opsin-like, Pgr_015173 (mRNA) Phagocata gracilis

Overview
Nameopsin-like
Unique NamePgr_015173
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1374
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of opsin-like vs. RefSeq Human
Match: gi|15150803|ref|NP_150598.1| (melanopsin isoform 1 [Homo sapiens])

HSP 1 Score: 209.92 bits (533), Expect = 1.37226e-60
Identity = 126/311 (40.51%), Postives = 193/311 (62.06%), Query Frame = 3
Query:  162 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVF--PVGIIIFCYYQIVKAVRLHELEMLKMAQKMNAT--NPTSIKTGAK-KADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCL 1079
VP+ HY +G I +VG++G+LGNL V+Y F ++SLRTP N+F+++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ IALDRY VI +P T + ++A +L+ VWLY+ W+ PPF+G+ YVPEG TSC++DY++ + + M +C FVF P+ III+CY I +A+R E + Q A N S+ + +++ + AKI ++++ L++LSW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ + + +PCL
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYT--MLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCL 368
BLAST of opsin-like vs. RefSeq Human
Match: gi|71999143|ref|NP_001025186.1| (melanopsin isoform 2 [Homo sapiens])

HSP 1 Score: 201.83 bits (512), Expect = 1.87365e-57
Identity = 126/322 (39.13%), Postives = 193/322 (59.94%), Query Frame = 3
Query:  162 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFA-----------STKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVF--PVGIIIFCYYQIVKAVRLHELEMLKMAQKMNAT--NPTSIKTGAK-KADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCL 1079
VP+ HY +G I +VG++G+LGNL V+Y F ++SLRTP N+F+++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ IALDRY VI +P T + ++A +L+ VWLY+ W+ PPF+G+ YVPEG TSC++DY++ + + M +C FVF P+ III+CY I +A+R E + Q A N S+ + +++ + AKI ++++ L++LSW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ + + +PCL
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYT--MLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCL 379
BLAST of opsin-like vs. RefSeq Human
Match: gi|5730019|ref|NP_006574.1| (visual pigment-like receptor peropsin [Homo sapiens])

HSP 1 Score: 145.976 bits (367), Expect = 2.47663e-38
Identity = 84/303 (27.72%), Postives = 154/303 (50.83%), Query Frame = 3
Query:  168 EVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPC 1076
+ H +V Y+ + G+ ++ N++VL IF K LRTP N +++LA+ D+ S++ G+P+ S W +G C++Y + FG SI + ++A+DRY I P R +T I +++ W+ WA P G+ Y P+ +CT ++ + V + + + NF+ P+ ++ +CYY + +++ H + + ++ I K+S+I++ ++L++W+PY+I+ L A G + P A + LFAK+S YNP IY + + KFR + C
Sbjct: 22 QTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVTDIGVSSI-GYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLP-DVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSD-----------QIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKKFRRAMLAMFKC 311
BLAST of opsin-like vs. RefSeq Human
Match: gi|38678524|ref|NP_859528.1| (opsin-5 [Homo sapiens])

HSP 1 Score: 143.665 bits (361), Expect = 2.51214e-37
Identity = 97/290 (33.45%), Postives = 152/290 (52.41%), Query Frame = 3
Query:  183 LVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDY-LTQ-SKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1046
+ G Y++I+GI GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM ++LDRY I L K A I L +W Y+ W + P G G YVPE F TSCT D+ L Q S G +F + + + P +I+F Y +I+ V+ E+ ++++++ +K K++++I +L++W PYA++++ + GR D + + +P L AK++AMYNP IY + KF
Sbjct: 35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313
BLAST of opsin-like vs. RefSeq Human
Match: gi|4506527|ref|NP_000530.1| (rhodopsin [Homo sapiens])

