ifb, Pgr_011052 (mRNA) Phagocata gracilis

Overview
Nameifb
Unique NamePgr_011052
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1999
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of ifb vs. RefSeq Human
Match: gi|27436946|ref|NP_733821.1| (lamin isoform A [Homo sapiens])

HSP 1 Score: 159.844 bits (403), Expect = 1.07539e-40
Identity = 152/555 (27.39%), Postives = 276/555 (49.73%), Query Frame = 2
Query:  266 REKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQL-------KKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDT-------QETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMER---ANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGS---KPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
R +E+ +LQELNDR A YID+V+ LE EN L +TE + +E IK Y+ ++ + RK+LDS + +L++ ++ + E E+ + + + ++L D E + S L+ EK + E+ L+ +VA+L KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F + +A AL++++++++ +++ + ++E Y+ K+ + R + +++ +E Q R L QLS+++ +L EA+ +LE D +R+ D R A +E++ +A+++ E Q LLD KL+L++EI AYRK+LEGEE R+ S S G+ A S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R + ++ P+ T+ GQ + IWA G+ P +D + A++ WG G + T L N GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVRE-------EFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLE----------DSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLR--------LSPSPTSQRSRGR----ASSHSSQTQGGGSVTKKRKLESTE---------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTL--KAGQ--VVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063468|ref|NP_001269555.1| (lamin isoform A-delta50 [Homo sapiens])

HSP 1 Score: 159.073 bits (401), Expect = 1.65208e-40
Identity = 152/555 (27.39%), Postives = 276/555 (49.73%), Query Frame = 2
Query:  266 REKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQL-------KKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDT-------QETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMER---ANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGS---KPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
R +E+ +LQELNDR A YID+V+ LE EN L +TE + +E IK Y+ ++ + RK+LDS + +L++ ++ + E E+ + + + ++L D E + S L+ EK + E+ L+ +VA+L KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F + +A AL++++++++ +++ + ++E Y+ K+ + R + +++ +E Q R L QLS+++ +L EA+ +LE D +R+ D R A +E++ +A+++ E Q LLD KL+L++EI AYRK+LEGEE R+ S S G+ A S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R + ++ P+ T+ GQ + IWA G+ P +D + A++ WG G + T L N GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVRE-------EFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLE----------DSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLR--------LSPSPTSQRSRGR----ASSHSSQTQGGGSVTKKRKLESTE---------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTL--KAGQ--VVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|5031875|ref|NP_005563.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 158.303 bits (399), Expect = 1.69462e-40
Identity = 152/555 (27.39%), Postives = 276/555 (49.73%), Query Frame = 2
Query:  266 REKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQL-------KKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDT-------QETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMER---ANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGS---KPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
R +E+ +LQELNDR A YID+V+ LE EN L +TE + +E IK Y+ ++ + RK+LDS + +L++ ++ + E E+ + + + ++L D E + S L+ EK + E+ L+ +VA+L KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F + +A AL++++++++ +++ + ++E Y+ K+ + R + +++ +E Q R L QLS+++ +L EA+ +LE D +R+ D R A +E++ +A+++ E Q LLD KL+L++EI AYRK+LEGEE R+ S S G+ A S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R + ++ P+ T+ GQ + IWA G+ P +D + A++ WG G + T L N GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVRE-------EFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLE----------DSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLR--------LSPSPTSQRSRGR----ASSHSSQTQGGGSVTKKRKLESTE---------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTL--KAGQ--VVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063466|ref|NP_001269554.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 158.303 bits (399), Expect = 1.69462e-40
Identity = 152/555 (27.39%), Postives = 276/555 (49.73%), Query Frame = 2
Query:  266 REKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQL-------KKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDT-------QETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMER---ANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGS---KPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
R +E+ +LQELNDR A YID+V+ LE EN L +TE + +E IK Y+ ++ + RK+LDS + +L++ ++ + E E+ + + + ++L D E + S L+ EK + E+ L+ +VA+L KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F + +A AL++++++++ +++ + ++E Y+ K+ + R + +++ +E Q R L QLS+++ +L EA+ +LE D +R+ D R A +E++ +A+++ E Q LLD KL+L++EI AYRK+LEGEE R+ S S G+ A S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R + ++ P+ T+ GQ + IWA G+ P +D + A++ WG G + T L N GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVRE-------EFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLE----------DSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLR--------LSPSPTSQRSRGR----ASSHSSQTQGGGSVTKKRKLESTE---------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTL--KAGQ--VVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|27436948|ref|NP_733822.1| (lamin isoform A-delta10 [Homo sapiens])

HSP 1 Score: 157.532 bits (397), Expect = 5.10971e-40
Identity = 152/558 (27.24%), Postives = 276/558 (49.46%), Query Frame = 2
Query:  266 REKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQL-------KKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDT-------QETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMER---ANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGS---KPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHT 1858
R +E+ +LQELNDR A YID+V+ LE EN L +TE + +E IK Y+ ++ + RK+LDS + +L++ ++ + E E+ + + + ++L D E + S L+ EK + E+ L+ +VA+L KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F + +A AL++++++++ +++ + ++E Y+ K+ + R + +++ +E Q R L QLS+++ +L EA+ +LE D +R+ D R A +E++ +A+++ E Q LLD KL+L++EI AYRK+LEGEE R+ S S G+ A S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R + ++ P+ T+ GQ + IWA G+ P +D + A++ WG G + T L N GE SH
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVRE-------EFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLE----------DSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLR--------LSPSPTSQRSRGR----ASSHSSQTQGGGSVTKKRKLESTE---------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTL--KAGQ--VVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGE--GSHC 540
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15011956 (SmedAsxldir_c69509_g1_i1|m.14946|m.134)

