sfrp-1, Pgr_015361 (mRNA) Phagocata gracilis

Overview
Namesfrp-1
Unique NamePgr_015361
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1058
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|188528609|ref|NP_003006.2| (secreted frizzled-related protein 5 precursor [Homo sapiens])

HSP 1 Score: 138.272 bits (347), Expect = 1.73966e-36
Identity = 88/257 (34.24%), Postives = 132/257 (51.36%), Query Frame = 1
Query:   85 QCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI-------PSTVSKGKK-CRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILL-------QCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVL 810
QC IP +L LC VGYKRM LPN ++HE L E Q + W+ L+ CH D + FLCSL+APVC++ + + PC+ LC +V+ C P M+ +GF WP ++ C FP + N LCI P+T K C C S + + + C S+ V++ +IK I E N K+ QK L R K L+ C C +L +L G +L+M VD Q ++ + +W +KN ++++ +
Sbjct: 52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIE-NGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLD----SLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFM 298
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|48475052|ref|NP_003004.1| (secreted frizzled-related protein 2 precursor [Homo sapiens])

HSP 1 Score: 132.494 bits (332), Expect = 1.42479e-34
Identity = 86/292 (29.45%), Postives = 131/292 (44.86%), Query Frame = 1
Query:   10 FFIFYLHISCFLGD------WQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI---------PSTVSKGKKCRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFL-----KFQSDFTRNS--LKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVLRKF 819
+ +L C LG + Q Y C IP NL LC + Y+ M LPN + HE + E ++ + WI LV CH D +KFLCSL+APVC++++ + + PC LCV VK+ C P M FGF WP++++C FP N LCI P+T K C C + + + N + + N KI L K+ + + D ++ LK LQC C E + +L+M + V+ + +W++ F+ +RK
Sbjct: 8 LLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|56117838|ref|NP_003003.3| (secreted frizzled-related protein 1 precursor [Homo sapiens])

HSP 1 Score: 132.109 bits (331), Expect = 3.20207e-34
Identity = 93/284 (32.75%), Postives = 139/284 (48.94%), Query Frame = 1
Query:   22 YLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI---PSTVSKGKK------CRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKT----GFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVLRKFGNELC 834
Y+ +G +Q + QC IP +L LC NVGYK+M+LPN ++HE + E Q + W+ L+N +CH + FLCSL+APVC++ + + PC+ LC +V+++C P M+ FGF WP ++KC FP +CI P ++ K C PC E + C S +R KIK + KE + + +K K LK C C +L L +LIM V +Q ++ I KW +KN F+ N ++K N C
Sbjct: 36 YVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP--EGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLD----NLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFK---NFMKKMKNHEC 306
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 88.1965 bits (217), Expect = 2.43326e-18
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 1
Query:   73 YSTEQCFKIPDN-------LTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP-SVRNSLCIPSTVSKGKKCRP 471
Y+ E+ +PD+ + LC ++ Y + I+PN + H ++A + LV C +++ FLCS+YAPVC + Q +PPC+ LC ++ C M FGF+WP+ +KC FP LC+ S P
Sbjct: 102 YNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC--TVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP 240
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503833|ref|NP_003498.1| (frizzled-7 precursor [Homo sapiens])

HSP 1 Score: 86.2705 bits (212), Expect = 9.92255e-18
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query:   73 YSTEQCFKIPDN-------LTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
Y E+ +PD+ + LC ++ Y + ILPN + H ++A + LV C ++R FLCS+YAPVC + Q +PPC+ LC ++ C M FGF+WP ++C FP
Sbjct: 35 YHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC--TVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP 152
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001274 (Asxlregen_comp63361_c0_seq1|m.13574|m.6037)

