innexin, Pgr_016503 (mRNA) Phagocata gracilis

Overview
Nameinnexin
Unique NamePgr_016503
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2996
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 563.533 bits (1451), Expect = 0
Identity = 288/426 (67.61%), Postives = 345/426 (80.99%), Query Frame = 1
Query:  118 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIIDNN--SDSSTMPM*DQYL* 1389
MVLSEF+ + T YKW +FVGMEDFADKLSF++STS+LLL+T++ITVKSYLLTSIACYIPI PSGKDFDDFLKSYCWVHGTIP+ +LP D +WE++D RINYYQWVPFVLALQGILFYLPRI+WQ++TYNLSG DLEGLVEMANSA NQTG+ K+ TV QIA NLEN+ F HR+IN H++ + K + AK+WLC+ KRSGRQL QYMFIK+LY+IN FGQL LMQ FL FG FGY+VLKNIL GREWNDT IFPRVTYCY+ IQHV ++N+YLAQC LPINMLNEK+YIFLWFWTVIV FT S+ QWI+R+ ++++V FLKKFLR+REQY ED L F GFLRKDGVFI+RM S+NAGDL+T++IVT LW+IYK+K+ +F K D SD+ST+P+ D ++*
Sbjct: 1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP--PDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI* 424

HSP 2 Score: 563.533 bits (1451), Expect = 0
Identity = 288/426 (67.61%), Postives = 345/426 (80.99%), Query Frame = -1
Query: 1608 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIIDNN--SDSSTMPM*DQYL* 2879
MVLSEF+ + T YKW +FVGMEDFADKLSF++STS+LLL+T++ITVKSYLLTSIACYIPI PSGKDFDDFLKSYCWVHGTIP+ +LP D +WE++D RINYYQWVPFVLALQGILFYLPRI+WQ++TYNLSG DLEGLVEMANSA NQTG+ K+ TV QIA NLEN+ F HR+IN H++ + K + AK+WLC+ KRSGRQL QYMFIK+LY+IN FGQL LMQ FL FG FGY+VLKNIL GREWNDT IFPRVTYCY+ IQHV ++N+YLAQC LPINMLNEK+YIFLWFWTVIV FT S+ QWI+R+ ++++V FLKKFLR+REQY ED L F GFLRKDGVFI+RM S+NAGDL+T++IVT LW+IYK+K+ +F K D SD+ST+P+ D ++*
Sbjct: 1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP--PDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI* 424
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 380.948 bits (977), Expect = 4.79566e-121
Identity = 193/416 (46.39%), Postives = 276/416 (66.35%), Query Frame = 1
Query:  118 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHN-RSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYST---RHFGKLEEIIDNNSD 1353
MV EFL+ + +K +VG+EDFADKLSF S +LL+L +++T+KSYL +ACY P G +F+++L++YCWVHGTI P+++ W D +RINYYQWVPF+L LQ I+FY+P+I+WQI+ YN SG +LE +V AN+A N + + +++IA +E+M F HR+ N L K N+ K G LI+ Y+ IK LY +NV GQL +M+KFL F FGY VL N++SG+EW+ T IFPRVTYCYV I+HVG+ N Y+AQCALP+NMLNEK+Y+FLWFW V+V + T S+ W +R+A + F+K+FL + + Y++ D P +N F E FLR DGVF++RML +NAGD++T++IV +L +IYK+ Y R++ + +D + D
Sbjct: 1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGD 416