HSP 1 Score: 786.563 bits (2030), Expect = 0
Identity = 411/611 (67.27%), Postives = 513/611 (83.96%), Query Frame = 2
Query:   50 NVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQRTVYQM* 1882
N T++S IQPISG RNVVI RT P+V G G +NIR IEM KSYGL++TPGATSNIV +GV++LMNGREKE++ELQ+LNDRFANYIDKV++LEDEN+RL+DEL +LK+QWGKET RIK YDNDM LR+SLD AEGAK Q+EM+IN+ ED + E++ EL++ Q+H ADKETIDKM S LSDYE+EI +LR+RL GLE+EK+RD+KEI RLK+E+ LK+DL+KETL+HI A NE+QSL D+IEFLKKI+ESEVREL SL YKD +E+KDFWRNEMAQALRDIQ+EYDR++D++ +DMEAQY LKIQ+ R TQS++ ET+QLRE+NT++K+QL+EMRNRLPELEARNNELER+LE+LRREI+E++R++D+E+ NLRKEL +R+A+LE I ELQILLDAKLSLELEI+AYRKMLEGEE+RVN+K SN + +G+ +D D +TRT++ Q AA ++KTQV+S +KG+MSAKTSFQRTAKGNVTIQECSPDGKF++LENTG Q E+ISG+ + RNTDNGRIV+ IP TIL+PTG+NR+ KIWA+G++P GS D EC+ESNWG G IVT+L N KGEEKA+HTQRTVYQ+*
Sbjct: 12 NYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRK---------SNQNLNQTGRSVDTMDH-VTRTSISQQHAA-PSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL* 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15038947 (dd_smedV4_3871_0_1|m.24747|m.30510)

HSP 1 Score: 496.893 bits (1278), Expect = 9.13866e-168
Identity = 274/597 (45.90%), Postives = 410/597 (68.68%), Query Frame = 2
Query:   92 SGPRNVVINRTAPSVQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDP-SESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVG--QSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQRTVY 1873
S V IN+++P+V++ EM++SY + P S + S VSS + GRE+E+ E+Q+LN+R ANYI+KV+ LE +N+RLT+EL L+ +WGKE ERI+ Y+ +M+ L+K LD AE A+ +L +IN E+ L E + E N H D+E I+K+N QLS+ E EI LRRR+ LE+E+ R K ISRL+DE+ + + DLD+ET++HI +++EVQS +D+I+F+K +++E++EL +LAY+D +E++DFWR+EM +LR++Q EYDR++++++ D+E +N+K+Q+ R + ++ E+I L+E+N +LK QLS +R++ PE+EA+N +LER LE LRRE+D + D++ ER LR +L Q +L+SI E Q ++D KLSLELEI AYRK+LEGEE R SG R + + TI +T+ G ++ + T KTQ+S+ +K + +AK + QRTAKGNV I E S DGKF++LENTG + E+ISGFK+ RN DN R ++ + IP +TIL P GQ +FLKIW+KG++P GS+D+EC+ +NWG GT I T L NK EE+A+HTQ+T +
Sbjct: 6 SARSTVTINKSSPAVKE-----------YEMRQSYNFSGAPMGGSVQIHSNVSSAVEGREREKREMQDLNERLANYIEKVRFLEAQNKRLTNELNTLRERWGKEAERIRALYEIEMDQLKKLLDEAEAARSELLPKINKLEEQLHEYLQGIDEANNQHGMDQEMIEKLNRQLSECEGEIGLLRRRIAALEEERGRSKKTISRLRDEIKRTRMDLDQETMNHIASESEVQSRKDEIDFMKDSHDNEMKELAALAYRDSTAENRDFWRSEMGSSLRELQIEYDRKLEAMRGDLENHHNVKVQELRHSSPREGVESIHLKEENIRLKNQLSNLRSKCPEMEAKNAQLERFLEELRRELDRQINDFESERDKLRSDLQRTQDELDSIMKEFQNVMDMKLSLELEIAAYRKLLEGEESR--------------------SGLR-NMMEQTIFKTSGGIEGNIISKTAGKTQMSNLMKNERNAKVNHQRTAKGNVIIHETSADGKFIILENTGKKDEDISGFKIIRNIDNDRSIIRYEIPNSTILKPEGQQKFLKIWSKGNRPTGSNDLECSSANWGTGTHIFTALLNKSNEERATHTQKTTF 570
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15013238 (SmedAsxldir_c85434_g1_i1|m.24146|m.11304)

HSP 1 Score: 360.533 bits (924), Expect = 1.76752e-114
Identity = 221/622 (35.53%), Postives = 375/622 (60.29%), Query Frame = 2
Query:    5 SSTIIMQSS------RTATSTNVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
+STII + S +T T N + S + PIS R ++INRT V + I+ +Y P ++ V + REK++ +++ LN++ A YI++V+ LE +N++ + EL+ LK++WGK+TE +K +Y+ +M NL+K L AE + + E + + E LQ+++ EL+ + N + I+ +LS+ E I+ L++RL LE+ K +D EI +L+DE+ L++DL+ +T+ ++ + E+Q D++EFLK+I+++++ EL++LAY+D + ++KDFW+ E++ A++DIQS+YD RI ++ +E+QY +++QD + +K E ++++N ++K + R+R+P+LE + LER L LR E +E RDY++E ++ KEL+ + + +L+ LLD KLSL+LEI AYRK+LEGEE R K++ + + S+ TI + V ++ + G++SAK++F RT KGNV+I EC+ DG+ ++LEN G E IS +NR+ D+GR ++ F IP+ T +D N+ +KIWAKG KP G++D+E E+NWG+G+ I T+L+N GEE+A
Sbjct: 15 NSTIIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPS---------QIIQRSFNYETRVIPSKSA--AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTS-----------ATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERA 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15019274 (SmedSxldir_c108927_g2_i1|m.81594|m.27374)

