L L N I+V+ T F K+ NL+ + LSNNRI + G FD + + +L L N ++ + +F L +L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCH+AWL R+++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C +G+ ++P+ +P + EL L N + + + LS ++ L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+++ + + +++F C + + C+ C N TC+ + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-VETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKE-LSAFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCSQDPVE 937

HSP 4 Score: 221.09 bits (562), Expect = 3.66069e-56
Identity = 141/473 (29.81%), Postives = 247/473 (52.22%), Query Frame = -2
Query: 8146 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 9552
+CP C+C+ ++C ++ L +P +PE T L L N I+V+ T F K+ NL+ + LSNNRI + G FD + + +L L N ++ + +F L +L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCH+AWL R+++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C +G+ ++P+ +P + EL L N + + + LS ++ L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+++ + + +++F C + + C+ C N TC+ + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-VETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKE-LSAFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCSQDPVE 937

HSP 5 Score: 183.341 bits (464), Expect = 1.27996e-44
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = 2
Query: 1541 PKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKI---------------DLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
P +CP CTC+ VDC+G L +P + L +V I+ Q++ L N +++ DLS N+I I F +K + L++N + C+ + FR L DLE L L++N I+ I+ SF I+ L L+ N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C S P + + L CP+ C C + VDC L +IP +P E+ L++N++K++ +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TIGQFT--LCMAPVHLRGFSVADVQKKEYVC------PGPHSEAPACNANS--------------LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 183.341 bits (464), Expect = 1.27996e-44
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = -2
Query: 6958 PKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKI---------------DLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8196
P +CP CTC+ VDC+G L +P + L +V I+ Q++ L N +++ DLS N+I I F +K + L++N + C+ + FR L DLE L L++N I+ I+ SF I+ L L+ N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C S P + + L CP+ C C + VDC L +IP +P E+ L++N++K++ +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TIGQFT--LCMAPVHLRGFSVADVQKKEYVC------PGPHSEAPACNANS--------------LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. uniprot
Match: gi|311033528|sp|O75094|SLIT3_HUMAN (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 767.303 bits (1980), Expect = 0
Identity = 502/1586 (31.65%), Postives = 774/1586 (48.80%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSNVSDVC-------------SEPEMCK-----NGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCL 4642
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ ++KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C CTCS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ + E C + CP+ C C +VDC+ L +P ++ LP+ + + LS NK++EV + + ++ L+ N+++ + VF LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC L W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + L +L + LS N I+ L + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCKNNG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ C ++N C + C L D + C C PG+ GK C + DDC ++C++ A CVD +NGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + D C MCK G +C +ND ++ + C+C+ GFSG+ C ++ C ++++ I+ +C + +V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGCG---------------------PQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 2 Score: 767.303 bits (1980), Expect = 0
Identity = 502/1586 (31.65%), Postives = 774/1586 (48.80%), Query Frame = -2
Query: 5095 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-LKNLE------------------------TLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNM-------------------------LPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFC-KDINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGT------ESVTKAATEVLKIGHMSTTTTMSNVSDVC-------------SEPEMCK-----NGGVCQEQND------------------EKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCL 9549
CP C C + S++C LR VP +P +L+L N I + K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q I F G+ ++KNL LD N I I + R L++LE TL + N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C CTCS IV C GKG+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N++ DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL+ ++ L+L NP C+C L WL+ +L+ E SG A C P+ L + + I+S +F C+ E+ + E C + CP+ C C +VDC+ L +P ++ LP+ + + LS NK++EV + + ++ L+ N+++ + VF LK + L SN + CV+N TF L + L L DN I I G+F ++ + L NP +CNC L W+ W R I G CQ P L+ P+ + + F C NE +S C+ RCP +C C T V CS L +P G+P + TELYL+ N+L + L +L + LS N I+ L + + +L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCKNNG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CPLGF G +C N +DC D+ CEN A+C D +N Y C+C + G+ C+ C ++N C + C L D + C C PG+ GK C + DDC ++C++ A CVD +NGY C C G+ G C+ P P VL + S C ++C N C+ Q+ CRC G++G +C+ L ++ F DSY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + +NS +++GG P +AL + F GC+ + INN+ DF +++ V PGCK SV K + + D C MCK G +C +ND ++ + C+C+ GFSG+ C ++ C ++++ I+ +C + +V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCD---GNEESS--------------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL----------------------LQTSPCDQYECQNGAQCIVV---QQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGCG---------------------PQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 3 Score: 215.312 bits (547), Expect = 2.07801e-54
Identity = 140/473 (29.60%), Postives = 245/473 (51.80%), Query Frame = 2
Query:  185 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 1591
+CP C+C+ ++C ++ L +P +PE L L N ++V+ T F K+ NL+ + LSNN+I + G FD + + +L L N ++ + +F L L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCHLAWL ++++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C KG++++P+ +P + EL L N + + + LS ++L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+ + + + +++F C + + C+ C N TCT + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE-LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCTQDPVE 937

HSP 4 Score: 215.312 bits (547), Expect = 2.07801e-54
Identity = 140/473 (29.60%), Postives = 245/473 (51.80%), Query Frame = -2
Query: 8146 ICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTD-FSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLR--FKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVD 9552
+CP C+C+ ++C ++ L +P +PE L L N ++V+ T F K+ NL+ + LSNN+I + G FD + + +L L N ++ + +F L L+ L LR N + C++ + F GL +++ L L N+I I+ + L +L T+++ N NCNCHLAWL ++++ + +++ NP+ C PF L +IPI ++ +F C + ++S CQ + C + CTC E +V+C KG++++P+ +P + EL L N + + + LS ++L I L+ N + + F + L++L L+ N+L+ I +A GL SL L +H NDI +P+ +F N L L +L L NPL+C+C L WLS +++ +KE +A C P+ + + + +++F C + + C+ C N TCT + V+
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-RIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESS----CQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE-LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSF------------------------NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSS-PCKNNGTCTQDPVE 937

HSP 5 Score: 179.104 bits (453), Expect = 2.46727e-43
Identity = 121/484 (25.00%), Postives = 217/484 (44.83%), Query Frame = 2
Query: 1541 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 2779
P ++CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL ++L+ N+++ + + FR + D++ L+L +N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C +E S N + CP+ C C + VDC L +IP +P E+ L++N++K + +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFT--LCMAPVHLRGFNVADVQKKEYVC-PAPHSEPPSCN-------------------ANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 179.104 bits (453), Expect = 2.46727e-43
Identity = 121/484 (25.00%), Postives = 217/484 (44.83%), Query Frame = -2
Query: 6958 PKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLI-----------------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVV------------------------SFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETD 8196
P ++CP CTC+ VDC+G L +P + + + + L N + +T + ++ L+ N++ + +F PKL ++L+ N+++ + + FR + D++ L+L +N I+CI +G+F+ +++ LTLN N L+C+C L W+SDW R T+G T LC +P L+G ++ + +K + C +E S N + CP+ C C + VDC L +IP +P E+ L++N++K + +F + + LK + +S N I+++ + L++L +LV+ + NK+ C+ + F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFT--LCMAPVHLRGFNVADVQKKEYVC-PAPHSEPPSCN-------------------ANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. uniprot
Match: gi|145559530|sp|O75093|SLIT1_HUMAN (RecName: Full=Slit homolog 1 protein; Short=Slit-1; AltName: Full=Multiple epidermal growth factor-like domains protein 4; Short=Multiple EGF-like domains protein 4; Flags: Precursor)