HSP 1 Score: 377.867 bits (969), Expect = 3.1192e-129
Identity = 184/302 (60.93%), Postives = 243/302 (80.46%), Query Frame = 1
Query:   10 FFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVSKGKKCRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNI-VDNQPVVNFITKWKRKNTNFRYSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYAKMNN 912
+F +++ F+GDWQ FQ+GY+ +QC++IPDN TLC NVGY+ M+LPNYIQHE ++EA QHSKVW+GLVN+ CH DI+KF+CSLYAPVCI+N R QKVPPC+ELCV+VKE+CLPSMK++GF+WP IMKCS FP +NSLCIP TV GKKC C+K +SYEV+AN+FCLS IVIRAKIKRI+ N +I L +K+ FLKFQ++F++N+L++ L+CNCT LKF++RALKG+W+IM I DN+ VVNFI+KWKRK F++S+ +++ FG+ +C+ LP DG S+ +RY AY KMNN
Sbjct: 11 LLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLP---DG-ISLRERYAAYLKMNN 308
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15040524 (dd_smedV4_8832_0_1|m.39951|m.18186)

HSP 1 Score: 164.851 bits (416), Expect = 5.49017e-47
Identity = 105/273 (38.46%), Postives = 153/273 (56.04%), Query Frame = 1
Query:   49 DWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI-----------PSTVSKGKKCRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVLRKFGNELC 834
+W GYS+ +C +IP+ LC N+GY +MILPN++QHE + EA+ S W + CH D R+FLCSLYAPVC+ N ++K+ PCKELC+SVK+AC P+M FG++WP I+ C FP LCI S V KG CR S + + +C S VIRAKI R+ N+ + + L +K+ +K I + C C + + KG+WL+M + D + + +TKWK+KN +F+ I L+KF ++C
Sbjct: 27 EWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLY---SAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDN-IRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKIC 295
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15030883 (SmedSxlregen_c55322_g1_i1|m.6956|m.30359)

HSP 1 Score: 140.198 bits (352), Expect = 1.64558e-37
Identity = 102/313 (32.59%), Postives = 147/313 (46.96%), Query Frame = 1
Query:   40 FLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGY--KRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVSKG-------------------------------KKCRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILL---QCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVLRKFGNELCR-----LNLPNN 855
F D++ N QC+ N TLC G +++ ++ S +WI L+++ CH D+ KFLC++YAP+C+ R +V PC+ELC SVKE CLP +K++GFEWP+I+ C FP + CI T G K C C + E++ FC ++VIRAKI I ++ I L K+ + S R SL L+ QC C+ L+ K KGKWL+ +I + Q +V F+TKW+RK FR L K C+ LN+ NN
Sbjct: 17 FSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNII-HSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNN 328
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001054 (Asxlregen_comp62015_c0_seq1|m.11130|m.22104)

HSP 1 Score: 92.4337 bits (228), Expect = 1.90372e-20
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 1
Query:   97 IPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
IP +++C +GY +PN + H L+EA + + LV +C ED+R FLCS+YAP+C+ N ++P C+ LC+S +E C M +GF+WP M C P
Sbjct: 36 IPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWP-NRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP 139
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15005581 (SmedAsxldir_c106676_g1_i1|m.77561|m.15397)

HSP 1 Score: 91.2781 bits (225), Expect = 5.11145e-20
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 1
Query:    1 LFLFFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI 435
L +F+ + F+ + + + Y+ C KI + C + Y+ I PN++ H DEA ++ L+ CH ++ FLCSLY PVC + + +PPC+ LC+ +K+ C P +K F F+WP M C L+P N+LCI
Sbjct: 10 LIKYFLIVSFVFLFINNIRAVNDPYNQPNCEKI--KVPACQGLLYQMTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVC--TIMKKALPPCRSLCLQIKKECEPILKKFYFKWPQSMSCDLYP--ENNLCI 148
BLAST of sfrp-1 vs. uniprot
Match: gi|61216861|sp|Q9XSC1|SFRP5_BOVIN (RecName: Full=Secreted frizzled-related protein 5; Short=sFRP-5; Flags: Precursor)