HSP 1 Score: 256.914 bits (655), Expect = 1.03844e-74
Identity = 159/435 (36.55%), Postives = 274/435 (62.99%), Query Frame = 2
Query:   62 TSSSNNIQPISGPRNVV--------INRTAPSVQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDK-EISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVN 1336
T+S + +PIS PRN + ++ +A S Q G + + IR S +QSGV+S+ GR +E+ +LQ+LN+RFA+YI+K + LE +N++L +E+ +LK ++ +IK+ Y+ ++N LR ++ +E +K LE +++S E + + L + I++ K TIDK +S +E E+ L RR G + + +K E+ L+D++ +L++D +KE L H+ ++E+QSL++ +EF K+I+++EV+EL ++AY+DP+ E+ +W++EM +ALRDIQ+EY+ ++ I+ ++EA Y L++Q+ R ++++D ET +E+N+++K Q+ MR+R+ +LE +N E E L +R +E R +++ NL+++L+ Q +L ELQ LLDAKL LELEI AY K+LE EE RVN
Sbjct: 91 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIR---------------GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVEL-RRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 509

HSP 2 Score: 71.633 bits (174), Expect = 9.09154e-13
Identity = 39/118 (33.05%), Postives = 63/118 (53.39%), Query Frame = 2
Query: 1508 SAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQ 1861
S + F+RT KGN++I E G ++LEN G + E++ G + R D + F I L+ G+ + + AKG ++E +++WGVG +VT L + +G EKA+H Q
Sbjct: 580 SKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNA-GEK--ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 694
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15006730 (SmedAsxldir_c108652_g1_i6|m.91472|m.48315)

HSP 1 Score: 255.758 bits (652), Expect = 1.81499e-74
Identity = 159/435 (36.55%), Postives = 274/435 (62.99%), Query Frame = 2
Query:   62 TSSSNNIQPISGPRNVV--------INRTAPSVQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDK-EISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVN 1336
T+S + +PIS PRN + ++ +A S Q G + + IR S +QSGV+S+ GR +E+ +LQ+LN+RFA+YI+K + LE +N++L +E+ +LK ++ +IK+ Y+ ++N LR L +E ++ LE++++S E + + L + I++ K TIDK +S +E E+ L RR G + + +K E+ L+D++ +L++D +KE L H+ ++E+QSL++ +EF K+I+++EV+EL ++AY+DP+ E+ +W++EM +ALRDIQ+EY+ ++ I+ ++EA Y L++Q+ R ++++D ET +E+N+++K Q+ MR+R+ +LE +N E E L +R +E R +++ NL+++L+ Q +L ELQ LLDAKL LELEI AY K+LE EE RVN
Sbjct: 91 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIR---------------GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVEL-RRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 509

HSP 2 Score: 71.633 bits (174), Expect = 9.01003e-13
Identity = 39/118 (33.05%), Postives = 63/118 (53.39%), Query Frame = 2
Query: 1508 SAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQ 1861
S + F+RT KGN++I E G ++LEN G + E++ G + R D + F I L+ G+ + + AKG ++E +++WGVG +VT L + +G EKA+H Q
Sbjct: 571 SKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRIVDGSENKISFTISGKVNLNA-GEK--ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 685
BLAST of ifb vs. uniprot
Match: gi|266617|sp|Q01241|NF70_DORPE (RecName: Full=70 kDa neurofilament protein; Short=NF70 [Doryteuthis pealeii])

HSP 1 Score: 405.986 bits (1042), Expect = 6.86368e-131
Identity = 249/631 (39.46%), Postives = 394/631 (62.44%), Query Frame = 2
Query:    8 STIIMQSSRTATSTNVYKTSSSNNIQP-ISGPRNVVINRTAPS-VQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKD-PSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFAD--STI-TRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPG-SDDMECAESN-WGVGTLIVTMLFNKKGEEKASHTQRTVYQ 1876
ST + S+ + S S I P SG INR++ S + + G+ R + SYG A PG +NI +GV+ + RE+E+ ++++LN+RFANYI+KV+ LE +N++L EL ELK++WGKET IK+ Y+ ++ RK +D+ K+ L++R+ D L+ + +L E H D+E I + N QL+D E EI+ LRR + LE EK+R ++++ DE+ +++ DL+ ET++H+ A+N Q+L +++EF K ++ E++EL +LAY+D +E+++FWRNE+AQA+RDIQ EYD + D ++ D+EA YNLK+Q++R +K E + +E+NTKLK ++E+RNRL +LEARN +LER + L R+++E+ R ++E ++E++ + ++ESI ELQ L+D KLSLELEI AYRK+LEGEE RV K + G R + A+ STI TR+ G ++G+++AKT++QRT+KG+V+I+E G F+ LE + EN++G+K+ R D+ + V + IP N +L TG +KIW+K + DD+ E++ WG G+ +VT+L N+KGE+KA++TQ TVYQ
Sbjct: 11 STTTTYEGESRPSSGMSGFSYSAKIHPRTSG----YINRSSQSPFRSSMGSNAAYTRSYDF--SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMK----------QIVEQVVGARPNEAEVLSTILTRSEGGYEATG---DSQISMKMMRGELAAKTTYQRTSKGSVSIKEADSQGCFIALETK--KEENLTGWKIVRKVDDNK-VYTYEIP-NLVL-KTGT--VVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNTVYQ 615
BLAST of ifb vs. uniprot
Match: gi|266616|sp|Q01240|NF60_DORPE (RecName: Full=60 kDa neurofilament protein; Short=NF60 [Doryteuthis pealeii])