HSP 1 Score: 758.829 bits (1958), Expect = 0
Identity = 498/1582 (31.48%), Postives = 762/1582 (48.17%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEE------QDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS--GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGC----KVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEP---EMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYM---CRR-KMIKNHIKDPDTT---CLSLRRVRYRYCEGSCADSKMQSDIQKSFFH-----------KPVETASSR-------CCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 4639
+ CP C C +++C L+ +P+++P T +L L GN I + K DF+ + L++LQL N+I +E G FD + +L +LRLNRN + LP+ LF + L +LDL +N +Q I F G +LKNL LD+N+I I E R + L T + N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + C C CTCS GIV C GKG+ ++P +LP ++ E+ L N I + A S Y+ L++I L+ N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L+ ++ L+L NP C+C L WL+ FLR E SG A C P+ L + + I+S +F C+ +E+ +D + + E C + CP C C VV+C+ L+ +P+ + ST + L+ N++ + L +L KI+LS N++ I+ F + E++L +N+L+ + + FR L L TL L +N I+CI SF N++ L+L NP +CNCQL W+ W R I G CQ+P L+ PL + F+C E C +CP +C C T V CS L +P GIP N TELYLD N TL + L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L ND++T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P++M+ K + + F C A + AKCD C+ SPC+N G C Y+C CP + G++CE +++C PC+NGG C + + C CP GF GP C N +DC DH C NG C D V Y C C + GK C C D+NPC + C PD RC C PG+ G NC++N DDC+ + C+N A C+D VN Y C C GY G+LC+ P P +S C +C N CV QG+ + C+C G+ G +C+ L S+ F D+Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + ++ LNS +++GG P + AA + + + T F GC++ L INN+ DF K + V PGC K+ + + + H + P C +G Q + Y C C+DG+SG CN+ + CR + + H + T C+ CE +S+ + D + F +P+ R CCQ + + R+ F+C G + V +C C
Sbjct: 30 GASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSE-CNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEGQEEGG----------------------CLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPA-------------------------PKSPCEGTECQNGANCVD--QGN-RPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDNF----GKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHG---QCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCE---QESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530

HSP 2 Score: 758.829 bits (1958), Expect = 0
Identity = 498/1582 (31.48%), Postives = 762/1582 (48.17%), Query Frame = -2
Query: 5098 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEE------QDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLN------------------------RNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPLGFRGPKCNENINDCADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS--GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGC----KVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEP---EMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYM---CRR-KMIKNHIKDPDTT---CLSLRRVRYRYCEGSCADSKMQSDIQKSFFH-----------KPVETASSR-------CCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKC 9561
+ CP C C +++C L+ +P+++P T +L L GN I + K DF+ + L++LQL N+I +E G FD + +L +LRLNRN + LP+ LF + L +LDL +N +Q I F G +LKNL LD+N+I I E R + L T + N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + C C CTCS GIV C GKG+ ++P +LP ++ E+ L N I + A S Y+ L++I L+ N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L+ ++ L+L NP C+C L WL+ FLR E SG A C P+ L + + I+S +F C+ +E+ +D + + E C + CP C C VV+C+ L+ +P+ + ST + L+ N++ + L +L KI+LS N++ I+ F + E++L +N+L+ + + FR L L TL L +N I+CI SF N++ L+L NP +CNCQL W+ W R I G CQ+P L+ PL + F+C E C +CP +C C T V CS L +P GIP N TELYLD N TL + L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L ND++T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P++M+ K + + F C A + AKCD C+ SPC+N G C Y+C CP + G++CE +++C PC+NGG C + + C CP GF GP C N +DC DH C NG C D V Y C C + GK C C D+NPC + C PD RC C PG+ G NC++N DDC+ + C+N A C+D VN Y C C GY G+LC+ P P +S C +C N CV QG+ + C+C G+ G +C+ L S+ F D+Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + ++ LNS +++GG P + AA + + + T F GC++ L INN+ DF K + V PGC K+ + + + H + P C +G Q + Y C C+DG+SG CN+ + CR + + H + T C+ CE +S+ + D + F +P+ R CCQ + + R+ F+C G + V +C C
Sbjct: 30 GASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSE-CNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEGQEEGG----------------------CLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPA-------------------------PKSPCEGTECQNGANCVD--QGN-RPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDNF----GKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHG---QCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCE---QESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136484|ref|NP_476729.1| (slit, isoform B [Drosophila melanogaster])

HSP 1 Score: 789.26 bits (2037), Expect = 0
Identity = 479/1492 (32.10%), Postives = 770/1492 (51.61%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDI-SRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ F GL L+ L L+ N + + +I L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L K + A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1468

HSP 2 Score: 789.26 bits (2037), Expect = 0
Identity = 479/1492 (32.10%), Postives = 770/1492 (51.61%), Query Frame = -2
Query: 5086 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDI-SRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9549
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ F GL L+ L L+ N + + +I L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L K + A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1468

HSP 3 Score: 286.96 bits (733), Expect = 1.83483e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 2131
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 291 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 903

HSP 4 Score: 286.96 bits (733), Expect = 1.83483e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = -2
Query: 7606 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 9561
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 291 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 903

HSP 5 Score: 177.178 bits (448), Expect = 1.17685e-43
Identity = 123/469 (26.23%), Postives = 217/469 (46.27%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------LPSTKVVILSYNKLQEVTXXXXXXXXXXXI---------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 2803
+ + CP+ C+CT VDC+ L+ +P + L + ++ Q +T L N I ++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 6 Score: 177.178 bits (448), Expect = 1.17685e-43
Identity = 123/469 (26.23%), Postives = 217/469 (46.27%), Query Frame = -2
Query: 6934 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------LPSTKVVILSYNKLQEVTXXXXXXXXXXLI---------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 8199
+ + CP+ C+CT VDC+ L+ +P + L + ++ Q +T L N I ++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 7 Score: 112.849 bits (281), Expect = 4.23179e-24
Identity = 67/229 (29.26%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 2216 RCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVS------------------------FNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCK 2830
RCP C C VDCS L +P I + L L NNL + E+ F+ L L+ L L+ N I + +N L +LE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300

HSP 8 Score: 112.849 bits (281), Expect = 4.23179e-24
Identity = 67/229 (29.26%), Postives = 104/229 (45.41%), Query Frame = -2
Query: 6907 RCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVS------------------------FNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCK 7521
RCP C C VDCS L +P I + L L NNL + E+ F+ L L+ L L+ N I + +N L +LE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136482|ref|NP_476728.1| (slit, isoform A [Drosophila melanogaster])

HSP 1 Score: 779.63 bits (2012), Expect = 0
Identity = 479/1503 (31.87%), Postives = 770/1503 (51.23%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDI-SRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ F GL L+ L L+ N + + +I L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L K + A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 2 Score: 779.63 bits (2012), Expect = 0
Identity = 479/1503 (31.87%), Postives = 770/1503 (51.23%), Query Frame = -2
Query: 5086 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDI-SRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9549
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ F GL L+ L L+ N + + +I L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L K + A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 3 Score: 286.574 bits (732), Expect = 2.32322e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 2131
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 291 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 903

HSP 4 Score: 286.574 bits (732), Expect = 2.32322e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = -2
Query: 7606 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 9561
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 291 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 903

HSP 5 Score: 176.792 bits (447), Expect = 1.57013e-43
Identity = 123/469 (26.23%), Postives = 217/469 (46.27%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------LPSTKVVILSYNKLQEVTXXXXXXXXXXXI---------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 2803
+ + CP+ C+CT VDC+ L+ +P + L + ++ Q +T L N I ++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 6 Score: 176.792 bits (447), Expect = 1.57013e-43
Identity = 123/469 (26.23%), Postives = 217/469 (46.27%), Query Frame = -2
Query: 6934 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------LPSTKVVILSYNKLQEVTXXXXXXXXXXLI---------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 8199
+ + CP+ C+CT VDC+ L+ +P + L + ++ Q +T L N I ++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 7 Score: 112.849 bits (281), Expect = 4.86127e-24
Identity = 67/229 (29.26%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 2216 RCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVS------------------------FNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCK 2830
RCP C C VDCS L +P I + L L NNL + E+ F+ L L+ L L+ N I + +N L +LE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300

HSP 8 Score: 112.849 bits (281), Expect = 4.86127e-24
Identity = 67/229 (29.26%), Postives = 104/229 (45.41%), Query Frame = -2
Query: 6907 RCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVS------------------------FNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCK 7521
RCP C C VDCS L +P I + L L NNL + E+ F+ L L+ L L+ N I + +N L +LE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077130|ref|NP_001097333.1| (slit, isoform D [Drosophila melanogaster])