HSP 1 Score: 142.895 bits (359), Expect = 1.08455e-37
Identity = 85/256 (33.20%), Postives = 135/256 (52.73%), Query Frame = 1
Query:   85 QCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI-------PSTVSKGKK-CRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILLQ------CNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVL 810
QC IP +L LC VGYKRM LPN ++HE L E Q + W+ L+ CH D + FLCSL+APVC++ + + PC+ LC +V+ C P M+ +GF WP ++ C FP + N LCI P+T K C C S + + + C S+ V++ +IK I E + I +K LK +++ +++L C C +L +L G +L+M VD Q ++ + +W +KN ++++ +
Sbjct: 50 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKRLVLHMKNSAGCPCPQLD----SLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFM 296
BLAST of sfrp-1 vs. uniprot
Match: gi|150421670|sp|Q5T4F7|SFRP5_HUMAN (RecName: Full=Secreted frizzled-related protein 5; Short=sFRP-5; AltName: Full=Frizzled-related protein 1b; Short=FRP-1b; AltName: Full=Secreted apoptosis-related protein 3; Short=SARP-3; Flags: Precursor)

HSP 1 Score: 138.272 bits (347), Expect = 4.60949e-36
Identity = 88/257 (34.24%), Postives = 132/257 (51.36%), Query Frame = 1
Query:   85 QCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI-------PSTVSKGKK-CRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILL-------QCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVL 810
QC IP +L LC VGYKRM LPN ++HE L E Q + W+ L+ CH D + FLCSL+APVC++ + + PC+ LC +V+ C P M+ +GF WP ++ C FP + N LCI P+T K C C S + + + C S+ V++ +IK I E N K+ QK L R K L+ C C +L +L G +L+M VD Q ++ + +W +KN ++++ +
Sbjct: 52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIE-NGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLD----SLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFM 298
BLAST of sfrp-1 vs. uniprot
Match: gi|341942099|sp|Q8C4U3|SFRP1_MOUSE (RecName: Full=Secreted frizzled-related protein 1; Short=sFRP-1; Flags: Precursor)

HSP 1 Score: 136.346 bits (342), Expect = 2.68855e-35
Identity = 96/295 (32.54%), Postives = 142/295 (48.14%), Query Frame = 1
Query:   22 YLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI----PSTVSKGKK-----CRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGF---------------KIELGQKTGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVLRKFGNELC 834
Y+ +G +Q + QC IP +L LC NVGYK+M+LPN ++HE + E Q + W+ L+N +CH + FLCSL+APVC++ + + PC+ LC +V+++C P M+ FGF WP ++KC FP +CI P+T K C PC E + C S +R KIK + KE + K EL + FLK +D C C +L L +LIM V +Q ++ I KW +KN F+ N +++ N C
Sbjct: 36 YVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP--EGDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGAD-----------CPCHQLD----NLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFK---NFMKRMKNHEC 306
BLAST of sfrp-1 vs. uniprot
Match: gi|61216860|sp|Q9WU66|SFRP5_MOUSE (RecName: Full=Secreted frizzled-related protein 5; Short=sFRP-5; Flags: Precursor)

HSP 1 Score: 134.806 bits (338), Expect = 9.87721e-35
Identity = 85/257 (33.07%), Postives = 130/257 (50.58%), Query Frame = 1
Query:   85 QCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI-------PSTVSKGKK-CRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFLKFQSDFTRNSLKILL-------QCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVL 810
QC IP +L LC VGYKRM LPN ++HE L E Q + W+ L+ CH D + FLCSL+APVC++ + + PC+ LC + + C P M+ +GF WP ++ C FP + N LCI P+T K C C S + + + C S+ V++ +IK I + N K+ QK L R K L+ C C +L L G +L+M V+ Q ++ + +W +KN ++++ +
Sbjct: 49 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKID-NGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLD----NLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFM 295
BLAST of sfrp-1 vs. uniprot
Match: gi|61216791|sp|Q863H1|SFRP2_CANFA (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; Flags: Precursor [Canis lupus familiaris])