HSP 1 Score: 139.428 bits (350), Expect = 6.41964e-36
Identity = 100/325 (30.77%), Postives = 167/325 (51.38%), Query Frame = 3
Query:  183 LVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDY--LTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSR 1151
++ Y+ ++ + G N L LY+ K LRTP N +++LA+ DL F + GF +S + + +G C + GF L G I++ ++ ++A++RY V+ +P R AI+ + F W+ + A+PP G+ Y+PEG Q SC DY L N F I M++ +F P+ II FCY Q+V V+ + Q+ +AT +KA+ + ++ II+V +L+ W PYA +A T + + P +P FAK++A+YNP IY + + +FR + ICC + E ++ S T+ S+
Sbjct: 39 MLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADL-FMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFR-FGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQ-----QQESATT--------QKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFR----NCMLTTICCGKNPLGDDEASATVSKTETSQ 344
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15026624 (SmedSxldir_c84693_g1_i1|m.24953|m.19106)

HSP 1 Score: 694.501 bits (1791), Expect = 0
Identity = 349/421 (82.90%), Postives = 383/421 (90.97%), Query Frame = 3
Query:   21 MSLQYANTIGPGMFSNSTVN-VSATTAPWHWDHEFESIVHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESSMSQLD-SDGPQKQDEGKN---AGKTNPAYEDGEK* 1268
MS+Q +G + N+T N S T + WHWD EFESIVHPYWR FDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFAS KSLRTPPN+F+MSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALI+LDRYFVIAQPFQTM++LT+K+AIIMLVFVWLYS +W++PPF+G+G+YVPEGFQTSCTFDYLTQSKGN+IFNIGMYI NF+ PVGIIIFCYYQIVKAVR+HELEMLKMAQKMNA++PTS+KTGAKKAD+QAAKIS+IIVFLY+LSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR+QLEKK PCLICCCPPK KER+TTS ASATKPS+YQSE+ESSMSQLD D Q + KN +G TN AYE +K*
Sbjct: 13 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK* 433
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15032968 (SmedSxlregen_c81464_g11_i1|m.21191|m.10162)

HSP 1 Score: 148.673 bits (374), Expect = 6.20797e-40
Identity = 105/340 (30.88%), Postives = 180/340 (52.94%), Query Frame = 3
Query:  165 PEVYHY-LVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLT---QSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETT-SVASATK--PSRYQS 1160
PE + Y + GVYI +G+ G + N V+ +F +K L TP N+FV L D + GFP L +SSF W + C +Y F + G SI + +IA++R+ + P QT++ +T+K++I ++ W + + PP G+ YV EG Q SC+FD QSK ++ IG F+ + II CY +I VR +++ +++ + N IK K + + + + ++LSW PYA++ ++AL + + +P FAK+ + NP IY +N+P+F+ +L K + C++ P K K+ +TT ++++ T+ PS Q+
Sbjct: 15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIG----TFLLILTAIIICYVKIFFKVR-DQIKEMRIVYTKSFNNLQRIK--ESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLL-CILKQIPCKKKQSQTTQNLSTITRHVPSAVQT 345
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15028515 (SmedSxldir_c96785_g1_i5|m.39594|m.45818)

HSP 1 Score: 140.198 bits (352), Expect = 1.24835e-36
Identity = 88/297 (29.63%), Postives = 154/297 (51.85%), Query Frame = 3
Query:  165 PEVY-HYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLT---QSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPY-TAELPVLFAKTSAMYNPFIYAINHP 1040
PE Y +Y + YI ++GI G N+LV+ +F +KS+ TP N+F+ LA+ DL + GFP LTIS F W + + C Y F + G SI + ++A++R VI++P + ++ ++ K++ ++++ W ++ + PP G+ YV EG SC++D +SK ++F IG+++ + IIIFCY + V+ M M + + K I++ ++LSW PYA++ ++++ + N P FAK+ +YNP IY ++P
Sbjct: 19 PETYVYYALASYILVIGIIGTAENMLVMLVFIRSKSMWTPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGIFLVVLL----IIIFCYLALFLKVQRQATSMRVMIKDSRDLLAERERQRENKLIWMGCNITL----AFVLSWGPYALVTILSIFKVLNEKNSLIIVTFPSFFAKSFTIYNPIIYIFSYP 306
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15030838 (SmedSxlregen_c54053_g1_i1|m.6668|m.37854)