HSP 1 Score: 779.63 bits (2012), Expect = 0
Identity = 479/1503 (31.87%), Postives = 770/1503 (51.23%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDI-SRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ F GL L+ L L+ N + + +I L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L K + A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 2 Score: 779.63 bits (2012), Expect = 0
Identity = 479/1503 (31.87%), Postives = 770/1503 (51.23%), Query Frame = -2
Query: 5086 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDI-SRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9549
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ F GL L+ L L+ N + + +I L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L K + A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 3 Score: 286.574 bits (732), Expect = 2.32322e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 2131
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 291 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 903

HSP 4 Score: 286.574 bits (732), Expect = 2.32322e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = -2
Query: 7606 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 9561
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 291 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 903

HSP 5 Score: 176.792 bits (447), Expect = 1.57013e-43
Identity = 123/469 (26.23%), Postives = 217/469 (46.27%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------LPSTKVVILSYNKLQEVTXXXXXXXXXXXI---------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 2803
+ + CP+ C+CT VDC+ L+ +P + L + ++ Q +T L N I ++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 6 Score: 176.792 bits (447), Expect = 1.57013e-43
Identity = 123/469 (26.23%), Postives = 217/469 (46.27%), Query Frame = -2
Query: 6934 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------LPSTKVVILSYNKLQEVTXXXXXXXXXXLI---------------KIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 8199
+ + CP+ C+CT VDC+ L+ +P + L + ++ Q +T L N I ++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 7 Score: 112.849 bits (281), Expect = 4.86127e-24
Identity = 67/229 (29.26%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 2216 RCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVS------------------------FNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCK 2830
RCP C C VDCS L +P I + L L NNL + E+ F+ L L+ L L+ N I + +N L +LE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300

HSP 8 Score: 112.849 bits (281), Expect = 4.86127e-24
Identity = 67/229 (29.26%), Postives = 104/229 (45.41%), Query Frame = -2
Query: 6907 RCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVS------------------------FNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCK 7521
RCP C C VDCS L +P I + L L NNL + E+ F+ L L+ L L+ N I + +N L +LE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136480|ref|NP_476727.1| (slit, isoform C [Drosophila melanogaster])

HSP 1 Score: 777.319 bits (2006), Expect = 0
Identity = 482/1529 (31.52%), Postives = 771/1529 (50.43%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +LRLN N ++ +P+ + +L +LD+ +N + + VF G +L++L LD N+I + E + L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L E SG A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSG---ARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 777.319 bits (2006), Expect = 0
Identity = 482/1529 (31.52%), Postives = 771/1529 (50.43%), Query Frame = -2
Query: 5086 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9549
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +LRLN N ++ +P+ + +L +LD+ +N + + VF G +L++L LD N+I + E + L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L E SG A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSG---ARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 3 Score: 286.96 bits (733), Expect = 2.271e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 2131
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 315 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 927

HSP 4 Score: 286.96 bits (733), Expect = 2.271e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = -2
Query: 7606 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 9561
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 315 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 927

HSP 5 Score: 168.318 bits (425), Expect = 5.50005e-41
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXX---------------XXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 2803
+ + CP+ C+CT VDC+ L+ +P + L ++ + N Q++ + + S +L+++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 6 Score: 168.318 bits (425), Expect = 5.50005e-41
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = -2
Query: 6934 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXX---------------XXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 8199
+ + CP+ C+CT VDC+ L+ +P + L ++ + N Q++ + + S +L+++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077132|ref|NP_001097334.1| (slit, isoform E [Drosophila melanogaster])

HSP 1 Score: 777.319 bits (2006), Expect = 0
Identity = 482/1529 (31.52%), Postives = 771/1529 (50.43%), Query Frame = 2
Query:  188 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 4651
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +LRLN N ++ +P+ + +L +LD+ +N + + VF G +L++L LD N+I + E + L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L E SG A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSG---ARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 777.319 bits (2006), Expect = 0
Identity = 482/1529 (31.52%), Postives = 771/1529 (50.43%), Query Frame = -2
Query: 5086 CPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISEDISR-------------------------LKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFK--EASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDC-ADHKCENGASCDDSVNGYNCVCKKGFRGKFCNLKFSFCK-DINPCNNTGICESLPDNDYRCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKLCDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLCVSDLQGDQKSYCRCKAGYSGQQCQHLDSL-FFSTDSYIEISPPSRGFLMPRGNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNSGIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRAVNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNGGVCQEQNDEKKKYKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRIEFKCDSGRQYFRVVHFVRRCKCLPNC 9549
CP C C +++C HR L +VP + +L L GN + V+ +TDF ++ L++LQL++N+I TIE +F L L +LRLN N ++ +P+ + +L +LD+ +N + + VF G +L++L LD N+I + E + L L L +S N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C K + SVP LP EL L N I L + S ++ L++I L+ N + I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ KD F L L LL L +N + +L T + +K ++ ++L NP C+C L WL+ +L E SG A C PK +H + + ++ +F C+ +E + + + C CP C C VDC G L +P ++ T ++L+ N+L +++ LP+L+K++L N++ I+ + F ++E+ L N++K ++N+ F LH L+TL L DN I+C++ GSF+ ++ L L NP +CNC L W ++W R + GA C +P+ ++ + L F+C ++EN S C G CP C C T V CS QL++IP GIP T+ELYL+ N ++ ++ + L +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC+N +C + +YQC C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NI+DC + KC+N A+C D V Y C C+ GF G+FC+ K FC + NPC N C + Y C C+ G+ G NC NIDDC+ + C+N CVD +N Y C+C Y GK C+ N+ S C H+C G+C CRC GY+G+ C++L S+ F +S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L + +F+GG P + A + + + T F GC++ + IN+K +DF R + PGC ++ E + + + T D C E C+ G C ++ + Y+C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C + +CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSG---ARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKC----SSEN-SEGCLGDGY------------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE----------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDF-GNAQRQQKITPGCALL--EGEQQEEEDDEQDFMDETPHIKEEPVDPCLE-NKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 3 Score: 286.96 bits (733), Expect = 2.271e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = 2
Query:  176 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 2131
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 315 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 927

HSP 4 Score: 286.96 bits (733), Expect = 2.271e-77
Identity = 202/656 (30.79%), Postives = 321/656 (48.93%), Query Frame = -2
Query: 7606 STNICPNGCQCDSYSMECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNNRITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCINENVFIGLDNLKNLYLDRNKIFWISED-ISRLKNLETLHISLNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCTCSTEG-IVKCVGKGIKSVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSENKLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVASCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTCTPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTXXXXXXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNE 9561
+ N CP+ C+C ++C+ + L +VP ++P+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ CI ++ F L +L L L N I ++ +K+++T+H++ N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C G+G+K +P+D+P EL L+DN + + + L + +L K+ L N++ IEP AFEG + L L NK+K I +GL L L +++N I C+ +F L N LT+L L NP NCNC L W + +LR K +G A C P + ++ + +F C+ E + E C+ CP +CTCT VV C+ L +P + T + L N+++++ + + L +L ++DLS N+I + F KL + ++ N+L+C+ L++L L L N I+ + EGSF++ ++ H+ L NPL+C+C LKW SDW + Y+ G C P ++ + S F CR V N+
Sbjct: 315 AENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHL----------NSLTSLN--------------LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSSE-------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRND 927