HSP 1 Score: 132.88 bits (333), Expect = 2.79072e-34
Identity = 86/291 (29.55%), Postives = 131/291 (45.02%), Query Frame = 1
Query:   10 FFIFYLHISCFLGDWQ-----QFQNGYSTEQCFKIPDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCI---------PSTVSKGKKCRPCVKSSSYEVMANKFCLSNXXXXXXXXXXXXEGNNGFKIELGQKTGFL-----KFQSDFTRNS--LKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVVNFITKWKRKNTNFRYSINVLRKF 819
+ L C LG + Q Y C IP NL LC + Y+ M LPN + HE + E ++ + WI LV CH D +KFLCSL+APVC++++ + + PC LCV VK+ C P M FGF WP++++C FP N LCI P+T K C C + + + N + + N KI L K+ + + D ++ LK LQC C E + +L+M + + V+ + +W++ F+ +RK
Sbjct: 8 LLLLVLASHCCLGSARGLFFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKLGGELVITSVKRWQKGQREFKRISRSIRKL 292
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 77.7962 bits (190), Expect = 2.53437e-15
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  100 PDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
P +++C N+ Y I+PN I H +EA + LV C +D++ FLCSLY PVC + + +PPC+ LC S + C MK + F WP ++CS FP
Sbjct: 55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC--TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFP 155
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 77.411 bits (189), Expect = 3.00578e-15
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  100 PDNLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
P +++C N+ Y I+PN I H +EA + LV C +D++ FLCSLY PVC + + +PPC+ LC S + C MK + F WP ++CS FP
Sbjct: 55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC--TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFP 155
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 77.411 bits (189), Expect = 3.61035e-15
Identity = 34/102 (33.33%), Postives = 52/102 (50.98%), Query Frame = 1
Query:  106 NLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
+ +C +GY PN + HE DEA + LV C D++ FLCS+Y P+C+ + + +P C+ +C + C P M+ + FEWP M C P
Sbjct: 68 TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP 168
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 77.411 bits (189), Expect = 3.61035e-15
Identity = 34/102 (33.33%), Postives = 52/102 (50.98%), Query Frame = 1
Query:  106 NLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
+ +C +GY PN + HE DEA + LV C D++ FLCS+Y P+C+ + + +P C+ +C + C P M+ + FEWP M C P
Sbjct: 68 TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP 168
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 77.411 bits (189), Expect = 3.61035e-15
Identity = 34/102 (33.33%), Postives = 52/102 (50.98%), Query Frame = 1
Query:  106 NLTLCLNVGYKRMILPNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQKVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFP 411
+ +C +GY PN + HE DEA + LV C D++ FLCS+Y P+C+ + + +P C+ +C + C P M+ + FEWP M C P
Sbjct: 68 TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP 168
The following BLAST results are available for this feature:
BLAST of sfrp-1 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|188528609|ref|NP_003006.2|1.739660e-3634.24secreted frizzled-related protein 5 precursor [Hom... [more]
gi|48475052|ref|NP_003004.1|1.424790e-3429.45secreted frizzled-related protein 2 precursor [Hom... [more]