HSP 1 Score: 112.079 bits (279), Expect = 2.37185e-27
Identity = 76/295 (25.76%), Postives = 154/295 (52.20%), Query Frame = 3
Query:  168 EVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIM-LVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1049
+V++Y + IS I GVL N +++ F ++L++P NL +M++ I + A+ G P+ +SSF W + + C YGF G S+ M +IA+DR+FVIA+P TM A K I + + +YS ++ PP G+ Y + +TSC+ ++ ++ + I + + ++ P+ + ++CY+ I +R +++ T +++ +K + + ++I + + ++WTPYA+I + G + P ++AK++ + PF++ +++ +FR
Sbjct: 10 KVFYYSKAIVISFFLIFGVLLNGTIMFTFFHNRALKSPTNLLIMAIIINNFLL-AIFGIPMDIVSSFYQYWIFSDVGCRFYGFAMFFTGLNSVAIMTVIAIDRFFVIAKP--TMAAHITKNVIYLSICGCLVYSLIFTIPPLIGWNEYKLDKSKTSCSVNFESRDPIFYSYTIVILVFCYIIPIIVNLYCYFYIYMTIR-------HISRNTKVTTDNAVEQN-RKIERKLLTVAIAVFVSFFIAWTPYAVICTWTVFGDPSVIPLIVYTTPSVWAKSTVVVYPFVFVLSNQQFR 293
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15010993 (SmedAsxldir_c46418_g1_i1|m.8227|m.22320)

HSP 1 Score: 99.7525 bits (247), Expect = 7.70142e-23
Identity = 91/317 (28.71%), Postives = 159/317 (50.16%), Query Frame = 3
Query:  183 LVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNG-FPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQ---TSCTFDYLT--QSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVR-----LHELEMLKMAQKMNATNPTSIKTGAKKADIQAAK------ISIIIVFLYLLSWTPYAIIALMA---LTGRRDHLNPYTAELP---VLFAKTSAMYNPFIYAINHPKFRLQLEK 1064
LV YI+++ I G LG+ LV+Y+ +K+LRTP N+F+++LAI DL A + F ++ + SF+ W +G+ C++ G G +S ++ IALDRY VI P T +L + AI +++ +W+ S + ASP G + T CT + K V ++I + +V P+ I+ Y +I + ++ LH+ + L+ + + ++ + T +K DIQ + +SI IVF +SW P +I ++ L + P + + +L TSA NP +Y + FR + ++
Sbjct: 61 LVLSYIAMIVI-GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNLHKKD-LESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVF--AISWLPLNLINMIMDLYLMYNESTVGPMSLRIQSICLLMVLTSACTNPILYGWLNDNFRHEFKR 371
BLAST of opsin-like vs. uniprot
Match: gi|3024254|sp|O15973|OPSD1_MIZYE (RecName: Full=Rhodopsin, GQ-coupled; AltName: Full=GQ-rhodopsin [Mizuhopecten yessoensis])

HSP 1 Score: 333.183 bits (853), Expect = 5.60042e-107
Identity = 169/365 (46.30%), Postives = 256/365 (70.14%), Query Frame = 3
Query:   66 NSTVNVSATTAPWHWDHEFESIVHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSRYQS 1160
N T+N S T W+ ++ VH +W QF V E +HY++GVYI+IVG+ G++GN V+YIF++TKSLR+P NLFV++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+ I++DRY VI +P Q + +T +K +M+V VW+ S + + PPF+G+G Y+PEGFQTSCTFDYLT++ + + +Y+ F+ P+ II CY I++ VR H+ +ML + + M + + A +++++ +KI++ + L+++SW+PYAIIAL+A G + P +ELP++ AK+S+M+NP +YA++HPKFR L ++VP L CCC PK K TSV S +R +S
Sbjct: 15 NGTLNRSMTPNT-GWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRA-RSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITPLVSELPMMLAKSSSMHNPVVYALSHPKFRKALYQRVPWLFCCCKPKEKADFRTSVCSKRSVTRTES 377
BLAST of opsin-like vs. uniprot
Match: gi|129211|sp|P09241|OPSD_ENTDO (RecName: Full=Rhodopsin [Enteroctopus dofleini])