HSP 2 Score: 380.948 bits (977), Expect = 4.79566e-121
Identity = 193/416 (46.39%), Postives = 276/416 (66.35%), Query Frame = -1
Query: 1644 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHN-RSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYST---RHFGKLEEIIDNNSD 2879
MV EFL+ + +K +VG+EDFADKLSF S +LL+L +++T+KSYL +ACY P G +F+++L++YCWVHGTI P+++ W D +RINYYQWVPF+L LQ I+FY+P+I+WQI+ YN SG +LE +V AN+A N + + +++IA +E+M F HR+ N L K N+ K G LI+ Y+ IK LY +NV GQL +M+KFL F FGY VL N++SG+EW+ T IFPRVTYCYV I+HVG+ N Y+AQCALP+NMLNEK+Y+FLWFW V+V + T S+ W +R+A + F+K+FL + + Y++ D P +N F E FLR DGVF++RML +NAGD++T++IV +L +IYK+ Y R++ + +D + D
Sbjct: 1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGD 416
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 372.859 bits (956), Expect = 2.28417e-118
Identity = 184/402 (45.77%), Postives = 276/402 (68.66%), Query Frame = 1
Query:  124 LSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTH--DHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 1323
+ FLS T ++ +VG+ED ADK SF S +L++ ++I++ K Y+ I+CYIP+ SG D D ++K+YCWVHGTIP A+ P+ ++ W D +++INYYQWVPFVL LQG+LFYLPR++W+ + YNLSG DLEGLV A A NQ GE++ T+ Q+A+ LE++F R + H + ++ + + +C G+R+G I Y+ IK+LYL N Q+ILMQ FL++G + FG+ +LK+ILSG++WND +FPRV++C+++ I V +N ++AQCALPINMLNEK+YIFLWFWTV V T+ S+ W++R+ F+K+FL+++ Y K+ +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y F K
Sbjct: 1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399

HSP 2 Score: 372.859 bits (956), Expect = 2.28417e-118
Identity = 184/402 (45.77%), Postives = 276/402 (68.66%), Query Frame = -1
Query: 1674 LSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTH--DHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 2873
+ FLS T ++ +VG+ED ADK SF S +L++ ++I++ K Y+ I+CYIP+ SG D D ++K+YCWVHGTIP A+ P+ ++ W D +++INYYQWVPFVL LQG+LFYLPR++W+ + YNLSG DLEGLV A A NQ GE++ T+ Q+A+ LE++F R + H + ++ + + +C G+R+G I Y+ IK+LYL N Q+ILMQ FL++G + FG+ +LK+ILSG++WND +FPRV++C+++ I V +N ++AQCALPINMLNEK+YIFLWFWTV V T+ S+ W++R+ F+K+FL+++ Y K+ +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y F K
Sbjct: 1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 361.688 bits (927), Expect = 3.78068e-114
Identity = 178/402 (44.28%), Postives = 272/402 (67.66%), Query Frame = 1
Query:  124 LSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTH--DHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 1323
+ + + + +VG+ED ADK SF S +L++ T+I++ K Y+ IACYIPI +G+ +D++++YCW HGTIP + P++ W + D ++R+NYYQWVPFVL LQG+LFYLPR++W+ + YNLSG DLEGLV A A NQ GE++ T+ Q+A+ LE++F R + H + ++ + + +C G+R+G I Y+ IK+LYL N Q+ILMQ FL++G + FG+ +LK+ILSG++WND +FPRV++C+++ I V +N ++AQCALPINMLNEK+YIFLWFWTV V T+ S+ W++R+ F+K+FL+++ Y K+ +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y F K
Sbjct: 1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399

HSP 2 Score: 361.688 bits (927), Expect = 3.78068e-114
Identity = 178/402 (44.28%), Postives = 272/402 (67.66%), Query Frame = -1
Query: 1674 LSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTH--DHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 2873
+ + + + +VG+ED ADK SF S +L++ T+I++ K Y+ IACYIPI +G+ +D++++YCW HGTIP + P++ W + D ++R+NYYQWVPFVL LQG+LFYLPR++W+ + YNLSG DLEGLV A A NQ GE++ T+ Q+A+ LE++F R + H + ++ + + +C G+R+G I Y+ IK+LYL N Q+ILMQ FL++G + FG+ +LK+ILSG++WND +FPRV++C+++ I V +N ++AQCALPINMLNEK+YIFLWFWTV V T+ S+ W++R+ F+K+FL+++ Y K+ +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y F K
Sbjct: 1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 333.569 bits (854), Expect = 2.26379e-103
Identity = 173/425 (40.71%), Postives = 260/425 (61.18%), Query Frame = 1
Query:  118 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAK-------NWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF---GKLEEIIDNNSDSST 1362
MV EFLS + +K ++ G+EDFAD+L+F S +L L +I+T K+Y ++CY+ PSG +FD ++++YCWVHGTIP + P W D ++RI YYQWVPF+L LQ ILFY+P+++W+I+ YN G +LE L+ A + + + + I +E++ + HR+ K AKA+ N+ K G L+ Y FIK LY INV GQL LM+ FL F + FGY +L +I+SG+ W++T+ FPRV+YCY I+H+G N Y+AQC LP+NMLNEK+YIFLWFW ++V + T+ S++QW+ RI + F KK L++ + YQ+ + ++N F + +LR DG+F+IRM+ +N+GD+V + I+ LW+ YK KY F E++I D +
Sbjct: 1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYR------QGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKS 419