gi|56117838|ref|NP_003003.3|3.202070e-3432.75secreted frizzled-related protein 1 precursor [Hom... [more]
gi|4503825|ref|NP_003496.1|2.433260e-1831.91frizzled-1 [Homo sapiens][more]
gi|4503833|ref|NP_003498.1|9.922550e-1835.00frizzled-7 precursor [Homo sapiens][more]
back to top
BLAST of sfrp-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150012743.119200e-12960.93Asxlregen_comp63361_c0_seq1|m.13574|m.6037[more]
SMU150405245.490170e-4738.46dd_smedV4_8832_0_1|m.39951|m.18186[more]
SMU150308831.645580e-3732.59SmedSxlregen_c55322_g1_i1|m.6956|m.30359[more]
SMU150010541.903720e-2039.05Asxlregen_comp62015_c0_seq1|m.11130|m.22104[more]
SMU150055815.111450e-2033.79SmedAsxldir_c106676_g1_i1|m.77561|m.15397[more]
back to top
BLAST of sfrp-1 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|61216861|sp|Q9XSC1|SFRP5_BOVIN1.084550e-3733.20RecName: Full=Secreted frizzled-related protein 5;... [more]
gi|150421670|sp|Q5T4F7|SFRP5_HUMAN4.609490e-3634.24RecName: Full=Secreted frizzled-related protein 5;... [more]
gi|341942099|sp|Q8C4U3|SFRP1_MOUSE2.688550e-3532.54RecName: Full=Secreted frizzled-related protein 1;... [more]
gi|61216860|sp|Q9WU66|SFRP5_MOUSE9.877210e-3533.07RecName: Full=Secreted frizzled-related protein 5;... [more]
gi|61216791|sp|Q863H1|SFRP2_CANFA2.790720e-3429.55RecName: Full=Secreted frizzled-related protein 2;... [more]
back to top
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|442632294|ref|NP_001261836.1|2.534370e-1538.46frizzled, isoform C [Drosophila melanogaster][more]
gi|17864440|ref|NP_524812.1|3.005780e-1538.46frizzled, isoform A [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|3.610350e-1533.33frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|3.610350e-1533.33frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|3.610350e-1533.33frizzled 2, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_015361 ID=Pgr_015361|Name=sfrp-1|organism=Phagocata gracilis|type=mRNA|length=1058bp
CTTTTTTTGTTTTTCATATTTTACTTGCATATCTCTTGCTTCCTTGGCGA
TTGGCAGCAATTTCAAAATGGATATTCAACTGAACAATGTTTTAAGATTC
CAGATAATTTGACACTATGTCTAAATGTTGGTTACAAGAGGATGATTTTG
CCTAATTATATTCAACATGAATACCTGGATGAAGCCGTTCAGCATTCAAA
GGTGTGGATTGGTTTAGTAAATTCCCATTGCCATGAAGACATAAGGAAAT
TTCTATGTTCTTTATACGCCCCTGTCTGCATCAATAATATGAGAATTCAG
AAAGTACCCCCATGTAAAGAACTGTGTGTAAGTGTGAAAGAAGCATGTTT
ACCTAGTATGAAATTATTTGGATTTGAATGGCCAAATATAATGAAATGTT
CTTTATTCCCAAGTGTAAGAAATTCGCTTTGTATCCCAAGTACTGTTAGT
AAAGGAAAAAAGTGTCGTCCGTGCGTCAAATCCTCATCATATGAAGTTAT
GGCTAACAAATTTTGTCTATCAAATATAGTAATTCGAGCCAAAATTAAAC
GTATTGTAAAAGAAGGAAATAATGGATTTAAAATTGAATTAGGCCAGAAA
ACTGGTTTTTTAAAGTTTCAATCAGATTTTACAAGAAATTCTTTAAAAAT
ATTGCTTCAATGTAATTGTACTAGATTGAAATTTGAAAAAAGAGCACTGA
AGGGAAAATGGTTAATAATGGTGAATATAGTCGATAATCAACCTGTCGTT
AATTTTATTACAAAATGGAAAAGAAAGAATACTAACTTTAGATATAGCAT
CAATGTCTTACGAAAATTTGGAAATGAATTATGTCGACTAAATCTTCCAA
ATAATTCTGATGGTAGAACAAGTATGCTCAAAAGATATTTAGCCTATGCT
AAAATGAATAATATTACTCAATTTAAAAACCGAAAAAATCGTAACAATAA
TTCTAAGGAAAACAAAAAACCAAAAAAATCTTGGACTACTCAAAAAAAGA
ATGCTTACAAAAACTGAACGTATACTTTGATTAGATTCAATAATATTGTC
ATCGATCA