HSP 1 Score: 330.872 bits (847), Expect = 1.20746e-106
Identity = 161/334 (48.20%), Postives = 242/334 (72.46%), Query Frame = 3
Query:  132 VHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVAS 1133
+HP+W +FD +P+ +Y VG++I +VGI G+LGN +V+Y+F+ TKSL+TP N+F+++LA+ DL+FSA+NGFPL TIS+F +W +GK+ C++YG +GG+FGF+SINTMA+I++DRY VI +P + ++ ++A +M++FVW++S VW+ P + +G YVPEG TSC+FDYL+ F + MY C F+ P+ II FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++I+ ++LSW+PYAIIAL+A G + + PY AELPVLFAK SA++NP +Y+++HPKFR ++ P L+ CC KE E + A
Sbjct: 20 IHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISMVIITQFMLSWSPYAIIALLAQFGPAEWVTPYAAELPVLFAKASAIHNPIVYSVSHPKFREAIQTTFPWLLTCCQFDEKECEDANDAE 352
BLAST of opsin-like vs. uniprot
Match: gi|129209|sp|P24603|OPSD_LOLFO (RecName: Full=Rhodopsin [Loligo forbesii])

HSP 1 Score: 312.768 bits (800), Expect = 1.31068e-99
Identity = 159/348 (45.69%), Postives = 236/348 (67.82%), Query Frame = 3
Query:  132 VHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESS 1175
+HP+W+QFD VP +Y +G++I+I GI G +GN +V+Y+F TKSL+TP N+F+++LA D TFS VNGFPL+TIS F W +G C++YG IGG+FG +SI TM +I++DRY VI +P + ++ +KA IM++FVW++S +WA P +G+G Y EG +C+FDY+T+ + MYI F+ P+ +I FCY+ IV +V HE EM MA+++NA + GA A+++ AKISI+IV +LLSW+PYA++AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR ++ P ++ CC KE E A A P+ QS E++
Sbjct: 19 IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNILCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-NAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQSGGETA 365
BLAST of opsin-like vs. uniprot
Match: gi|2499376|sp|Q17094|OPSD_ALLSU (RecName: Full=Rhodopsin, partial [Alloteuthis subulata])

HSP 1 Score: 311.612 bits (797), Expect = 2.0659e-99
Identity = 161/347 (46.40%), Postives = 232/347 (66.86%), Query Frame = 3
Query:  132 VHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKES 1172
+H +W+QFD VP +Y +G++I+I GI G GN +V+Y+F TKSL+TP N+F+++LA D TFS VNGFP++TIS F W +G+ C++YG IGG+FG SI TM +I++DRY VI +P + ++ +KA IM+VFVW++S +WA P +G+G Y EG +C+FDY+T+ + MYI F+FP+ +I FCY+ IV +V HE EM MA+++NA + GA A+++ AKISI+IV LLSW+PYAI+AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + P ++ CC KE E A A P+ QS ES
Sbjct: 12 IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGES 357
BLAST of opsin-like vs. uniprot
Match: gi|3024292|sp|O16005|OPSD_SEPOF (RecName: Full=Rhodopsin [Sepia officinalis])

HSP 1 Score: 296.975 bits (759), Expect = 2.20986e-93
Identity = 162/348 (46.55%), Postives = 238/348 (68.39%), Query Frame = 3
Query:  132 VHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESS 1175
VHP+W+QF+ VP+ +Y +G++I I GI G GN +V+Y+F TKSL+TP N+F+++LA D TFS VNGFPL+TIS F +W +G C++YGFIGG+FG +SI TM++I++DRY VI +P + ++ ++A +M++FVW++S +W+ P +G+G YV EG +C+FDY+T+ + MYI F FP+ II FCY+ IV AV HE EM MA+++NA + GA A+++ AKISI+IV +LLSW+PYA++AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + + P +I CC KE E A P+ QS ES+
Sbjct: 19 VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQSGGESA 365
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17137098|ref|NP_477096.1| (rhodopsin 5, isoform A [Drosophila melanogaster])