HSP 2 Score: 333.569 bits (854), Expect = 2.26379e-103
Identity = 173/425 (40.71%), Postives = 260/425 (61.18%), Query Frame = -1
Query: 1635 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAK-------NWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF---GKLEEIIDNNSDSST 2879
MV EFLS + +K ++ G+EDFAD+L+F S +L L +I+T K+Y ++CY+ PSG +FD ++++YCWVHGTIP + P W D ++RI YYQWVPF+L LQ ILFY+P+++W+I+ YN G +LE L+ A + + + + I +E++ + HR+ K AKA+ N+ K G L+ Y FIK LY INV GQL LM+ FL F + FGY +L +I+SG+ W++T+ FPRV+YCY I+H+G N Y+AQC LP+NMLNEK+YIFLWFW ++V + T+ S++QW+ RI + F KK L++ + YQ+ + ++N F + +LR DG+F+IRM+ +N+GD+V + I+ LW+ YK KY F E++I D +
Sbjct: 1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYR------QGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKS 419
BLAST of innexin vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 215.312 bits (547), Expect = 3.97535e-60
Identity = 135/409 (33.01%), Postives = 233/409 (56.97%), Query Frame = 1
Query:  115 TMVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEI 1335
+M+L F S V K + F +D DKL++ +T+++ + I+++ K Y+ I C++P + + + + ++YCWV T +P++ +P E N++I YYQWVPFVLAL+ +LFY+P IVW+++++ SG ++ LV+MA + E +N ++ IA N+E ++ NR K N + + SG + Y+ +K+LY +N+ GQ+ L+ FL G ++G VL ++++GREW ++ FPRVT C +++ +G + + QC L INM NEK+++FLWFW ++A T+ S+ WI+ + + ++ F+ K+L E Y+ D SL RF FLR+DGVF++RM++ +AG+L + LW+ Y GK+ ++
Sbjct: 2 SMLLYYFASAV---KSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAER------ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNR------LKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWN----NYCDNKEGKMHDV 386

HSP 2 Score: 215.312 bits (547), Expect = 3.97535e-60
Identity = 135/409 (33.01%), Postives = 233/409 (56.97%), Query Frame = -1
Query: 1662 TMVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEI 2882
+M+L F S V K + F +D DKL++ +T+++ + I+++ K Y+ I C++P + + + + ++YCWV T +P++ +P E N++I YYQWVPFVLAL+ +LFY+P IVW+++++ SG ++ LV+MA + E +N ++ IA N+E ++ NR K N + + SG + Y+ +K+LY +N+ GQ+ L+ FL G ++G VL ++++GREW ++ FPRVT C +++ +G + + QC L INM NEK+++FLWFW ++A T+ S+ WI+ + + ++ F+ K+L E Y+ D SL RF FLR+DGVF++RM++ +AG+L + LW+ Y GK+ ++
Sbjct: 2 SMLLYYFASAV---KSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAER------ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNR------LKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWN----NYCDNKEGKMHDV 386
BLAST of innexin vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 210.305 bits (534), Expect = 5.54913e-57
Identity = 128/375 (34.13%), Postives = 220/375 (58.67%), Query Frame = 1
Query:  181 EDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEEL--DRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLEN-MFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKE---DLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLW 1281
+DF DKL++ +T++L ++++ K Y+ I C++P + + + ++YCWV T +PM +P E+ RN++I YYQWVPF+LA++ +LFY+P I+W+ + Y SG +L+GLV+MA A E+K TV +A ++++ + + + H+RS N G+ G + + Y+ IK+LY NV Q L+ L G++D +G+ +LK+++ EW T +FPRVT C +++ +G + + QC L INM NEK+++FLWFW + + TV + + WI + + + + F++K+LRV + + D +L +F FLRKDGVF++RM+S +AG+L++S ++ LW
Sbjct: 139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIP--------REIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498