Design Primers for sfrp-1

back to top

protein sequence

>Pgr_015361-protein ID=Pgr_015361-protein|Name=sfrp-1|organism=Phagocata gracilis|type=polypeptide|length=339bp
LFLFFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMIL
PNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQ
KVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVS
KGKKCRPCVKSSSYEVMANKFCLSNIVIRAKIKRIVKEGNNGFKIELGQK
TGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVV
NFITKWKRKNTNFRYSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYA
KMNNITQFKNRKNRNNNSKENKKPKKSWTTQKKNAYKN*
back to top

coding sequence

>Pgr_015361.1.1017 ID=Pgr_015361.1.1017|Name=Pgr_015361.1.1017|organism=Phagocata gracilis|type=CDS|length=1017bp
CTTTTTTTGTTTTTCATATTTTACTTGCATATCTCTTGCTTCCTTGGCGA
TTGGCAGCAATTTCAAAATGGATATTCAACTGAACAATGTTTTAAGATTC
CAGATAATTTGACACTATGTCTAAATGTTGGTTACAAGAGGATGATTTTG
CCTAATTATATTCAACATGAATACCTGGATGAAGCCGTTCAGCATTCAAA
GGTGTGGATTGGTTTAGTAAATTCCCATTGCCATGAAGACATAAGGAAAT
TTCTATGTTCTTTATACGCCCCTGTCTGCATCAATAATATGAGAATTCAG
AAAGTACCCCCATGTAAAGAACTGTGTGTAAGTGTGAAAGAAGCATGTTT
ACCTAGTATGAAATTATTTGGATTTGAATGGCCAAATATAATGAAATGTT
CTTTATTCCCAAGTGTAAGAAATTCGCTTTGTATCCCAAGTACTGTTAGT
AAAGGAAAAAAGTGTCGTCCGTGCGTCAAATCCTCATCATATGAAGTTAT
GGCTAACAAATTTTGTCTATCAAATATAGTAATTCGAGCCAAAATTAAAC
GTATTGTAAAAGAAGGAAATAATGGATTTAAAATTGAATTAGGCCAGAAA
ACTGGTTTTTTAAAGTTTCAATCAGATTTTACAAGAAATTCTTTAAAAAT
ATTGCTTCAATGTAATTGTACTAGATTGAAATTTGAAAAAAGAGCACTGA
AGGGAAAATGGTTAATAATGGTGAATATAGTCGATAATCAACCTGTCGTT
AATTTTATTACAAAATGGAAAAGAAAGAATACTAACTTTAGATATAGCAT
CAATGTCTTACGAAAATTTGGAAATGAATTATGTCGACTAAATCTTCCAA
ATAATTCTGATGGTAGAACAAGTATGCTCAAAAGATATTTAGCCTATGCT
AAAATGAATAATATTACTCAATTTAAAAACCGAAAAAATCGTAACAATAA
TTCTAAGGAAAACAAAAAACCAAAAAAATCTTGGACTACTCAAAAAAAGA
ATGCTTACAAAAACTGA
back to top
Gene Groups
sfrp-1 is similar in sequence to the genes of this group: GG7656
Gene NameGene ID
SMU15001274SMU15001274
sfrp-1Ddo_009225
sfrp-1Gsp_013592
sfrp-1Pgr_015361
sfrp-1Pmo_009874

Gene Group Protein Sequences

>SMU15001274

MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNV
GYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVC
ISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSL
CIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAI
QIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQI
DSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERY
AAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS*
>Ddo_009225 sfrp-1
LIAFSNDIGIRGMITILPLGLLLSLFSNGNCFIGDWESFRSGYTTDQCYK
VPENFSMCHNVGYNKMVLPNFIQHEYMEEAIAHSRVWLSLVKSQCHLDVR
KFLCSLYAPVCITNKRIQKVPPCRELCIIVKEACLPSMKMYGFNWPEIMK
CSKFPPVQNALCIPKTTVKKKNCELCVKNAPYEVIANRFCLSPIVIRAKI
KRIIPKESGFQIVLHQKSKFLKFQSNSSRDSVNLWLKCNCLNLKFQQRAL
RGRWIIMARIVEDRFVVNFISKWKKKKEEFKNSIRIIQKFGNVVCKSKLK
DGISLQERYVAYMKMNNKTNYQNQLKQQTRKFKKRKQNQQRRIP*
>Gsp_013592 sfrp-1
MVIIFRFTFILFVFNVNCFIGDWQSFQSGYTIDQCYHIPDNFSLCRNVGY
NRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCIS
SQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI
PRTLVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQI
VLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQ
NEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAY
LKMNNKIKYSNNNNKSKQQTRRSKKPINTRSSSIS*
>Pgr_015361 sfrp-1
LFLFFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMIL
PNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQ
KVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVS
KGKKCRPCVKSSSYEVMANKFCLSNIVIRAKIKRIVKEGNNGFKIELGQK
TGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVV
NFITKWKRKNTNFRYSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYA
KMNNITQFKNRKNRNNNSKENKKPKKSWTTQKKNAYKN*
>Pmo_009874 sfrp-1
MCILSLFFFNIFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY
KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIY
NMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI
PSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYII
DLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVK
GQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKR
YLAYAKMKNRNKASNKTK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.