HSP 1 Score: 207.223 bits (526), Expect = 5.76683e-61
Identity = 128/376 (34.04%), Postives = 217/376 (57.71%), Query Frame = 3
Query:   48 GPGMFSNSTVNVSATTAPWH-WDHEFESIVHPYWRQFDMVPEVYHYLVGVYIS--IVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASP-----PFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKA-DIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPS 1148
GP + N ++ + H + E++ +VH +WR F P YH G YI+ ++ +S + GN LV++IF+++KSLRTP NL +++LAI DL F N P I++ G L C+IY GG+ G + T A IA DRY I+ P L+ + +++++F WL WA+P F +G Y PEGF T+C+FDYLT + N +F +++ ++V P+ +I+ YY++ VR+HE + + A+KMN + ++ + +++ AK ++II L++L+WTPY+++AL+ G + + P+ + LP L K+ + +P++YA +HPK+RL+LE+++P L +E+ TS S + S
Sbjct: 8 GPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDG--RLSYGQIVLLILFTWL----WATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRLPWL------GIREKHATSGTSGGQES 367
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|665407712|ref|NP_001285859.1| (rhodopsin 5, isoform B [Drosophila melanogaster])

HSP 1 Score: 207.223 bits (526), Expect = 5.76683e-61
Identity = 128/376 (34.04%), Postives = 217/376 (57.71%), Query Frame = 3
Query:   48 GPGMFSNSTVNVSATTAPWH-WDHEFESIVHPYWRQFDMVPEVYHYLVGVYIS--IVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASP-----PFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKA-DIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPS 1148
GP + N ++ + H + E++ +VH +WR F P YH G YI+ ++ +S + GN LV++IF+++KSLRTP NL +++LAI DL F N P I++ G L C+IY GG+ G + T A IA DRY I+ P L+ + +++++F WL WA+P F +G Y PEGF T+C+FDYLT + N +F +++ ++V P+ +I+ YY++ VR+HE + + A+KMN + ++ + +++ AK ++II L++L+WTPY+++AL+ G + + P+ + LP L K+ + +P++YA +HPK+RL+LE+++P L +E+ TS S + S
Sbjct: 8 GPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDG--RLSYGQIVLLILFTWL----WATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRLPWL------GIREKHATSGTSGGQES 367
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738051|ref|NP_524407.1| (neither inactivation nor afterpotential E [Drosophila melanogaster])

HSP 1 Score: 205.297 bits (521), Expect = 2.14075e-60
Identity = 120/342 (35.09%), Postives = 194/342 (56.73%), Query Frame = 3
Query:  117 EFESIVHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATK 1142
+ ++ PYW QF + ++ ++ Y+ ++G+ GN +V+YIFA+TKSLRTP NL V++LAI D N P++ I+ + W G + C+IY +G FG SI +M +I+LDRY VI + R +T+ A+ + ++W S +W P +G+ YVPEG TSC DYL + + I I + P+ +I + Y+ I+ AV HE M + A+KMN + S + K A+ + AK++++ + L+ ++WTPY +I M L + + L P FAK++A YNP +Y I+HPK+RL L++K PC + K + S A+A++
Sbjct: 30 DMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLF-KFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASE 368
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738059|ref|NP_524411.1| (rhodopsin 3 [Drosophila melanogaster])

HSP 1 Score: 201.445 bits (511), Expect = 8.56697e-59
Identity = 127/364 (34.89%), Postives = 203/364 (55.77%), Query Frame = 3
Query:   78 NVSATTAPWHWDHEFESIVH--PYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPF-WGFGHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATN-PTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCLICCCPPKAKERETTSVASATKPSRYQ 1157
+SA T W+ E + H +W + PE +YL+G + +LGN LV+++F++ KSLRTP N+ V++LA D F + P+ +SF+ +A G L C+I+G IG G + T A IA DR+ VI +P + +T KAI M++F+++Y+ W + +G +VPEG+ TSCTFDYLT + +F ++ +FV P +I + Y QIV V HE + A+KMN + +++ + A+I+ AK +I I FL+ SWTPY +++L+ G + L P +P K A +PF+YAI+HP++R++L+K+ P L K E+++VAS + Q
Sbjct: 23 RLSAETRLLGWNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCD--FMMMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPMEG--KMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQKRCPWLAL----NEKAPESSAVASTSTTQEPQ 378
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17136434|ref|NP_476701.1| (rhodopsin 4 [Drosophila melanogaster])