HSP 2 Score: 210.305 bits (534), Expect = 5.54913e-57
Identity = 128/375 (34.13%), Postives = 220/375 (58.67%), Query Frame = -1
Query: 1716 EDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEEL--DRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLEN-MFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKE---DLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLW 2816
+DF DKL++ +T++L ++++ K Y+ I C++P + + + ++YCWV T +PM +P E+ RN++I YYQWVPF+LA++ +LFY+P I+W+ + Y SG +L+GLV+MA A E+K TV +A ++++ + + + H+RS N G+ G + + Y+ IK+LY NV Q L+ L G++D +G+ +LK+++ EW T +FPRVT C +++ +G + + QC L INM NEK+++FLWFW + + TV + + WI + + + + F++K+LRV + + D +L +F FLRKDGVF++RM+S +AG+L++S ++ LW
Sbjct: 139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIP--------REIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498
BLAST of innexin vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 183.341 bits (464), Expect = 2.83909e-48
Identity = 126/415 (30.36%), Postives = 226/415 (54.46%), Query Frame = 1
Query:  175 GMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGK----RSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 1341
G +D D+L++ + +L + ++I+ K Y T I C++ S + +++++SYCW+ T IPM ++P D A EE ++I YYQWVPF+L + ++F LP I W++ ++ SG +++ L+ N+AC+ + + ++ E + F + ++ N + +A+ W+ K SG+ + I Y F K+LY +NV Q ++ L+ + +FG+ VL +I +GR W +T FPRVT C +++++ N Y QCAL IN++NEKV+ FLW W +I+A+ T S + WI + + +V ++ KF+++ E + + L L+ F FL+ DG+ ++RM+S +AGD++ +V LW Y+++ + R F + EE+ D
Sbjct: 19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER-NWREFEEHEEMKD 414

HSP 2 Score: 183.341 bits (464), Expect = 2.83909e-48
Identity = 126/415 (30.36%), Postives = 226/415 (54.46%), Query Frame = -1
Query: 1656 GMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGK----RSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 2822
G +D D+L++ + +L + ++I+ K Y T I C++ S + +++++SYCW+ T IPM ++P D A EE ++I YYQWVPF+L + ++F LP I W++ ++ SG +++ L+ N+AC+ + + ++ E + F + ++ N + +A+ W+ K SG+ + I Y F K+LY +NV Q ++ L+ + +FG+ VL +I +GR W +T FPRVT C +++++ N Y QCAL IN++NEKV+ FLW W +I+A+ T S + WI + + +V ++ KF+++ E + + L L+ F FL+ DG+ ++RM+S +AGD++ +V LW Y+++ + R F + EE+ D
Sbjct: 19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER-NWREFEEHEEMKD 414
BLAST of innexin vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 181.03 bits (458), Expect = 2.05832e-47
Identity = 126/415 (30.36%), Postives = 227/415 (54.70%), Query Frame = 1
Query:  175 GMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGK----RSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 1341
G +D D+L++ + +L + ++I+ K Y T I C++ S + +++++SYCW+ T IPM ++P D A EE ++I YYQWVPF+L + ++F LP I W++ ++ SG +++ L+ N+AC+ + + ++ E + F + ++ N + +A+ W+ K SG+ L I + F K+LY +NV Q +++ L+ + +FG+ VL +I +GR W +T FPRVT C +++++ N Y QCAL IN++NEKV+ FLW W +I+A+ T S + WI + + +V ++ KF+++ E + + L L+ F FL+ DGV ++RM+S +AGD++ +V LW ++++ + R F + EE+ D
Sbjct: 35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER-NWREFEEHEEMKD 430