HSP 5 Score: 168.318 bits (425), Expect = 5.50005e-41
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = 2
Query: 1538 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXX---------------XXXXXXXIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXXKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 2803
+ + CP+ C+CT VDC+ L+ +P + L ++ + N Q++ + + S +L+++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 6 Score: 168.318 bits (425), Expect = 5.50005e-41
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = -2
Query: 6934 VPKISCPKNCTCTPEVVDCNGAHLSIMPDNM--------------------------------LPSTKVVILSYNKLQEVTXXXX---------------XXXXXXLIKIDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLKLSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITLGAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGXXXXXXXXXXXSKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYLDRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSFNKLQ------------------------CIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEETDDAYITAKC 8199
+ + CP+ C+CT VDC+ L+ +P + L ++ + N Q++ + + S +L+++D+S N I + VF L+ + L++N++ C++ F+ L +LE L L++N + + F G ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G ++ L ++ F+C + + P +EC CP CRC VDC L +P+ +P +TTEL L++N + L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI +DAF+ L +L +L L N++ ++ GTF ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKC------SGLTEHAP--------------MECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537
The following BLAST results are available for this feature:
BLAST of slit vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|11321571|ref|NP_003053.1|7.776330e-5531.65slit homolog 3 protein isoform 2 precursor [Homo s... [more]
gi|429836873|ref|NP_001258875.1|3.702530e-5431.53slit homolog 3 protein isoform 1 precursor [Homo s... [more]
gi|188528675|ref|NP_003052.2|0.000000e+031.48slit homolog 1 protein precursor [Homo sapiens][more]
gi|574281850|ref|NP_001276064.1|8.242310e-4531.38slit homolog 2 protein isoform 2 precursor [Homo s... [more]
gi|574281382|ref|NP_001276065.1|1.307940e-4431.25slit homolog 2 protein isoform 3 precursor [Homo s... [more]
back to top
BLAST of slit vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150367780.000000e+062.08dd_smedV4_12111_0_1|m.4973|m.1592[more]
SMU150061401.564690e-3131.32SmedAsxldir_c107649_g2_i1|m.84323|m.17798[more]
SMU150371143.489140e-3036.24dd_smedV4_13823_0_1|m.8312|m.39635[more]
SMU150063177.414050e-3034.96SmedAsxldir_c107934_g5_i1|m.86273|m.14433[more]
SMU150261922.955050e-2331.40SmedSxldir_c80425_g1_i1|m.21927|m.13931[more]
back to top
BLAST of slit vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|33302576|sp|P24014|SLIT_DROME1.967340e-7631.52RecName: Full=Protein slit; Short=dSlit; Contains:... [more]
gi|45477220|sp|O88280|SLIT3_RAT3.485210e-5731.97RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|341942041|sp|Q9WVB4|SLIT3_MOUSE3.660690e-5632.57RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|311033528|sp|O75094|SLIT3_HUMAN2.078010e-5431.65RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|145559530|sp|O75093|SLIT1_HUMAN0.000000e+031.48RecName: Full=Slit homolog 1 protein; Short=Slit-1... [more]
back to top
BLAST of slit vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136484|ref|NP_476729.1|1.834830e-7732.10slit, isoform B [Drosophila melanogaster][more]
gi|17136482|ref|NP_476728.1|2.323220e-7731.87slit, isoform A [Drosophila melanogaster][more]
gi|161077130|ref|NP_001097333.1|2.323220e-7731.87slit, isoform D [Drosophila melanogaster][more]
gi|17136480|ref|NP_476727.1|2.271000e-7731.52slit, isoform C [Drosophila melanogaster][more]
gi|161077132|ref|NP_001097334.1|2.271000e-7731.52slit, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_016847 ID=Pgr_016847|Name=slit|organism=Phagocata gracilis|type=mRNA|length=9736bp
CAATTATCGACATACTGAATTTAGTATTAAAAGCAGATTTTTATCGATGT
AATTTGCATTCAAGTTTTCAATAATGCAAACTTTAAACATCAATATTTGG
TTTTTGTTTTCTATAATGTTATTGCTTGCGATTTGCAAATCATATTCAAG
CACATGGTATCATGACACGATTGAAAGTACAAATATTTGCCCAAATGGTT
GCCAATGTGACAGTTACTCGATGGAGTGTAAACATCGATTGTTGAGAAAT
GTTCCAGAATCAGTTCCGGAGAAAACGGTAAAACTGAATCTCTTGGGAAA
TCGAATAAATGTCGTTAGAAAGACTGACTTCTCAAAAGTGGTCAATCTTA
AGATTTTACAACTGTCAAATAACCGAATCACTACTATAGAAGCGGGAACA
TTTGATACGTTGAGTCAGTTGACAAAATTGCGCCTGAATCGTAATCTGAT
TCAATACCTACCGGATGGTTTATTCTCGAAATTGAAGAATTTACAGAAAT
TAGATCTGAGAGATAATCAGCTACAATGTATCAATGAGAATGTCTTTATC
GGGCTCGATAATTTGAAGAATTTATATTTGGATCGTAATAAGATATTCTG
GATATCGGAGGACATATCGAGACTAAAGAACCTCGAAACTTTACACATAT
CTTTGAACAAACTCAACTGTAACTGTCATTTGGCGTGGCTCAACAGATTC
ATCAAACATCAGCCTCAAGTCATCAAACCGAATCCGCAGTCTGTGCTTTG