HSP 1 Score: 197.978 bits (502), Expect = 1.31467e-57
Identity = 118/329 (35.87%), Postives = 186/329 (56.53%), Query Frame = 3
Query:   99 PWHWDHEFESIVHPYWRQFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGF-GHYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVKAVRLHELEMLKMAQKMNATN-PTSIKTGAKKADIQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRLQLEKKVPCL 1079
P HW + E P HY++GV+ + + +GN +V++IF+++KSLRTP N+FV++LA+ DL P+ +SF+ +A G C+I+ IG G + T A I DRY VI +P R +T KA+IM + +WLY W P F +VPEG+ TSC+FDYL+ + +F ++ +FV P +I++ Y QIV V HE + + A+KMN + +++ + A+I+ AK +I I FL+ +SWTPY +++L+ G + L P +P K A +PF+YAI+HP++RL+L+K+ P L
Sbjct: 40 PEHWLTQLEP------------PASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKA--PIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMN--RNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQKRCPWL 352
The following BLAST results are available for this feature:
BLAST of opsin-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|15150803|ref|NP_150598.1|1.372260e-6040.51melanopsin isoform 1 [Homo sapiens][more]
gi|71999143|ref|NP_001025186.1|1.873650e-5739.13melanopsin isoform 2 [Homo sapiens][more]
gi|5730019|ref|NP_006574.1|2.476630e-3827.72visual pigment-like receptor peropsin [Homo sapien... [more]
gi|38678524|ref|NP_859528.1|2.512140e-3733.45opsin-5 [Homo sapiens][more]
gi|4506527|ref|NP_000530.1|6.419640e-3630.77rhodopsin [Homo sapiens][more]
back to top
BLAST of opsin-like vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150266240.000000e+082.90SmedSxldir_c84693_g1_i1|m.24953|m.19106[more]
SMU150329686.207970e-4030.88SmedSxlregen_c81464_g11_i1|m.21191|m.10162[more]
SMU150285151.248350e-3629.63SmedSxldir_c96785_g1_i5|m.39594|m.45818[more]
SMU150308382.371850e-2725.76SmedSxlregen_c54053_g1_i1|m.6668|m.37854[more]
SMU150109937.701420e-2328.71SmedAsxldir_c46418_g1_i1|m.8227|m.22320[more]
back to top
BLAST of opsin-like vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|3024254|sp|O15973|OPSD1_MIZYE5.600420e-10746.30RecName: Full=Rhodopsin, GQ-coupled; AltName: Full... [more]
gi|129211|sp|P09241|OPSD_ENTDO1.207460e-10648.20RecName: Full=Rhodopsin [Enteroctopus dofleini][more]
gi|129209|sp|P24603|OPSD_LOLFO1.310680e-9945.69RecName: Full=Rhodopsin [Loligo forbesii][more]