HSP 2 Score: 181.03 bits (458), Expect = 2.05832e-47
Identity = 126/415 (30.36%), Postives = 227/415 (54.70%), Query Frame = -1
Query: 1656 GMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGK----RSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 2822
G +D D+L++ + +L + ++I+ K Y T I C++ S + +++++SYCW+ T IPM ++P D A EE ++I YYQWVPF+L + ++F LP I W++ ++ SG +++ L+ N+AC+ + + ++ E + F + ++ N + +A+ W+ K SG+ L I + F K+LY +NV Q +++ L+ + +FG+ VL +I +GR W +T FPRVT C +++++ N Y QCAL IN++NEKV+ FLW W +I+A+ T S + WI + + +V ++ KF+++ E + + L L+ F FL+ DGV ++RM+S +AGD++ +V LW ++++ + R F + EE+ D
Sbjct: 35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER-NWREFEEHEEMKD 430
BLAST of innexin vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 169.474 bits (428), Expect = 1.14135e-43
Identity = 111/371 (29.92%), Postives = 197/371 (53.10%), Query Frame = 1
Query:  181 EDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYC--YVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLW 1281
+D D+LS+ + +LL +I+++ K Y+ ++I C++P++ G ++ + + YC++ T IP + +P ++ + I YYQWVP VLA+Q +FYLP +W + Y G D ++ A + +Q E + V ++ + + ++ R N + R + GK G + Y+ IK++YL NVF Q I++ KFL G +G+ ++ +GREW D+ +FPRVT C V K+ +V + Y QC L INM NEK+Y+F+WFW V V + T + + I+R++ ++ +++ L K++ + F L++DGV ++R + +AG +VT I +L+
Sbjct: 21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDR------QKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT-RSKNEYGRFYCYRF---------GKGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANV---HRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF 368

HSP 2 Score: 169.474 bits (428), Expect = 1.14135e-43
Identity = 111/371 (29.92%), Postives = 197/371 (53.10%), Query Frame = -1
Query: 1716 EDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYC--YVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLW 2816
+D D+LS+ + +LL +I+++ K Y+ ++I C++P++ G ++ + + YC++ T IP + +P ++ + I YYQWVP VLA+Q +FYLP +W + Y G D ++ A + +Q E + V ++ + + ++ R N + R + GK G + Y+ IK++YL NVF Q I++ KFL G +G+ ++ +GREW D+ +FPRVT C V K+ +V + Y QC L INM NEK+Y+F+WFW V V + T + + I+R++ ++ +++ L K++ + F L++DGV ++R + +AG +VT I +L+
Sbjct: 21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDR------QKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT-RSKNEYGRFYCYRF---------GKGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANV---HRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF 368
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|24643568|ref|NP_728361.1| (shaking B, isoform A [Drosophila melanogaster])

HSP 1 Score: 92.4337 bits (228), Expect = 1.44352e-19
Identity = 84/302 (27.81%), Postives = 131/302 (43.38%), Query Frame = 1
Query:  163 VNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDF-DDFLKSYCWVHGTIPMNA--------SLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 1032
V+ V + +L ++++ +L+ ++IIT + Y+ I C KD +D L +YCW+ T + + S+P+P N+ + + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F F FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 14 VSHVKTDSIVFRLHYSITVMILMSFSLIITTRQYVGNPIDCV-----HTKDIPEDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 275

HSP 2 Score: 92.4337 bits (228), Expect = 1.44352e-19
Identity = 84/302 (27.81%), Postives = 131/302 (43.38%), Query Frame = -1
Query: 1965 VNFVGMEDFADKLSFNVXXXXXXXXXXXXTVKSYLLTSIACYIPIQPSGKDF-DDFLKSYCWVHGTIPMNA--------SLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 2834
V+ V + +L ++++ +L+ ++IIT + Y+ I C KD +D L +YCW+ T + + S+P+P N+ + + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F F FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 14 VSHVKTDSIVFRLHYSITVMILMSFSLIITTRQYVGNPIDCV-----HTKDIPEDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 275
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 89.7373 bits (221), Expect = 9.30933e-19
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 1032
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 50 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264