TGCCACTCCATTTCGACTGTCACAAATCCCAATATCGAGTCTGAGCTCAT
ATGAATTCCAGTGTGCAAGTGACAGCAAGAACAGTTTGGAGAATATTTGC
CAACCGAAAAAGAAACTTTGCTCAAAACACTGCACCTGCTCCACCGAAGG
AATCGTCAAGTGTGTCGGCAAAGGAATCAAAAGTGTACCACAAGATTTAC
CGACAAGTATCATAGAATTAGATCTCCATGACAATGCTATTAATGTTCTG
AAACAGAACGCTTTGTCGAAATACAAAAATCTGAAAAAAATATTACTGAA
TGGTAATGAGATGATTGACATTGAGCCAGGAGCATTCGAAGGACTTCGAC
AACTGACGTCTTTATATCTCAACGGCAACAAGCTCAAGTCTATCCGAAAG
AATGCTCTTATTGGTTTATCGTCACTTATGTTTTTATATATTCACAACAA
TGACATAGAGTGTTTGCCTAAGGATACATTCGCTGGTCTTAGTAGACTAT
ATTTACTACATTTATCGGAAAATAAGCTCACAACTCTAAAGAAAGAAACC
CTGAATCCGCTCAAAAAACTGCGTTACTTATATCTCGTACATAATCCCCT
CAACTGCAACTGTAAACTCGGATGGCTGTCGGCATTTCTACGATTTAAGG
AGGCCAGCGGCAGTCCAGTGGCTTCGTGTCTGCAGCCAAAGAATTTGCAC
GGTCAGCCAGTTAGAGGCATCCAATCATATCAGTTCAATTGCGCCCAAGA
AGAGGAACAAGACGCGGAGACCCACGACGAGGATTGTGTGCCGAAGATTA
GCTGTCCGAAAAATTGCACATGCACACCGGAAGTAGTCGATTGCAATGGG
GCCCATTTGTCGATTATGCCCGACAATATGCTGCCATCAACGAAAGTTGT
GATTTTGTCGTATAATAAACTCCAAGAAGTCACCAATCCATCTCCTCTTC
TCTCTCTACCAAATCTCATCAAAATAGACTTGTCATACAATGAAATAGAT
CACATCGATGCCGACGTTTTCATGAAGAATCCAAAGCTCAAGGAAATAAA
TCTCAACTCCAATCGACTGAAATGCGTCAACAATCAGACATTCAGAATGC
TTCACGACCTGGAGACATTAAAACTCAGCGACAACATGATAGCATGCATC
GTGGAGGGCTCCTTCCAAGAGAATGGAAACATAAAGCATCTGACTCTGAA
CAGGAATCCTCTTCACTGTAATTGCCAATTGAAATGGATGTCAGACTGGG
CTCGTACTCACTACATTACACTGGGAGCCCATACCGCAGTTCTCTGTCAG
AGTCCAGCCCTTCTCCAAGGCACCCCTCTGTCCAGTCTCGATGAAAAATA
CTTCCAGTGTCGTGAGAATGTCACAAATGAGAATGCGAGCTCTAATTGTC
CCGGTAGTTCAGACTCAGAAAACTCGTGTTGCTCAATTTCTAAATTAGAG
TGTAAGAAAATACTACGATGCCCGGCCAAATGCCGCTGTGAATCTACGAA
GGTTGACTGCAGTTGGATACAACTTGAGGATATTCCGTTGGGTATACCAA
TTAACACCACTGAACTATACCTTGACAGAAATAATCTCAAGACTCTCAAT
GAATCATCATTTAAAGAGTTGGAGAACTTGAAAACACTAGTTCTGAGTTA
CAATGGAATAACCGAACTTAATAAGAATGTTTTGACGCCACTTAGAAATC
TTGAAACCCTAGTGGTAAGCTTCAACAAACTGCAATGTATAGATCGAGAT
GCATTTAAAGGATTAACCAATCTAAAAGTTCTGATATTGCAAAGCAACGA
TGTAGCAACAATTCCATTTGGGACTTTCCGAGATCTTCGGAACTTAAACA
ACATAGCATTGGGGCAAAATCCCTTCCACTGTGACTGCAACATTAAGTGG
CTGAATCAATTCTTCATGGAGCGATTCCTTGACAACGGCATCTCCTTATG
TGCCAGTCCTGAGAATATGAAACTGAAATCTATCTACCACTCGAAACCAA
CAGATTTCTCGTGTACAGAAGAGACCGATGACGCTTACATAACCGCCAAG
TGTGACGCTTGTATCAGGAGTCCGTGCAAAAACAATGGAAAATGTTCCCT
GGTGACCCATCATCAATATCAGTGCCAGTGTCCGCATCCGTTCCATGGGA
AAAATTGCGAAAAACGTATCAATGCTTGTTTCGGGCATCCGTGTAAGAAT
GGAGGAATTTGTAAAAATGTCGACAATTACGGAAATTATGAATGTGTCTG
TCCGTTAGGTTTTCGTGGGCCGAAATGTAATGAGAATATTAACGATTGTG
CTGACCACAAGTGCGAGAATGGCGCTTCATGCGACGATTCGGTTAATGGC
TACAATTGTGTCTGTAAGAAGGGCTTCAGAGGAAAGTTCTGCAATTTGAA
GTTTTCCTTCTGCAAGGACATCAATCCGTGTAACAACACTGGGATTTGTG
AATCACTGCCAGATAATGACTACAGATGTGCCTGTAAACCTGGTTGGTTG
GGCAAAAATTGCAACCAAAATATCGACGACTGCAAATATAATGAGTGCAA
AAACAATGCCCACTGTGTGGACTTGGTCAACGGATACGACTGCAAGTGTC
GTCCGGGCTATGTTGGCAAACTGTGCGATGAACCGGCCTGGAAACCGACC
GTTCTCAAGACAAGCATGTCACGACGGGACTTGAAGTTGCCGCACTCGGC
CAATGTTAATGAGAATGAGGTTATCTCAGAGTCGGTGTGTGCTTACCATC
AGTGTCTCAATGACGGACTGTGTGTCAGTGACTTACAAGGAGACCAGAAG
TCGTACTGTCGCTGCAAGGCAGGGTATTCAGGCCAGCAATGTCAACATCT
GGACAGTCTCTTCTTTTCGACAGACTCGTACATTGAGATATCACCTCCTT
CTAGAGGATTCTTGATGCCACGCGGGAATATTACTTTGAAGTTCTCCACT
AATTCATCGTCTGGCCTGCTACTGTATCAGGGTTTCGATCGCAAGTATCT
ATCTGTCAATCTCTATCGAGGTCACGTGAGAATTGGATACAATATCGGCG
ACAAGGTCATTGGGCCAGAGGGATATTCAATGAATAGTATCAATGACAGT
CGCCCACATTCACTCGAGATCGAGATAATCGGGGAAAATCTCACCATGTA
CTTGGACGGTCGTTTCCATTGCACTTTGAAGTCGAGTTATTCGTCCGGAA
ACCGTTATCTTGCTCTTAACAGTGGCATTTTCATTGGCGGGGCTCCGAAA
CTAATAATGGAGGCTGCCTTGTCGAAATATCATCTAGAGAGTAACACATA
TTTCGTCGGTTGTCTACAGTTTCTTTCTATAAACAATAAGAAGATCGACT
TCTTGAAGTACATGACTCGGGCGGTGAATGTGAAACCGGGCTGTAAAGTT
ATTGGAACGGAATCAGTGACGAAGGCAGCCACTGAAGTATTGAAAATTGG
TCACATGAGCACAACGACCACCATGTCTAATGTCAGTGATGTGTGCAGTG
AACCGGAGATGTGTAAGAATGGCGGGGTGTGTCAGGAACAAAATGATGAG
AAAAAGAAATACAAGTGCATTTGTAAAGATGGTTTCTCCGGGAAATCATG
TAACAGAAAAGCATACATGTGCCGCCGGAAAATGATCAAGAATCACATCA
AAGATCCGGACACGACTTGTCTGTCTTTGAGGAGGGTTCGCTACAGATAT
TGTGAGGGCTCTTGTGCAGACTCAAAAATGCAATCCGATATCCAGAAGAG
TTTCTTCCATAAACCGGTCGAAACCGCATCGTCTCGTTGTTGTCAGCCAT
ATAAATTTCGAACTAGACGTATAGAATTCAAGTGTGACTCTGGTAGACAA
TACTTTCGAGTGGTTCACTTCGTCAGACGTTGCAAATGTCTACCTAATTG
TACCAGTAAATAAGGATACAAAAGAGGAATCATAGGTTGCTGATATTTAT
CGATGTCTCCATTGATAACATTCTTCCTCTATCTATCTTCGTCATGTTAT
TCATTGTAATCAGTGGTTCTTATTAATTTTATGCATTTCAGTTGTTTCAA
TACTGTCTCATGTAGTTACCTCTGTGTATAGTCATTTGGAAAATAAAATT
TTATCAATTCGAAAAAAATTTTTTTCGAATTGATAAAATTTTATTTTCCA
AATGACTATACACAGAGGTAACTACATGAGACAGTATTGAAACAACTGAA
ATGCATAAAATTAATAAGAACCACTGATTACAATGAATAACATGACGAAG
ATAGATAGAGGAAGAATGTTATCAATGGAGACATCGATAAATATCAGCAA
CCTATGATTCCTCTTTTGTATCCTTATTTACTGGTACAATTAGGTAGACA
TTTGCAACGTCTGACGAAGTGAACCACTCGAAAGTATTGTCTACCAGAGT
CACACTTGAATTCTATACGTCTAGTTCGAAATTTATATGGCTGACAACAA
CGAGACGATGCGGTTTCGACCGGTTTATGGAAGAAACTCTTCTGGATATC