HSP 1 Score: 327.405 bits (838), Expect = 5.23309e-102
Identity = 186/448 (41.52%), Postives = 293/448 (65.40%), Query Frame = 2
Query:    8 STIIMQSSRTATSTNVYKTSSSNNIQP-ISGPRNVVINRTAPS-VQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKD-PSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQK 1342
ST + S+ + S S I P SG INR++ S + + G+ R + SYG A PG +NI +GV+ + RE+E+ ++++LN+RFANYI+KV+ LE +N++L EL ELK++WGKET IK+ Y+ ++ RK +D+ K+ L++R+ D L+ + +L E H D+E I + N QL+D E EI+ LRR + LE EK+R ++++ DE+ +++ DL+ ET++H+ A+N Q+L +++EF K ++ E++EL +LAY+D +E+++FWRNE+AQA+RDIQ EYD + D ++ D+EA YNLK+Q++R +K E + +E+NTKLK ++E+RNRL +LEARN +LER + L R+++E+ R ++E ++E++ + ++ESI ELQ L+D KLSLELEI AYRK+LEGEE RV K
Sbjct: 11 STTTTYEGESRPSSGMSGFSYSAKIHPRTSG----YINRSSQSPFRSSMGSNAAYTRSYDF--SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMK 452
BLAST of ifb vs. uniprot
Match: gi|124235|sp|P23731|IFEB_ASCSU (RecName: Full=Intermediate filament protein B; Short=IF-B [Ascaris suum])

HSP 1 Score: 324.324 bits (830), Expect = 7.93202e-100
Identity = 205/609 (33.66%), Postives = 346/609 (56.81%), Query Frame = 2
Query:   56 YKTSSSNNIQPISGPRNVVINRTAPSVQQTGGAGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTG-GQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAK---GSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQRTV 1870
Y+ + + IQP + R A S G G R ++M G + G + + + S + +KE+ E+Q LNDR NYID+VK LE++NR+L +L EL+ +WGK+T IK QY + + + RK +D K ++++++ D L E +V +D+E I++ + D ++E+ LR R L +E+ R + + +R+ +E+ + + DLD+ETL I QN+VQ+L +++EFL++++E EV+EL +L + P+++++F++NE+A A+RDI+ EYD + DME+ Y LK+ + + + ++ E+ RE+ ++++ + ++R +L +LEA+N LE+ ++ L ++++ R Y+ + L + + +++ AELQ LLD K L+ EI YRKMLEGEE RV + + + + Q+ + DST NV +G++S KT+FQR+AKGNVTI EC P+GKF+ LENT + EN+ ++ R DN R +V + IP NT+L R +KI+A+ G P + E+ WG+G +VT L NK G+E+A+HTQ+T+
Sbjct: 11 YEIAYRSTIQPRTAVRTQSRQSGAYSTGAVSGGGG---RVLKMVTEMGSASIGGISPALSANAAKSFLEATDKEKKEMQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGRWGKDTSEIKIQYSDSLRDARKEIDDGARRKAEIDVKVARLRDDLAELRNRYEDVQHRRESDREKINQWQHAIEDAQSELEMLRARWRQLTEEEKRLNGDNARIWEELQKARNDLDEETLGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDYIAKQGKQDMESWYKLKVSEVQGSANRANMESSYQREEVKRMRDNIGDLRGKLGDLEAKNALLEKEVQNLNYQLNDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEESRVGLRQMVEQVVKTHSL------QQQEDTDST---RNV------------------RGEVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRSKDENLGEHRLKRKLDNRREIV-YTIPPNTVLKA---GRTMKIYARDQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|46576384|sp|Q19289|IFB1_CAEEL (RecName: Full=Intermediate filament protein ifb-1; AltName: Full=Cel IF B1; AltName: Full=Intermediate filament protein B1; Short=IF-B1)

HSP 1 Score: 314.309 bits (804), Expect = 5.37464e-96
Identity = 195/572 (34.09%), Postives = 333/572 (58.22%), Query Frame = 2
Query:  170 RRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTG-GQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKG----SKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQRTV 1870
R ++M G G + + + S + +KE+ LQ LNDR NYID+VK LE++NR+L +L EL+ +WGK+T IK +Y ++ RK +D A K ++++++ D L E ++ Q +D+E I + + ++D ++E+ LR R L DE+ R + SR+ +E+ + + DLD ET+ I QN+VQ+L +++EFL++++E EV+EL +L + P+++++F++NE+A A+RDI+ EYD + DME+ Y LK+ + + + ++ E+ R++ ++++ + ++R +L +LE +N+ LE+ ++ L ++ + R Y+ + L + + +++ AELQ LLD K L+ EI YRKMLEGEE RV + + + Q+ + DST +V+G++S KT+FQR+AKGNVTI EC P+GKF+ LEN+ + EN+ K+ R D GR ++++IP N ++ P G+N L I+A+ + PP S + E+ WG+G +VT L NK GEE+A+HTQ+T+
Sbjct: 46 RVLKMVTEMGSATVGGISPALSANAAKSFLEATDKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEMLRARFKQLTDEEKRVTADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRVGLTQMVEQAVKTHSL------QQQENTDST---------------------RSVRGEVSTKTTFQRSAKGNVTISECDPNGKFIKLENSHRNKDENVGEHKIRRKLD-GRREIVYSIPANVVIKP-GKN--LTIYARDQGGINNPPESLVFD-GENTWGIGANVVTSLVNKDGEERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|46576376|sp|P90901|IFA1_CAEEL (RecName: Full=Intermediate filament protein ifa-1; AltName: Full=Cel IF A1; AltName: Full=Intermediate filament protein A1; Short=IF-A1)