HSP 2 Score: 89.7373 bits (221), Expect = 9.30933e-19
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = -1
Query: 1965 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 2678
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 50 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 90.1225 bits (222), Expect = 1.0016e-18
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 1032
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280

HSP 2 Score: 90.1225 bits (222), Expect = 1.0016e-18
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = -1
Query: 1965 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 2678
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 90.1225 bits (222), Expect = 1.0016e-18
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 1032
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280

HSP 2 Score: 90.1225 bits (222), Expect = 1.0016e-18
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = -1
Query: 1965 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 2678
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 90.1225 bits (222), Expect = 1.0016e-18
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 1032
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280

HSP 2 Score: 90.1225 bits (222), Expect = 1.0016e-18
Identity = 73/252 (28.97%), Postives = 107/252 (42.46%), Query Frame = -1
Query: 1965 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 2678
+D L +YCW+H T + + +P+P N+ + YYQWV F L Q ILFY PR +W+ + G + L+ + E K + EN+ + NW +Y ++L LINV GQ+ LM +F +F T FG V+ + + +E IFPR+T C K G + A C LP+N++NEK+YIFLWFW
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280
The following BLAST results are available for this feature:
BLAST of innexin vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150009180.000000e+067.61Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150008374.795660e-12146.39Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150036482.284170e-11845.77SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150036493.780680e-11444.28SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150006572.263790e-10340.71Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of innexin vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL3.975350e-6033.01RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL5.549130e-5734.13RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR2.839090e-4830.36RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL2.058320e-4730.36RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|12643734|sp|Q19746|INX3_CAEEL1.141350e-4329.92RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of innexin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24643568|ref|NP_728361.1|1.443520e-1927.81shaking B, isoform A [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|9.309330e-1928.97shaking B, isoform C [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|1.001600e-1828.97shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|1.001600e-1828.97shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|1.001600e-1828.97shaking B, isoform I [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_016503 ID=Pgr_016503|Name=innexin|organism=Phagocata gracilis|type=mRNA|length=2996bp