GGATTGCATTTTTGAGTCTGCACAAGAGCCCTCACAATATCTGTAGCGAA
CCCTCCTCAAAGACAGACAAGTCGTGTCCGGATCTTTGATGTGATTCTTG
ATCATTTTCCGGCGGCACATGTATGCTTTTCTGTTACATGATTTCCCGGA
GAAACCATCTTTACAAATGCACTTGTATTTCTTTTTCTCATCATTTTGTT
CCTGACACACCCCGCCATTCTTACACATCTCCGGTTCACTGCACACATCA
CTGACATTAGACATGGTGGTCGTTGTGCTCATGTGACCAATTTTCAATAC
TTCAGTGGCTGCCTTCGTCACTGATTCCGTTCCAATAACTTTACAGCCCG
GTTTCACATTCACCGCCCGAGTCATGTACTTCAAGAAGTCGATCTTCTTA
TTGTTTATAGAAAGAAACTGTAGACAACCGACGAAATATGTGTTACTCTC
TAGATGATATTTCGACAAGGCAGCCTCCATTATTAGTTTCGGAGCCCCGC
CAATGAAAATGCCACTGTTAAGAGCAAGATAACGGTTTCCGGACGAATAA
CTCGACTTCAAAGTGCAATGGAAACGACCGTCCAAGTACATGGTGAGATT
TTCCCCGATTATCTCGATCTCGAGTGAATGTGGGCGACTGTCATTGATAC
TATTCATTGAATATCCCTCTGGCCCAATGACCTTGTCGCCGATATTGTAT
CCAATTCTCACGTGACCTCGATAGAGATTGACAGATAGATACTTGCGATC
GAAACCCTGATACAGTAGCAGGCCAGACGATGAATTAGTGGAGAACTTCA
AAGTAATATTCCCGCGTGGCATCAAGAATCCTCTAGAAGGAGGTGATATC
TCAATGTACGAGTCTGTCGAAAAGAAGAGACTGTCCAGATGTTGACATTG
CTGGCCTGAATACCCTGCCTTGCAGCGACAGTACGACTTCTGGTCTCCTT
GTAAGTCACTGACACACAGTCCGTCATTGAGACACTGATGGTAAGCACAC
ACCGACTCTGAGATAACCTCATTCTCATTAACATTGGCCGAGTGCGGCAA
CTTCAAGTCCCGTCGTGACATGCTTGTCTTGAGAACGGTCGGTTTCCAGG
CCGGTTCATCGCACAGTTTGCCAACATAGCCCGGACGACACTTGCAGTCG
TATCCGTTGACCAAGTCCACACAGTGGGCATTGTTTTTGCACTCATTATA
TTTGCAGTCGTCGATATTTTGGTTGCAATTTTTGCCCAACCAACCAGGTT
TACAGGCACATCTGTAGTCATTATCTGGCAGTGATTCACAAATCCCAGTG
TTGTTACACGGATTGATGTCCTTGCAGAAGGAAAACTTCAAATTGCAGAA
CTTTCCTCTGAAGCCCTTCTTACAGACACAATTGTAGCCATTAACCGAAT
CGTCGCATGAAGCGCCATTCTCGCACTTGTGGTCAGCACAATCGTTAATA
TTCTCATTACATTTCGGCCCACGAAAACCTAACGGACAGACACATTCATA
ATTTCCGTAATTGTCGACATTTTTACAAATTCCTCCATTCTTACACGGAT
GCCCGAAACAAGCATTGATACGTTTTTCGCAATTTTTCCCATGGAACGGA
TGCGGACACTGGCACTGATATTGATGATGGGTCACCAGGGAACATTTTCC
ATTGTTTTTGCACGGACTCCTGATACAAGCGTCACACTTGGCGGTTATGT
AAGCGTCATCGGTCTCTTCTGTACACGAGAAATCTGTTGGTTTCGAGTGG
TAGATAGATTTCAGTTTCATATTCTCAGGACTGGCACATAAGGAGATGCC
GTTGTCAAGGAATCGCTCCATGAAGAATTGATTCAGCCACTTAATGTTGC
AGTCACAGTGGAAGGGATTTTGCCCCAATGCTATGTTGTTTAAGTTCCGA
AGATCTCGGAAAGTCCCAAATGGAATTGTTGCTACATCGTTGCTTTGCAA
TATCAGAACTTTTAGATTGGTTAATCCTTTAAATGCATCTCGATCTATAC
ATTGCAGTTTGTTGAAGCTTACCACTAGGGTTTCAAGATTTCTAAGTGGC
GTCAAAACATTCTTATTAAGTTCGGTTATTCCATTGTAACTCAGAACTAG
TGTTTTCAAGTTCTCCAACTCTTTAAATGATGATTCATTGAGAGTCTTGA
GATTATTTCTGTCAAGGTATAGTTCAGTGGTGTTAATTGGTATACCCAAC
GGAATATCCTCAAGTTGTATCCAACTGCAGTCAACCTTCGTAGATTCACA
GCGGCATTTGGCCGGGCATCGTAGTATTTTCTTACACTCTAATTTAGAAA
TTGAGCAACACGAGTTTTCTGAGTCTGAACTACCGGGACAATTAGAGCTC
GCATTCTCATTTGTGACATTCTCACGACACTGGAAGTATTTTTCATCGAG
ACTGGACAGAGGGGTGCCTTGGAGAAGGGCTGGACTCTGACAGAGAACTG
CGGTATGGGCTCCCAGTGTAATGTAGTGAGTACGAGCCCAGTCTGACATC
CATTTCAATTGGCAATTACAGTGAAGAGGATTCCTGTTCAGAGTCAGATG
CTTTATGTTTCCATTCTCTTGGAAGGAGCCCTCCACGATGCATGCTATCA
TGTTGTCGCTGAGTTTTAATGTCTCCAGGTCGTGAAGCATTCTGAATGTC
TGATTGTTGACGCATTTCAGTCGATTGGAGTTGAGATTTATTTCCTTGAG
CTTTGGATTCTTCATGAAAACGTCGGCATCGATGTGATCTATTTCATTGT
ATGACAAGTCTATTTTGATGAGATTTGGTAGAGAGAGAAGAGGAGATGGA
TTGGTGACTTCTTGGAGTTTATTATACGACAAAATCACAACTTTCGTTGA
TGGCAGCATATTGTCGGGCATAATCGACAAATGGGCCCCATTGCAATCGA
CTACTTCCGGTGTGCATGTGCAATTTTTCGGACAGCTAATCTTCGGCACA
CAATCCTCGTCGTGGGTCTCCGCGTCTTGTTCCTCTTCTTGGGCGCAATT
GAACTGATATGATTGGATGCCTCTAACTGGCTGACCGTGCAAATTCTTTG
GCTGCAGACACGAAGCCACTGGACTGCCGCTGGCCTCCTTAAATCGTAGA
AATGCCGACAGCCATCCGAGTTTACAGTTGCAGTTGAGGGGATTATGTAC
GAGATATAAGTAACGCAGTTTTTTGAGCGGATTCAGGGTTTCTTTCTTTA
GAGTTGTGAGCTTATTTTCCGATAAATGTAGTAAATATAGTCTACTAAGA
CCAGCGAATGTATCCTTAGGCAAACACTCTATGTCATTGTTGTGAATATA
TAAAAACATAAGTGACGATAAACCAATAAGAGCATTCTTTCGGATAGACT
TGAGCTTGTTGCCGTTGAGATATAAAGACGTCAGTTGTCGAAGTCCTTCG
AATGCTCCTGGCTCAATGTCAATCATCTCATTACCATTCAGTAATATTTT
TTTCAGATTTTTGTATTTCGACAAAGCGTTCTGTTTCAGAACATTAATAG
CATTGTCATGGAGATCTAATTCTATGATACTTGTCGGTAAATCTTGTGGT
ACACTTTTGATTCCTTTGCCGACACACTTGACGATTCCTTCGGTGGAGCA
GGTGCAGTGTTTTGAGCAAAGTTTCTTTTTCGGTTGGCAAATATTCTCCA
AACTGTTCTTGCTGTCACTTGCACACTGGAATTCATATGAGCTCAGACTC
GATATTGGGATTTGTGACAGTCGAAATGGAGTGGCACAAAGCACAGACTG
CGGATTCGGTTTGATGACTTGAGGCTGATGTTTGATGAATCTGTTGAGCC
ACGCCAAATGACAGTTACAGTTGAGTTTGTTCAAAGATATGTGTAAAGTT
TCGAGGTTCTTTAGTCTCGATATGTCCTCCGATATCCAGAATATCTTATT
ACGATCCAAATATAAATTCTTCAAATTATCGAGCCCGATAAAGACATTCT
CATTGATACATTGTAGCTGATTATCTCTCAGATCTAATTTCTGTAAATTC
TTCAATTTCGAGAATAAACCATCCGGTAGGTATTGAATCAGATTACGATT
CAGGCGCAATTTTGTCAACTGACTCAACGTATCAAATGTTCCCGCTTCTA
TAGTAGTGATTCGGTTATTTGACAGTTGTAAAATCTTAAGATTGACCACT
TTTGAGAAGTCAGTCTTTCTAACGACATTTATTCGATTTCCCAAGAGATT
CAGTTTTACCGTTTTCTCCGGAACTGATTCTGGAACATTTCTCAACAATC
GATGTTTACACTCCATCGAGTAACTGTCACATTGGCAACCATTTGGGCAA
ATATTTGTACTTTCAATCGTGTCATGATACCATGTGCTTGAATATGATTT
GCAAATCGCAAGCAATAACATTATAGAAAACAAAAACCAAATATTGATGT
TTAAAGTTTGCATTATTGAAAACTTGAATGCAAATTACATCGATAAAAAT
CTGCTTTTAATACTAAATTCAGTATGTCGATAATTG