HSP 1 Score: 301.597 bits (771), Expect = 2.15316e-91
Identity = 193/566 (34.10%), Postives = 339/566 (59.89%), Query Frame = 2
Query:  179 EMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTG-GQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAK--GSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASHTQR 1864
EM+ G +P Q+ S++ + RE+E+ E+ +LNDR A+YI+KV+ LE +NR+L +L L+++WGK+T I++ Y+ ++ + +K +D + +E ++ +D L E +L + + D+ ID + LS+ E EI+ L+RR+ LEDE R +E RL E+ + + DLD+ETL+ I QN+VQ+L ++I+FL++++++E++EL +LA +D + E+++F++NE++ A+RDI+ EYD+ + ++DME+ Y LK+Q+ + ++ E +E+ +L+ QLS++R +L +LE+RN+ LE+ ++ L ++++ R Y+ + ++ + + +++ ELQ+LLD K +L+ EI YRKMLEGEE+R K + V ++ A + T+ VKG+ +++ SFQR+AKGNV+I E SPDGKF+VL+NT + E I +K+ R D G+ ++ +P + +L + LKI+A+ G P + AE ++G G + T+LFNK+GEE+A+H QR
Sbjct: 42 EMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQLVE---------------------------QVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRID-GKRENVYTLPRDFVLRA---GKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|17136290|ref|NP_476616.1| (lamin, isoform A [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.41007e-34
Identity = 160/566 (28.27%), Postives = 273/566 (48.23%), Query Frame = 2
Query:  224 SNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETI---------DKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNE----MAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXID--ERSRDYDMERAN-----LRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSK----PPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
S S +S + R E+ ELQ LNDR A YID+V++LE EN RLT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I L E EL N++ KE + ++L++ N+ + R++L +E + KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE +E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ + T K E+L R R+ L A NELE+ L I ER D D ER L KEL + ++ E Q L+D K+SL+LEI AY K+L GEE R+N A + + S + S + R +T +R ++ +A K V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + ++P G + +W+ +K PP S M+ + W T+L N +GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKR----LWEENEELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNST-------HKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTR-----ATPSR----RTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQK--WVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769141|ref|NP_001245892.1| (lamin, isoform B [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.41007e-34
Identity = 160/566 (28.27%), Postives = 273/566 (48.23%), Query Frame = 2
Query:  224 SNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETI---------DKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNE----MAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXID--ERSRDYDMERAN-----LRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSK----PPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
S S +S + R E+ ELQ LNDR A YID+V++LE EN RLT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I L E EL N++ KE + ++L++ N+ + R++L +E + KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE +E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ + T K E+L R R+ L A NELE+ L I ER D D ER L KEL + ++ E Q L+D K+SL+LEI AY K+L GEE R+N A + + S + S + R +T +R ++ +A K V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + ++P G + +W+ +K PP S M+ + W T+L N +GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKR----LWEENEELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNST-------HKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTR-----ATPSR----RTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQK--WVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769143|ref|NP_001245893.1| (lamin, isoform C [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.41007e-34
Identity = 160/566 (28.27%), Postives = 273/566 (48.23%), Query Frame = 2
Query:  224 SNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETI---------DKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNE----MAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXID--ERSRDYDMERAN-----LRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSK----PPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
S S +S + R E+ ELQ LNDR A YID+V++LE EN RLT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I L E EL N++ KE + ++L++ N+ + R++L +E + KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE +E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ + T K E+L R R+ L A NELE+ L I ER D D ER L KEL + ++ E Q L+D K+SL+LEI AY K+L GEE R+N A + + S + S + R +T +R ++ +A K V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + ++P G + +W+ +K PP S M+ + W T+L N +GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKR----LWEENEELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNST-------HKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTR-----ATPSR----RTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQK--WVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|665404412|ref|NP_001285629.1| (lamin, isoform D [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.41007e-34
Identity = 160/566 (28.27%), Postives = 273/566 (48.23%), Query Frame = 2
Query:  224 SNIVQSGVSSLMNGREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETI---------DKMNSQLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNE----MAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXID--ERSRDYDMERAN-----LRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNVGQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWAKGSK----PPGSDDMECAESNWGVGTLIVTMLFNKKGEEKA 1849
S S +S + R E+ ELQ LNDR A YID+V++LE EN RLT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I L E EL N++ KE + ++L++ N+ + R++L +E + KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE +E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ + T K E+L R R+ L A NELE+ L I ER D D ER L KEL + ++ E Q L+D K+SL+LEI AY K+L GEE R+N A + + S + S + R +T +R ++ +A K V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + ++P G + +W+ +K PP S M+ + W T+L N +GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKR----LWEENEELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNST-------HKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTR-----ATPSR----RTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQK--WVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|24653664|ref|NP_523742.2| (lamin C, isoform A [Drosophila melanogaster])