GGATTTCAGATAATTCGGTGTGTTCTAACGTGAGCGAATAACAATGTCGA
TCAGTGTCACGATTTTATAATTCTAATTAGCGAATTATTGTCGGCAACAT
TTATTAGTCGGAGAACAATGGTACTAAGTGAATTTCTCAGTCACGTTACG
ACCTACAAATGGGTGAACTTCGTCGGCATGGAGGACTTTGCCGACAAGCT
CAGCTTCAATGTTTCGACGTCACTGTTACTATTAATAACCATCATTATAA
CAGTGAAAAGTTACCTACTGACGTCGATAGCCTGTTACATTCCCATACAG
CCATCAGGTAAAGATTTCGATGACTTTCTGAAGAGCTATTGTTGGGTGCA
CGGAACCATTCCAATGAATGCATCGTTACCGTGGCCAAAAGACGAAAATG
CTTGGGAAGAACTGGATAGAAATCAAAGAATAAATTATTATCAATGGGTG
CCATTCGTTCTGGCTCTACAGGGGATTTTGTTCTACTTGCCACGAATTGT
CTGGCAAATAATGACCTACAATCTGTCTGGCGCAGATCTCGAGGGTCTGG
TCGAGATGGCCAACTCTGCCTGCAATCAAACCGGAGAAGTCAAGAATAAC
ACAGTCAAACAAATTGCCGAAAATCTTGAAAATATGTTCTTCTGTCACAG
GGAAATAAATTTCCACAATAGAAGTTTGGCAATAAAAGCTGCCAAGGCCA
AGAATTGGCTTTGTGCCGGAAAACGAAGCGGTCGACAGTTGATAATACAG
TACATGTTCATTAAGATGCTCTACCTGATCAATGTGTTCGGCCAATTGAT
TTTGATGCAGAAGTTCTTGCAGTTCGGCACTCACGACCATTACTTCGGAT
ATATAGTGCTAAAGAATATCCTGAGCGGCCGCGAATGGAATGACACTCAG
ATTTTCCCGAGGGTCACGTACTGTTACGTCAATAAAATCCAACATGTCGG
CATGCAGAACGATTATCTGGCCCAGTGTGCTCTGCCAATTAATATGCTCA
ACGAGAAGGTGTACATCTTTCTTTGGTTCTGGACTGTGATAGTCGCGGTG
TTCACTGTCACCAGTGTTGTGCAATGGATCTTCCGGATTGCGTTGACAAA
CAATGAAGTGGGCTTCTTGAAGAAATTCTTACGGGTTCGAGAACAGTACC
AAAAAGAGGATTTGCCGAGTTTAAATCGCTTCTGTGAGGGATTTCTACGC
AAAGATGGAGTCTTCATAATACGGATGTTGTCGATGAATGCCGGCGACTT
GGTGACGAGTAACATTGTGACGAAATTGTGGGACATTTATAAGAAAAAAT
ATTCGACCAGGCATTTCGGGAAATTGGAGGAAATCATTGACAATAATAGC
GACAGCTCCACTATGCCGATGTAGGATCAATACCTGTGAACCTTGGATAT
TGGATATGATCGAGTAACTTATGATAGAGACACGGTGAGATAGACCATAC
AATTATGTATATTTATCGATTATATCCTCCATTTATTCTCAATACCAGCT
GGTATTGAGAATAAATGGAGGATATAATCGATAAATATACATAATTGTAT
GGTCTATCTCACCGTGTCTCTATCATAAGTTACTCGATCATATCCAATAT
CCAAGGTTCACAGGTATTGATCCTACATCGGCATAGTGGAGCTGTCGCTA
TTATTGTCAATGATTTCCTCCAATTTCCCGAAATGCCTGGTCGAATATTT
TTTCTTATAAATGTCCCACAATTTCGTCACAATGTTACTCGTCACCAAGT
CGCCGGCATTCATCGACAACATCCGTATTATGAAGACTCCATCTTTGCGT
AGAAATCCCTCACAGAAGCGATTTAAACTCGGCAAATCCTCTTTTTGGTA
CTGTTCTCGAACCCGTAAGAATTTCTTCAAGAAGCCCACTTCATTGTTTG
TCAACGCAATCCGGAAGATCCATTGCACAACACTGGTGACAGTGAACACC
GCGACTATCACAGTCCAGAACCAAAGAAAGATGTACACCTTCTCGTTGAG
CATATTAATTGGCAGAGCACACTGGGCCAGATAATCGTTCTGCATGCCGA
CATGTTGGATTTTATTGACGTAACAGTACGTGACCCTCGGGAAAATCTGA
GTGTCATTCCATTCGCGGCCGCTCAGGATATTCTTTAGCACTATATATCC
GAAGTAATGGTCGTGAGTGCCGAACTGCAAGAACTTCTGCATCAAAATCA
ATTGGCCGAACACATTGATCAGGTAGAGCATCTTAATGAACATGTACTGT
ATTATCAACTGTCGACCGCTTCGTTTTCCGGCACAAAGCCAATTCTTGGC
CTTGGCAGCTTTTATTGCCAAACTTCTATTGTGGAAATTTATTTCCCTGT
GACAGAAGAACATATTTTCAAGATTTTCGGCAATTTGTTTGACTGTGTTA
TTCTTGACTTCTCCGGTTTGATTGCAGGCAGAGTTGGCCATCTCGACCAG
ACCCTCGAGATCTGCGCCAGACAGATTGTAGGTCATTATTTGCCAGACAA
TTCGTGGCAAGTAGAACAAAATCCCCTGTAGAGCCAGAACGAATGGCACC
CATTGATAATAATTTATTCTTTGATTTCTATCCAGTTCTTCCCAAGCATT
TTCGTCTTTTGGCCACGGTAACGATGCATTCATTGGAATGGTTCCGTGCA
CCCAACAATAGCTCTTCAGAAAGTCATCGAAATCTTTACCTGATGGCTGT
ATGGGAATGTAACAGGCTATCGACGTCAGTAGGTAACTTTTCACTGTTAT
AATGATGGTTATTAATAGTAACAGTGACGTCGAAACATTGAAGCTGAGCT
TGTCGGCAAAGTCCTCCATGCCGACGAAGTTCACCCATTTGTAGGTCGTA
ACGTGACTGAGAAATTCACTTAGTACCATTGTTCTCCGACTAATAAATGT
TGCCGACAATAATTCGCTAATTAGAATTATAAAATCGTGACACTGATCGA
CATTGTTATTCGCTCACGTTAGAACACACCGAATTATCTGAAATCC