Design Primers for slit

back to top

protein sequence

>Pgr_016847-protein ID=Pgr_016847-protein|Name=slit|organism=Phagocata gracilis|type=polypeptide|length=1530bp
MQTLNINIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSM
ECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNN
RITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQL
QCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCN
CHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASD
SKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELD
LHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLN
GNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSEN
KLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVA
SCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTC
TPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTNPSPLLSLPNLIK
IDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLK
LSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITL
GAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGSSDSEN
SCCSISKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYL
DRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSF
NKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNP
FHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEE
TDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRIN
ACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENG
ASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDY
RCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKL
CDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC
VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPR
GNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG
YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS
GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRA
VNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNG
GVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCL
SLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRI
EFKCDSGRQYFRVVHFVRRCKCLPNCTSK*
back to top

coding sequence

>Pgr_016847.74.4663 ID=Pgr_016847.74.4663|Name=Pgr_016847.74.4663|organism=Phagocata gracilis|type=CDS|length=4590bp
ATGCAAACTTTAAACATCAATATTTGGTTTTTGTTTTCTATAATGTTATT
GCTTGCGATTTGCAAATCATATTCAAGCACATGGTATCATGACACGATTG
AAAGTACAAATATTTGCCCAAATGGTTGCCAATGTGACAGTTACTCGATG
GAGTGTAAACATCGATTGTTGAGAAATGTTCCAGAATCAGTTCCGGAGAA
AACGGTAAAACTGAATCTCTTGGGAAATCGAATAAATGTCGTTAGAAAGA
CTGACTTCTCAAAAGTGGTCAATCTTAAGATTTTACAACTGTCAAATAAC
CGAATCACTACTATAGAAGCGGGAACATTTGATACGTTGAGTCAGTTGAC
AAAATTGCGCCTGAATCGTAATCTGATTCAATACCTACCGGATGGTTTAT
TCTCGAAATTGAAGAATTTACAGAAATTAGATCTGAGAGATAATCAGCTA
CAATGTATCAATGAGAATGTCTTTATCGGGCTCGATAATTTGAAGAATTT
ATATTTGGATCGTAATAAGATATTCTGGATATCGGAGGACATATCGAGAC
TAAAGAACCTCGAAACTTTACACATATCTTTGAACAAACTCAACTGTAAC
TGTCATTTGGCGTGGCTCAACAGATTCATCAAACATCAGCCTCAAGTCAT
CAAACCGAATCCGCAGTCTGTGCTTTGTGCCACTCCATTTCGACTGTCAC
AAATCCCAATATCGAGTCTGAGCTCATATGAATTCCAGTGTGCAAGTGAC
AGCAAGAACAGTTTGGAGAATATTTGCCAACCGAAAAAGAAACTTTGCTC
AAAACACTGCACCTGCTCCACCGAAGGAATCGTCAAGTGTGTCGGCAAAG
GAATCAAAAGTGTACCACAAGATTTACCGACAAGTATCATAGAATTAGAT
CTCCATGACAATGCTATTAATGTTCTGAAACAGAACGCTTTGTCGAAATA
CAAAAATCTGAAAAAAATATTACTGAATGGTAATGAGATGATTGACATTG
AGCCAGGAGCATTCGAAGGACTTCGACAACTGACGTCTTTATATCTCAAC
GGCAACAAGCTCAAGTCTATCCGAAAGAATGCTCTTATTGGTTTATCGTC
ACTTATGTTTTTATATATTCACAACAATGACATAGAGTGTTTGCCTAAGG
ATACATTCGCTGGTCTTAGTAGACTATATTTACTACATTTATCGGAAAAT
AAGCTCACAACTCTAAAGAAAGAAACCCTGAATCCGCTCAAAAAACTGCG
TTACTTATATCTCGTACATAATCCCCTCAACTGCAACTGTAAACTCGGAT
GGCTGTCGGCATTTCTACGATTTAAGGAGGCCAGCGGCAGTCCAGTGGCT
TCGTGTCTGCAGCCAAAGAATTTGCACGGTCAGCCAGTTAGAGGCATCCA
ATCATATCAGTTCAATTGCGCCCAAGAAGAGGAACAAGACGCGGAGACCC
ACGACGAGGATTGTGTGCCGAAGATTAGCTGTCCGAAAAATTGCACATGC
ACACCGGAAGTAGTCGATTGCAATGGGGCCCATTTGTCGATTATGCCCGA
CAATATGCTGCCATCAACGAAAGTTGTGATTTTGTCGTATAATAAACTCC
AAGAAGTCACCAATCCATCTCCTCTTCTCTCTCTACCAAATCTCATCAAA
ATAGACTTGTCATACAATGAAATAGATCACATCGATGCCGACGTTTTCAT
GAAGAATCCAAAGCTCAAGGAAATAAATCTCAACTCCAATCGACTGAAAT
GCGTCAACAATCAGACATTCAGAATGCTTCACGACCTGGAGACATTAAAA
CTCAGCGACAACATGATAGCATGCATCGTGGAGGGCTCCTTCCAAGAGAA
TGGAAACATAAAGCATCTGACTCTGAACAGGAATCCTCTTCACTGTAATT
GCCAATTGAAATGGATGTCAGACTGGGCTCGTACTCACTACATTACACTG
GGAGCCCATACCGCAGTTCTCTGTCAGAGTCCAGCCCTTCTCCAAGGCAC
CCCTCTGTCCAGTCTCGATGAAAAATACTTCCAGTGTCGTGAGAATGTCA
CAAATGAGAATGCGAGCTCTAATTGTCCCGGTAGTTCAGACTCAGAAAAC
TCGTGTTGCTCAATTTCTAAATTAGAGTGTAAGAAAATACTACGATGCCC
GGCCAAATGCCGCTGTGAATCTACGAAGGTTGACTGCAGTTGGATACAAC
TTGAGGATATTCCGTTGGGTATACCAATTAACACCACTGAACTATACCTT
GACAGAAATAATCTCAAGACTCTCAATGAATCATCATTTAAAGAGTTGGA
GAACTTGAAAACACTAGTTCTGAGTTACAATGGAATAACCGAACTTAATA
AGAATGTTTTGACGCCACTTAGAAATCTTGAAACCCTAGTGGTAAGCTTC
AACAAACTGCAATGTATAGATCGAGATGCATTTAAAGGATTAACCAATCT
AAAAGTTCTGATATTGCAAAGCAACGATGTAGCAACAATTCCATTTGGGA
CTTTCCGAGATCTTCGGAACTTAAACAACATAGCATTGGGGCAAAATCCC
TTCCACTGTGACTGCAACATTAAGTGGCTGAATCAATTCTTCATGGAGCG
ATTCCTTGACAACGGCATCTCCTTATGTGCCAGTCCTGAGAATATGAAAC
TGAAATCTATCTACCACTCGAAACCAACAGATTTCTCGTGTACAGAAGAG
ACCGATGACGCTTACATAACCGCCAAGTGTGACGCTTGTATCAGGAGTCC
GTGCAAAAACAATGGAAAATGTTCCCTGGTGACCCATCATCAATATCAGT
GCCAGTGTCCGCATCCGTTCCATGGGAAAAATTGCGAAAAACGTATCAAT
GCTTGTTTCGGGCATCCGTGTAAGAATGGAGGAATTTGTAAAAATGTCGA
CAATTACGGAAATTATGAATGTGTCTGTCCGTTAGGTTTTCGTGGGCCGA
AATGTAATGAGAATATTAACGATTGTGCTGACCACAAGTGCGAGAATGGC
GCTTCATGCGACGATTCGGTTAATGGCTACAATTGTGTCTGTAAGAAGGG
CTTCAGAGGAAAGTTCTGCAATTTGAAGTTTTCCTTCTGCAAGGACATCA
ATCCGTGTAACAACACTGGGATTTGTGAATCACTGCCAGATAATGACTAC
AGATGTGCCTGTAAACCTGGTTGGTTGGGCAAAAATTGCAACCAAAATAT
CGACGACTGCAAATATAATGAGTGCAAAAACAATGCCCACTGTGTGGACT
TGGTCAACGGATACGACTGCAAGTGTCGTCCGGGCTATGTTGGCAAACTG
TGCGATGAACCGGCCTGGAAACCGACCGTTCTCAAGACAAGCATGTCACG
ACGGGACTTGAAGTTGCCGCACTCGGCCAATGTTAATGAGAATGAGGTTA
TCTCAGAGTCGGTGTGTGCTTACCATCAGTGTCTCAATGACGGACTGTGT
GTCAGTGACTTACAAGGAGACCAGAAGTCGTACTGTCGCTGCAAGGCAGG
GTATTCAGGCCAGCAATGTCAACATCTGGACAGTCTCTTCTTTTCGACAG
ACTCGTACATTGAGATATCACCTCCTTCTAGAGGATTCTTGATGCCACGC
GGGAATATTACTTTGAAGTTCTCCACTAATTCATCGTCTGGCCTGCTACT
GTATCAGGGTTTCGATCGCAAGTATCTATCTGTCAATCTCTATCGAGGTC
ACGTGAGAATTGGATACAATATCGGCGACAAGGTCATTGGGCCAGAGGGA
TATTCAATGAATAGTATCAATGACAGTCGCCCACATTCACTCGAGATCGA
GATAATCGGGGAAAATCTCACCATGTACTTGGACGGTCGTTTCCATTGCA
CTTTGAAGTCGAGTTATTCGTCCGGAAACCGTTATCTTGCTCTTAACAGT
GGCATTTTCATTGGCGGGGCTCCGAAACTAATAATGGAGGCTGCCTTGTC
GAAATATCATCTAGAGAGTAACACATATTTCGTCGGTTGTCTACAGTTTC
TTTCTATAAACAATAAGAAGATCGACTTCTTGAAGTACATGACTCGGGCG
GTGAATGTGAAACCGGGCTGTAAAGTTATTGGAACGGAATCAGTGACGAA
GGCAGCCACTGAAGTATTGAAAATTGGTCACATGAGCACAACGACCACCA
TGTCTAATGTCAGTGATGTGTGCAGTGAACCGGAGATGTGTAAGAATGGC
GGGGTGTGTCAGGAACAAAATGATGAGAAAAAGAAATACAAGTGCATTTG
TAAAGATGGTTTCTCCGGGAAATCATGTAACAGAAAAGCATACATGTGCC
GCCGGAAAATGATCAAGAATCACATCAAAGATCCGGACACGACTTGTCTG
TCTTTGAGGAGGGTTCGCTACAGATATTGTGAGGGCTCTTGTGCAGACTC
AAAAATGCAATCCGATATCCAGAAGAGTTTCTTCCATAAACCGGTCGAAA
CCGCATCGTCTCGTTGTTGTCAGCCATATAAATTTCGAACTAGACGTATA
GAATTCAAGTGTGACTCTGGTAGACAATACTTTCGAGTGGTTCACTTCGT
CAGACGTTGCAAATGTCTACCTAATTGTACCAGTAAATAA
back to top
Gene Groups
slit is similar in sequence to the genes of this group: GG9051
Gene NameGene ID
SMU15036778SMU15036778
slitDdo_016416
slitGsp_007744
slitPgr_016847
slitPmo_017648