HSP 1 Score: 126.331 bits (316), Expect = 6.02805e-30
Identity = 153/592 (25.84%), Postives = 291/592 (49.16%), Query Frame = 2
Query:  170 RRIEM--KKSYGLNATP-GATSNIVQSGVSSLMN----GREKERHELQELNDRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKE-TIDKMNSQLSDYENEITSLRRRLT-GLEDEKIRDD--KEIS----RLKDEVAQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSE-----SKDFWRNEMAQALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNTKLKEQLSEMRNRLPELEAXXXXXXXXXXXXXXXIDERSRDYDMERANLRKELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVN-----QKXXXXXXXXXXXXXXXXXGQRMDFADSTITRTNV-GQSMAAXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTDNGRIVVIFAIPENTILDPTGQNRFLKIWA----KGSKPPGSDDMECAESNWGVGTLIVTMLFNKKGEEKASH 1855
RR+ + + S +TP G S + G +S + R++E+ ELQ LNDR A YID++++LE+EN RLT EL ++ +ET +K Y+ ++ RK LD K +LE+ I L E +L ++ KE T+ + N++L YEN + + L D K +D KE++ RL+ ++ L+K L+ ETL + +N+ QSLR+++ F +++ E+ E S + SE S+ + ++ Q+L++++ +Y+ ++ + ++E Y+ +IQ+ + ++ Q + E+ ++ ++ + +L LE N L + L +D + ++ A+L EL + ++ E Q L+D K+SL+LEI AY K+L GEE R+N + S + + + +++S+ R + R+ G S ++ + V + + ++ S AKG++ I E +G+F+ L N G + N++G+++ R + + F+ + + + IW+ PP + M + W V + ++L N E+ AS+
Sbjct: 4 RRVTLNTRVSRASTSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKR----LWEENDDLKP--RLDKKTKEATVAENNARL--YENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQY-EAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGAS-----VTIWSVDAGTAHDPPNNLVM---KKKWPVANSMRSVLANADKEDVASY 578
The following BLAST results are available for this feature:
BLAST of ifb vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|27436946|ref|NP_733821.1|1.075390e-4027.39lamin isoform A [Homo sapiens][more]
gi|544063468|ref|NP_001269555.1|1.652080e-4027.39lamin isoform A-delta50 [Homo sapiens][more]
gi|5031875|ref|NP_005563.1|1.694620e-4027.39lamin isoform C [Homo sapiens][more]
gi|544063466|ref|NP_001269554.1|1.694620e-4027.39lamin isoform C [Homo sapiens][more]
gi|27436948|ref|NP_733822.1|5.109710e-4027.24lamin isoform A-delta10 [Homo sapiens][more]
back to top
BLAST of ifb vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150119560.000000e+067.27SmedAsxldir_c69509_g1_i1|m.14946|m.134[more]
SMU150389479.138660e-16845.90dd_smedV4_3871_0_1|m.24747|m.30510[more]
SMU150132381.767520e-11435.53SmedAsxldir_c85434_g1_i1|m.24146|m.11304[more]
SMU150192741.038440e-7436.55SmedSxldir_c108927_g2_i1|m.81594|m.27374[more]
SMU150067301.814990e-7436.55SmedAsxldir_c108652_g1_i6|m.91472|m.48315[more]
back to top
BLAST of ifb vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|266617|sp|Q01241|NF70_DORPE6.863680e-13139.46RecName: Full=70 kDa neurofilament protein; Short=... [more]
gi|266616|sp|Q01240|NF60_DORPE5.233090e-10241.52RecName: Full=60 kDa neurofilament protein; Short=... [more]
gi|124235|sp|P23731|IFEB_ASCSU7.932020e-10033.66RecName: Full=Intermediate filament protein B; Sho... [more]