Design Primers for innexin

back to top

protein sequence

>Pgr_016503-protein ID=Pgr_016503-protein|Name=innexin|organism=Phagocata gracilis|type=polypeptide|length=419bp
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
back to top

coding sequence

>Pgr_016503.118.1374 ID=Pgr_016503.118.1374|Name=Pgr_016503.118.1374|organism=Phagocata gracilis|type=CDS|length=1257bp
ATGGTACTAAGTGAATTTCTCAGTCACGTTACGACCTACAAATGGGTGAA
CTTCGTCGGCATGGAGGACTTTGCCGACAAGCTCAGCTTCAATGTTTCGA
CGTCACTGTTACTATTAATAACCATCATTATAACAGTGAAAAGTTACCTA
CTGACGTCGATAGCCTGTTACATTCCCATACAGCCATCAGGTAAAGATTT
CGATGACTTTCTGAAGAGCTATTGTTGGGTGCACGGAACCATTCCAATGA
ATGCATCGTTACCGTGGCCAAAAGACGAAAATGCTTGGGAAGAACTGGAT
AGAAATCAAAGAATAAATTATTATCAATGGGTGCCATTCGTTCTGGCTCT
ACAGGGGATTTTGTTCTACTTGCCACGAATTGTCTGGCAAATAATGACCT
ACAATCTGTCTGGCGCAGATCTCGAGGGTCTGGTCGAGATGGCCAACTCT
GCCTGCAATCAAACCGGAGAAGTCAAGAATAACACAGTCAAACAAATTGC
CGAAAATCTTGAAAATATGTTCTTCTGTCACAGGGAAATAAATTTCCACA
ATAGAAGTTTGGCAATAAAAGCTGCCAAGGCCAAGAATTGGCTTTGTGCC
GGAAAACGAAGCGGTCGACAGTTGATAATACAGTACATGTTCATTAAGAT
GCTCTACCTGATCAATGTGTTCGGCCAATTGATTTTGATGCAGAAGTTCT
TGCAGTTCGGCACTCACGACCATTACTTCGGATATATAGTGCTAAAGAAT
ATCCTGAGCGGCCGCGAATGGAATGACACTCAGATTTTCCCGAGGGTCAC
GTACTGTTACGTCAATAAAATCCAACATGTCGGCATGCAGAACGATTATC
TGGCCCAGTGTGCTCTGCCAATTAATATGCTCAACGAGAAGGTGTACATC
TTTCTTTGGTTCTGGACTGTGATAGTCGCGGTGTTCACTGTCACCAGTGT
TGTGCAATGGATCTTCCGGATTGCGTTGACAAACAATGAAGTGGGCTTCT
TGAAGAAATTCTTACGGGTTCGAGAACAGTACCAAAAAGAGGATTTGCCG
AGTTTAAATCGCTTCTGTGAGGGATTTCTACGCAAAGATGGAGTCTTCAT
AATACGGATGTTGTCGATGAATGCCGGCGACTTGGTGACGAGTAACATTG
TGACGAAATTGTGGGACATTTATAAGAAAAAATATTCGACCAGGCATTTC
GGGAAATTGGAGGAAATCATTGACAATAATAGCGACAGCTCCACTATGCC
GATGTAG
back to top
Gene Groups
innexin is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.