Gene Group Protein Sequences

>SMU15036778

MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQL
QCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCN
CHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASE
DKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELD
LKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLN
ENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSEN
KLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETNTPVAA
CLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCS
SDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKL
DLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQL
SENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLG
NHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTC
CSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDR
NHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNK
LQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFH
CDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETE
DAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINAC
FGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGAT
CNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKC
VCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCE
IPAWKPTVLKTLISRRDINQSEMTYENLENEVISESVCAYHECLNNGICI
NGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPR
GNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEG
YSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDT
GIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKS
INVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGIC
KNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDS
QGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKY
STHEIQFKCENGRVYRRAANLPKNCKCVANCLND*
>Ddo_016416 slit
DKMQFIFKDITYKSYLILLLSLYCFSSTIWINDPSEEVEICPKGCQCENF
SVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLS
NNRISSIESGAFDNLINLIKLRLNRNLIQHLPDHLFSKLSKLQKLDLREN
QLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLH
CNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA
NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQN
NSITILRQGFLSKYKLLKKIILTQNGMVDIEPGAFIGLQQLTALYLNMNN
LRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLS
ALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCV
GPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSE
IVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDL
SNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLND
NHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSL
RLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL
DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLK
TLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCI
HQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCN
IKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYI
TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQP
CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQ
VNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTK
GWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAW
KPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNED
MNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNIS
LKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMD
VVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFI
GGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVK
PGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNN
GVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDN
CLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTH
KIQFKCDNGRFYRRSVTLPRSCKCQGNCHRI*
>Gsp_007744 slit
MLIIFKDITYKFYLLLLLTLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDGLFSKLSKLQKLDLRDNQL
QCINENTFNKLTMLKYLLLEGNKIFWISESISKLKNLKELRIKKNKLTCN
CHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASE
DKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELD
LSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLN
ANKLKTIRKNAFSGLSSLMFLFLHGNEIECLPADAFEGVKKLHILHLSEN
KLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIAS
CHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCT
SDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKL
DMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQL
SDNEINCIVVDSFKNNLNLKYLMLNRNPFHCNCNMKWMSEWSRNHHSTLG
NHRLPTCQSPSLLKGTPITHLDEKYFLCDGNASIDQSSESCSEISSAEAC
CSIGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDR
NDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNK
LQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFH
CDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETE
DAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINAC
FGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGEC
VDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCV
CSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQ
PAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNG
DQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGN
ISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYS
MGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGI
FIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSIN
VKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKN
QGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLD
SCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYST
HKIQFKCRKGRKYFRDVNLPKNCKCISNCQSD*
>Pgr_016847 slit
MQTLNINIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSM
ECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNN
RITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQL
QCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCN
CHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASD
SKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELD
LHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLN
GNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSEN
KLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVA
SCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTC
TPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTNPSPLLSLPNLIK
IDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLK
LSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITL
GAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGSSDSEN
SCCSISKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYL
DRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSF
NKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNP
FHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEE
TDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRIN
ACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENG
ASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDY
RCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKL
CDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC
VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPR
GNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG
YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS
GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRA
VNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNG
GVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCL
SLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRI
EFKCDSGRQYFRVVHFVRRCKCLPNCTSK*
>Pmo_017648 slit
MCLYFLLYHDTMYSNMIDILRKIIIIMQKINLFFALLLLFFSICQSYSNT
WYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNR
INVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQ
YLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWI
AEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCA
TPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGI
VKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNS
NEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNND
IECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLN
CNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQDE
EAESESHDEDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVI
LSYNKLKEISNSSPLLALPNLIKIDLSYNEIDHIEADIFMKNSRLKEINL
NSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNR
NPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYF
LCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKV
DCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYN
GITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDV
ATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCA
SPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLI
THHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCP
VGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKF
TYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRN
NAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAG
KSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLD
SLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLS
VNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYL
DGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYF
IGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDL
QTVSSTPVSVSDVCSEPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCN
RKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSF
FHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNCT
SK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.