gi|46576384|sp|Q19289|IFB1_CAEEL5.374640e-9634.09RecName: Full=Intermediate filament protein ifb-1;... [more]
gi|46576376|sp|P90901|IFA1_CAEEL2.153160e-9134.10RecName: Full=Intermediate filament protein ifa-1;... [more]
back to top
BLAST of ifb vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136290|ref|NP_476616.1|1.410070e-3428.27lamin, isoform A [Drosophila melanogaster][more]
gi|386769141|ref|NP_001245892.1|1.410070e-3428.27lamin, isoform B [Drosophila melanogaster][more]
gi|386769143|ref|NP_001245893.1|1.410070e-3428.27lamin, isoform C [Drosophila melanogaster][more]
gi|665404412|ref|NP_001285629.1|1.410070e-3428.27lamin, isoform D [Drosophila melanogaster][more]
gi|24653664|ref|NP_523742.2|6.028050e-3025.84lamin C, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_011052 ID=Pgr_011052|Name=ifb|organism=Phagocata gracilis|type=mRNA|length=1999bp
AACCTCTTCAACCATCATAATGCAGTCATCCAGAACCGCTACTTCTACCA
ACGTCTACAAGACATCATCGTCAAATAATATTCAACCGATTTCTGGTCCT
AGAAATGTAGTCATCAACCGAACCGCTCCCAGTGTTCAGCAAACTGGTGG
AGCCGGAGTTACAAACATACGTCGAATAGAGATGAAAAAGAGCTACGGCC
TTAACGCAACCCCCGGAGCTACGTCCAATATTGTCCAGAGTGGCGTGAGT
AGTCTGATGAACGGACGAGAGAAAGAACGACATGAACTCCAGGAGTTGAA
TGATCGGTTTGCCAATTACATTGACAAAGTGAAGCATCTCGAGGACGAAA
ATAGACGACTCACTGACGAATTAACAGAACTAAAAAATCAATGGGGCAAA
GAGACGGAGAGAATCAAAGATCAATATGATAATGATATGAACAATCTAAG
AAAATCCTTAGACTCCGCAGAAGGTGCAAAGGTCCAGTTGGAGATGAGAA
TCAATTCGTTTGAAGATTTTCTTCAGGAGTCGGAAATAGAGTTGAGCGAA
GTGAATCAGATTCATAATGCGGATAAAGAAACCATTGACAAGATGAATTC
GCAACTGTCGGACTATGAAAATGAGATTACGAGTCTTCGAAGACGTTTAA
CCGGCTTGGAAGACGAAAAAATAAGAGACGACAAAGAAATTTCCCGTTTG
AAAGACGAAGTTGCTCAGTTGAAAAAGGATCTCGACAAAGAAACCCTTGA
TCATATTATGGCTCAAAATGAGGTTCAATCGTTACGAGACAAGATAGAGT
TCCTGAAGAAGATATATGAATCCGAGGTCAGAGAATTGACATCTTTGGCC
TACAAGGACCCCTCCGAGAGTAAGGACTTCTGGAGGAATGAAATGGCTCA
GGCGTTGCGGGACATTCAATCAGAATACGATCGCCGCATTGACTCAATAC
AACACGATATGGAGGCGCAATACAATCTTAAGATCCAGGACTATCGAATA
ACCCAGTCAAAGGACACCCAGGAGACAATTCAGTTGCGCGAAGACAACAC
CAAATTGAAGGAACAACTGTCGGAAATGCGTAACCGACTACCGGAACTAG
AAGCCAGGAACAACGAACTGGAAAGAATGCTGGAAATGTTACGACGAGAG
ATCGACGAAAGAAGTCGTGACTACGATATGGAAAGGGCAAATCTAAGAAA
GGAATTATCAAGTCGACAAGCACAACTTGAGAGCATTTTCGCTGAACTAC
AAATTTTGTTGGACGCTAAATTAAGTTTAGAATTAGAAATTGTGGCCTAC
CGGAAGATGCTCGAAGGCGAGGAGCACAGAGTCAATCAAAAGAATGCGAT
GTCATTAAATGCTATGTCATCCAACGCGATGTCATCCAGTAGTGGTCAAC
GAATGGATTTTGCAGACTCGACGATAACTCGTACAAACGTGGGTCAATCG
ATGGCTGCGGTCACAACAAGCAAAACCCAAGTGAGCAGCACTGTGAAAGG
TCAAATGTCTGCGAAGACTTCATTTCAAAGAACTGCAAAGGGAAATGTGA
CAATTCAGGAGTGTTCCCCAGATGGGAAGTTTGTCGTACTTGAGAATACA
GGAGGACAGCCAGAAAATATTTCCGGATTCAAAGTTAACAGAAACACTGA
TAACGGAAGAATCGTCGTAATATTCGCTATTCCGGAGAACACAATATTGG
ACCCTACCGGACAAAATCGATTCCTCAAGATATGGGCTAAAGGGTCTAAG
CCACCAGGTTCCGATGACATGGAGTGCGCCGAGTCAAACTGGGGTGTCGG
AACATTGATTGTTACAATGTTGTTCAATAAAAAAGGCGAAGAAAAAGCTT
CTCATACCCAGAGGACAGTTTACCAGATGTAAGCGAAATATATACTCCGA
AAAAAAAAACACTTGGACTCCAGTAATTAAATAATTCTTCTAGATTCTTA
TATTGATGGTGTTTCTTTATTAAATATAATTAAATTATTTCAAAAAAAA