gi|2499376|sp|Q17094|OPSD_ALLSU2.065900e-9946.40RecName: Full=Rhodopsin, partial [Alloteuthis subu... [more]
gi|3024292|sp|O16005|OPSD_SEPOF2.209860e-9346.55RecName: Full=Rhodopsin [Sepia officinalis][more]
back to top
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17137098|ref|NP_477096.1|5.766830e-6134.04rhodopsin 5, isoform A [Drosophila melanogaster][more]
gi|665407712|ref|NP_001285859.1|5.766830e-6134.04rhodopsin 5, isoform B [Drosophila melanogaster][more]
gi|17738051|ref|NP_524407.1|2.140750e-6035.09neither inactivation nor afterpotential E [Drosoph... [more]
gi|17738059|ref|NP_524411.1|8.566970e-5934.89rhodopsin 3 [Drosophila melanogaster][more]
gi|17136434|ref|NP_476701.1|1.314670e-5735.87rhodopsin 4 [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_015173 ID=Pgr_015173|Name=opsin-like|organism=Phagocata gracilis|type=mRNA|length=1374bp
CTTTATCCATCGCTGGTGACATGAGCTTACAATATGCAAATACAATCGGT
CCCGGAATGTTCTCCAACTCCACCGTTAATGTGTCCGCAACCACAGCACC
TTGGCACTGGGATCACGAATTCGAGTCCATCGTGCATCCTTACTGGCGGC
AATTTGACATGGTCCCGGAAGTGTACCACTACTTGGTCGGGGTCTATATA
TCGATAGTCGGTATATCCGGGGTGCTAGGCAATCTCTTGGTGCTCTATAT
ATTTGCAAGCACCAAGAGTCTTCGAACGCCTCCGAACCTTTTTGTGATGA
GCCTGGCCATTGGAGATTTGACCTTTTCCGCAGTTAATGGGTTCCCATTG
CTGACAATTTCCAGTTTTAATACAAGATGGGCCTGGGGCAAGCTAACGTG
TGAGATTTACGGCTTTATCGGGGGTCTTTTTGGCTTTATATCCATCAATA
CAATGGCCTTGATAGCTTTGGATCGATACTTTGTGATTGCGCAACCATTC
CAAACCATGCGGGCTCTGACTATGAAGAAGGCCATCATAATGCTGGTTTT
TGTGTGGCTTTATTCGTTCGTTTGGGCGTCACCTCCGTTCTGGGGATTTG
GTCATTACGTCCCAGAAGGATTTCAAACGTCATGTACATTTGACTATCTG
ACCCAAAGCAAAGGAAACGTCATCTTCAACATTGGAATGTACATTTGCAA
CTTTGTATTCCCAGTCGGCATTATAATTTTCTGCTACTATCAAATTGTAA
AGGCCGTACGATTACATGAACTTGAGATGCTTAAAATGGCCCAGAAAATG
AATGCTACCAATCCAACGTCAATAAAAACCGGCGCAAAAAAAGCCGATAT
TCAAGCAGCAAAAATTTCAATAATAATAGTGTTTCTATATTTGTTGTCAT
GGACACCGTACGCTATTATAGCGCTAATGGCCCTGACTGGACGGCGGGAT
CACTTGAATCCGTACACGGCTGAATTGCCGGTCCTGTTTGCGAAGACTTC
TGCCATGTACAATCCGTTCATTTACGCCATTAATCATCCGAAATTCCGAC
TGCAATTAGAGAAGAAGGTGCCGTGTTTGATTTGTTGCTGCCCACCAAAA
GCAAAGGAACGTGAGACAACTAGTGTGGCTTCTGCCACGAAACCAAGTCG
ATATCAAAGCGAAAAGGAGAGTTCAATGTCTCAATTAGATTCCGATGGCC
CGCAGAAGCAAGATGAAGGGAAAAATGCGGGGAAAACGAATCCGGCGTAC
GAAGATGGTGAGAAGTAAACGTTGAAACTGTTAGTGATTATATTCACGTG
TTCGTTGTTCTTGAAGCACAATGTTTGTAACAATTGTTTGATCGATATTG
TCAGTTATAGTATTTGTTCACAAT