Design Primers for ifb

back to top

protein sequence

>Pgr_011052-protein ID=Pgr_011052-protein|Name=ifb|organism=Phagocata gracilis|type=polypeptide|length=627bp
TSSTIIMQSSRTATSTNVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGG
AGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELN
DRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLR
KSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNS
QLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLD
HIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQ
ALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNT
KLKEQLSEMRNRLPELEARNNELERMLEMLRREIDERSRDYDMERANLRK
ELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKNAM
SLNAMSSNAMSSSSGQRMDFADSTITRTNVGQSMAAVTTSKTQVSSTVKG
QMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTD
NGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVG
TLIVTMLFNKKGEEKASHTQRTVYQM*
back to top

coding sequence

>Pgr_011052.2.1882 ID=Pgr_011052.2.1882|Name=Pgr_011052.2.1882|organism=Phagocata gracilis|type=CDS|length=1881bp
ACCTCTTCAACCATCATAATGCAGTCATCCAGAACCGCTACTTCTACCAA
CGTCTACAAGACATCATCGTCAAATAATATTCAACCGATTTCTGGTCCTA
GAAATGTAGTCATCAACCGAACCGCTCCCAGTGTTCAGCAAACTGGTGGA
GCCGGAGTTACAAACATACGTCGAATAGAGATGAAAAAGAGCTACGGCCT
TAACGCAACCCCCGGAGCTACGTCCAATATTGTCCAGAGTGGCGTGAGTA
GTCTGATGAACGGACGAGAGAAAGAACGACATGAACTCCAGGAGTTGAAT
GATCGGTTTGCCAATTACATTGACAAAGTGAAGCATCTCGAGGACGAAAA
TAGACGACTCACTGACGAATTAACAGAACTAAAAAATCAATGGGGCAAAG
AGACGGAGAGAATCAAAGATCAATATGATAATGATATGAACAATCTAAGA
AAATCCTTAGACTCCGCAGAAGGTGCAAAGGTCCAGTTGGAGATGAGAAT
CAATTCGTTTGAAGATTTTCTTCAGGAGTCGGAAATAGAGTTGAGCGAAG
TGAATCAGATTCATAATGCGGATAAAGAAACCATTGACAAGATGAATTCG
CAACTGTCGGACTATGAAAATGAGATTACGAGTCTTCGAAGACGTTTAAC
CGGCTTGGAAGACGAAAAAATAAGAGACGACAAAGAAATTTCCCGTTTGA
AAGACGAAGTTGCTCAGTTGAAAAAGGATCTCGACAAAGAAACCCTTGAT
CATATTATGGCTCAAAATGAGGTTCAATCGTTACGAGACAAGATAGAGTT
CCTGAAGAAGATATATGAATCCGAGGTCAGAGAATTGACATCTTTGGCCT
ACAAGGACCCCTCCGAGAGTAAGGACTTCTGGAGGAATGAAATGGCTCAG
GCGTTGCGGGACATTCAATCAGAATACGATCGCCGCATTGACTCAATACA
ACACGATATGGAGGCGCAATACAATCTTAAGATCCAGGACTATCGAATAA
CCCAGTCAAAGGACACCCAGGAGACAATTCAGTTGCGCGAAGACAACACC
AAATTGAAGGAACAACTGTCGGAAATGCGTAACCGACTACCGGAACTAGA
AGCCAGGAACAACGAACTGGAAAGAATGCTGGAAATGTTACGACGAGAGA
TCGACGAAAGAAGTCGTGACTACGATATGGAAAGGGCAAATCTAAGAAAG
GAATTATCAAGTCGACAAGCACAACTTGAGAGCATTTTCGCTGAACTACA
AATTTTGTTGGACGCTAAATTAAGTTTAGAATTAGAAATTGTGGCCTACC
GGAAGATGCTCGAAGGCGAGGAGCACAGAGTCAATCAAAAGAATGCGATG
TCATTAAATGCTATGTCATCCAACGCGATGTCATCCAGTAGTGGTCAACG
AATGGATTTTGCAGACTCGACGATAACTCGTACAAACGTGGGTCAATCGA
TGGCTGCGGTCACAACAAGCAAAACCCAAGTGAGCAGCACTGTGAAAGGT
CAAATGTCTGCGAAGACTTCATTTCAAAGAACTGCAAAGGGAAATGTGAC
AATTCAGGAGTGTTCCCCAGATGGGAAGTTTGTCGTACTTGAGAATACAG
GAGGACAGCCAGAAAATATTTCCGGATTCAAAGTTAACAGAAACACTGAT
AACGGAAGAATCGTCGTAATATTCGCTATTCCGGAGAACACAATATTGGA
CCCTACCGGACAAAATCGATTCCTCAAGATATGGGCTAAAGGGTCTAAGC
CACCAGGTTCCGATGACATGGAGTGCGCCGAGTCAAACTGGGGTGTCGGA
ACATTGATTGTTACAATGTTGTTCAATAAAAAAGGCGAAGAAAAAGCTTC
TCATACCCAGAGGACAGTTTACCAGATGTAA
back to top
Gene Groups
ifb is similar in sequence to the genes of this group: GG6276
Gene NameGene ID
SMU15011956SMU15011956
ifbDdo_001875
ifbGsp_021856
ifbPgr_011052
ifbPmo_026655

Gene Group Protein Sequences

>SMU15011956

MLTSKTTTSKTNYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSN
IRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFAN
YIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQ
AEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDY
EHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAH
NELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDI
QTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQ
LAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNR
KAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQT
GRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNV
TIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTIL
EPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKA
THTQRTVYQL*
>Ddo_001875 ifb
PIYSEYIKSLSLYTNLIMQTSKTTSSKTTYSVLAQSNIQPISGPRNVVIT
RTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGR
EKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIK
ALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHI
SDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQ
LKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASD
SKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES
AETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHR
EFESEKIHLRKELMNRQAELENIVLELQLLLDAKLSLELEIAAYRKMLEG
EEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGE
MSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDN
GRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGA
QILTTLQNSKGEEKATHTQRTVYQM*
>Gsp_021856 ifb
TTSKTNFKTTTNTANIQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEM
KKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVR
SLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKA
QLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGN
LRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSL
LDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDK
KMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRN
RLPELEARNSELERLLELLRREIEEKNREFDMEKANLRKELMNRQSELES
ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGR
NVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTI
QECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEP
TGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATH
TQRTVYQL*
>Pgr_011052 ifb
TSSTIIMQSSRTATSTNVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGG
AGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELN
DRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLR
KSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNS
QLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLD
HIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQ
ALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNT
KLKEQLSEMRNRLPELEARNNELERMLEMLRREIDERSRDYDMERANLRK
ELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKNAM
SLNAMSSNAMSSSSGQRMDFADSTITRTNVGQSMAAVTTSKTQVSSTVKG
QMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTD
NGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVG
TLIVTMLFNKKGEEKASHTQRTVYQM*
>Pmo_026655 ifb
MQSSRTVTSTNVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNV
RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANY
IDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSA
EGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYE
NEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQN
EVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQ
SEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQL
SDMRNRLPELEAKNNELEKMLEMLRREMDERNREYDLERANLRKELANQQ
AHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGR
RADATDSMVTRTVAGQSMAAVTTSKTQVVSSTVKGQMSAKTSFQRTAKGN
VTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTI
LEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEK
ASHTQRTVYQM*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.