Design Primers for opsin-like

back to top

protein sequence

>Pgr_015173-protein ID=Pgr_015173-protein|Name=opsin-like|organism=Phagocata gracilis|type=polypeptide|length=422bp
LSIAGDMSLQYANTIGPGMFSNSTVNVSATTAPWHWDHEFESIVHPYWRQ
FDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMS
LAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINT
MALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFG
HYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVK
AVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSW
TPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRL
QLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESSMSQLDSDGP
QKQDEGKNAGKTNPAYEDGEK*
back to top

coding sequence

>Pgr_015173.3.1268 ID=Pgr_015173.3.1268|Name=Pgr_015173.3.1268|organism=Phagocata gracilis|type=CDS|length=1266bp
TTATCCATCGCTGGTGACATGAGCTTACAATATGCAAATACAATCGGTCC
CGGAATGTTCTCCAACTCCACCGTTAATGTGTCCGCAACCACAGCACCTT
GGCACTGGGATCACGAATTCGAGTCCATCGTGCATCCTTACTGGCGGCAA
TTTGACATGGTCCCGGAAGTGTACCACTACTTGGTCGGGGTCTATATATC
GATAGTCGGTATATCCGGGGTGCTAGGCAATCTCTTGGTGCTCTATATAT
TTGCAAGCACCAAGAGTCTTCGAACGCCTCCGAACCTTTTTGTGATGAGC
CTGGCCATTGGAGATTTGACCTTTTCCGCAGTTAATGGGTTCCCATTGCT
GACAATTTCCAGTTTTAATACAAGATGGGCCTGGGGCAAGCTAACGTGTG
AGATTTACGGCTTTATCGGGGGTCTTTTTGGCTTTATATCCATCAATACA
ATGGCCTTGATAGCTTTGGATCGATACTTTGTGATTGCGCAACCATTCCA
AACCATGCGGGCTCTGACTATGAAGAAGGCCATCATAATGCTGGTTTTTG
TGTGGCTTTATTCGTTCGTTTGGGCGTCACCTCCGTTCTGGGGATTTGGT
CATTACGTCCCAGAAGGATTTCAAACGTCATGTACATTTGACTATCTGAC
CCAAAGCAAAGGAAACGTCATCTTCAACATTGGAATGTACATTTGCAACT
TTGTATTCCCAGTCGGCATTATAATTTTCTGCTACTATCAAATTGTAAAG
GCCGTACGATTACATGAACTTGAGATGCTTAAAATGGCCCAGAAAATGAA
TGCTACCAATCCAACGTCAATAAAAACCGGCGCAAAAAAAGCCGATATTC
AAGCAGCAAAAATTTCAATAATAATAGTGTTTCTATATTTGTTGTCATGG
ACACCGTACGCTATTATAGCGCTAATGGCCCTGACTGGACGGCGGGATCA
CTTGAATCCGTACACGGCTGAATTGCCGGTCCTGTTTGCGAAGACTTCTG
CCATGTACAATCCGTTCATTTACGCCATTAATCATCCGAAATTCCGACTG
CAATTAGAGAAGAAGGTGCCGTGTTTGATTTGTTGCTGCCCACCAAAAGC
AAAGGAACGTGAGACAACTAGTGTGGCTTCTGCCACGAAACCAAGTCGAT
ATCAAAGCGAAAAGGAGAGTTCAATGTCTCAATTAGATTCCGATGGCCCG
CAGAAGCAAGATGAAGGGAAAAATGCGGGGAAAACGAATCCGGCGTACGA
AGATGGTGAGAAGTAA
back to top
Gene Groups
opsin-like is similar in sequence to the genes of this group: GG7488
Gene NameGene ID
SMU15026624SMU15026624
opsin-likeDdo_008381
opsin-likeGsp_022660
opsin-likePgr_015173
opsin-likePmo_026986

Gene Group Protein Sequences

>SMU15026624

MILYLTLKIFIFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESI
VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTP
PNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLF
GFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWST
PPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIF
CYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIV
FLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI
NHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMS
QLDPEDDKQVVETTKNQTTSGHTNEAYESEQK*
>Ddo_008381 opsin-like
LQMSVQSFLSIGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPE
VYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDL
TFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISL
DRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEG
FQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHE
LEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVI
ALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKF
PCLICCCPPKPKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVET
NKGQAASGHTNEAYESEK*
>Gsp_022660 opsin-like
VLFMNLHSLVGLGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFD
MVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLA
IGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMA
LISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNY
VPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAV
RVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTP
YAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL
EKKFPCLICCCPPKPKERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQ
ATETSKVQATSGHTNDAYENEQK*
>Pgr_015173 opsin-like
LSIAGDMSLQYANTIGPGMFSNSTVNVSATTAPWHWDHEFESIVHPYWRQ
FDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMS
LAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINT
MALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFG
HYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVK
AVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSW
TPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRL
QLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESSMSQLDSDGP
QKQDEGKNAGKTNPAYEDGEK*
>Pmo_026986 opsin-like
MSNCLQYGWTIASNSWSQCHGAMVTVLLTVLFEYIMMYSNSTVNSTVTIA
PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLY
IFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLT
CEIYGFIGGLFGFISINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLV
GVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIC
NFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD
I

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.