collagen, Pgr_010667 (mRNA) Phagocata gracilis

Overview
Namecollagen
Unique NamePgr_010667
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length8550
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of collagen vs. RefSeq Human
Match: gi|767973253|ref|XP_011536237.1| (PREDICTED: collagen alpha-1(II) chain isoform X3 [Homo sapiens])

HSP 1 Score: 107.457 bits (267), Expect = 5.23124e-22
Identity = 67/221 (30.32%), Postives = 105/221 (47.51%), Query Frame = 2
Query: 7778 AIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSV--NGHSWIQALTMNNEVQYS------IPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P P K W SS H W T+N +S PN+ Q++FL+ S Q +T+ C N I ++ + L+ ++D + + + YT + D C +T+IE S S PI D+ I +FG+ VCF
Sbjct: 964 SIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWF-GETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNS-IAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1182

HSP 2 Score: 107.457 bits (267), Expect = 5.23124e-22
Identity = 67/221 (30.32%), Postives = 105/221 (47.51%), Query Frame = -2
Query:  153 AIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSV--NGHSWIQALTMNNEVQYS------IPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 773
+I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P P K W SS H W T+N +S PN+ Q++FL+ S Q +T+ C N I ++ + L+ ++D + + + YT + D C +T+IE S S PI D+ I +FG+ VCF
Sbjct: 964 SIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWF-GETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNS-IAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1182

HSP 3 Score: 53.9138 bits (128), Expect = 8.53359e-06
Identity = 46/98 (46.94%), Postives = 58/98 (59.18%), Query Frame = 2
Query: 5867 GPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGS 6160
GP GA+G +G PG G PG GP G PPG KG G++G G+ G GP G G+ G VG+PG G+RG+PG PG +G+PGK GA G+
Sbjct: 623 GPKGARGDSGPPGRAGEPGLQGPAG---PPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPG---------LPGPSGEPGKQGAPGA 708

HSP 4 Score: 53.9138 bits (128), Expect = 8.53359e-06
Identity = 46/98 (46.94%), Postives = 58/98 (59.18%), Query Frame = -2
Query: 2391 GPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGS 2684
GP GA+G +G PG G PG GP G PPG KG G++G G+ G GP G G+ G VG+PG G+RG+PG PG +G+PGK GA G+
Sbjct: 623 GPKGARGDSGPPGRAGEPGLQGPAG---PPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPG---------LPGPSGEPGKQGAPGA 708
BLAST of collagen vs. RefSeq Human
Match: gi|4502951|ref|NP_000081.1| (collagen alpha-1(III) chain preproprotein [Homo sapiens])

HSP 1 Score: 105.145 bits (261), Expect = 2.95545e-21
Identity = 69/222 (31.08%), Postives = 106/222 (47.75%), Query Frame = 2
Query: 7787 NPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCI--RPINGETPLKTW--PSSSVNGHSWIQALTMNNEVQYSIPNS---------QLSFLKAYSDSAIQRVTFSCDNHPIIGIN---GKINKVTSPRLLADDDSVMRI-NHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+P G++ PA+ C+ L +P GEYW+DPN G DA+KVFC + +TCI P+N P K W SS+ H W +M+ Q+S N QL+FL+ S A Q +T+ C N I ++ G + K +L+ ++ + + K YTV+ D C ++T+ E + A PI D+ I + +FG+ VCF
Sbjct: 1250 SPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLN--VPRKHWWTDSSAEKKHVWF-GESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNS-IAYMDQASGNVKKAL--KLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCF 1465

HSP 2 Score: 105.145 bits (261), Expect = 2.95545e-21
Identity = 69/222 (31.08%), Postives = 106/222 (47.75%), Query Frame = -2
Query:  153 NPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCI--RPINGETPLKTW--PSSSVNGHSWIQALTMNNEVQYSIPNS---------QLSFLKAYSDSAIQRVTFSCDNHPIIGIN---GKINKVTSPRLLADDDSVMRI-NHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 764
+P G++ PA+ C+ L +P GEYW+DPN G DA+KVFC + +TCI P+N P K W SS+ H W +M+ Q+S N QL+FL+ S A Q +T+ C N I ++ G + K +L+ ++ + + K YTV+ D C ++T+ E + A PI D+ I + +FG+ VCF
Sbjct: 1250 SPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLN--VPRKHWWTDSSAEKKHVWF-GESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNS-IAYMDQASGNVKKAL--KLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCF 1465

HSP 3 Score: 65.855 bits (159), Expect = 2.31407e-09
Identity = 89/206 (43.20%), Postives = 100/206 (48.54%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRG---PPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRG------------------------YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
GKDG+ G+ G G RG PPG GP G G G G RG G NG G+ G PGLKG +G G G+PG GP G G+ G G+PGAAG RG PG G G G+PGSNG PG+ G G G GA GP G G +G G +G G GI G PG G G GP G G PG G GE
Sbjct: 228 GKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGE 433

HSP 4 Score: 65.855 bits (159), Expect = 2.31407e-09
Identity = 89/206 (43.20%), Postives = 100/206 (48.54%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRG---PPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRG------------------------YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
GKDG+ G+ G G RG PPG GP G G G G RG G NG G+ G PGLKG +G G G+PG GP G G+ G G+PGAAG RG PG G G G+PGSNG PG+ G G G GA GP G G +G G +G G GI G PG G G GP G G PG G GE
Sbjct: 228 GKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGE 433
BLAST of collagen vs. RefSeq Human
Match: gi|767902460|ref|XP_011539023.1| (PREDICTED: collagen alpha-1(XI) chain isoform X3 [Homo sapiens])

HSP 1 Score: 103.99 bits (258), Expect = 4.65231e-21
Identity = 74/220 (33.64%), Postives = 103/220 (46.82%), Query Frame = 2
Query: 7781 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKI-SAQQTCIRPINGETPLK--TWPSSSVNGHSWIQALTMNNEVQY------SIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG----INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDA-SLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+K P GT+ PA+TCK L +S+P+ PDGEYWIDPN G D+ KV+C S +TCI P ++ +WP SW + Y SI Q++FLK + SA Q T+ C H +G +K R L +D M ++ T+ D C K E +T+IE++ PI DV + N KFG + VCF
Sbjct: 789 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPG--SWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHC--HQSAAWYDVSSGSYDKAL--RFLGSNDEEMSYDNNPFIKTLY-DGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1000

HSP 2 Score: 103.99 bits (258), Expect = 4.65231e-21
Identity = 74/220 (33.64%), Postives = 103/220 (46.82%), Query Frame = -2
Query:  153 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKI-SAQQTCIRPINGETPLK--TWPSSSVNGHSWIQALTMNNEVQY------SIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG----INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDA-SLFPIRDVGVTIISKSNSKFGLKFEEVCF 770
+K P GT+ PA+TCK L +S+P+ PDGEYWIDPN G D+ KV+C S +TCI P ++ +WP SW + Y SI Q++FLK + SA Q T+ C H +G +K R L +D M ++ T+ D C K E +T+IE++ PI DV + N KFG + VCF
Sbjct: 789 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPG--SWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHC--HQSAAWYDVSSGSYDKAL--RFLGSNDEEMSYDNNPFIKTLY-DGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1000

HSP 3 Score: 55.8398 bits (133), Expect = 2.13992e-06
Identity = 57/115 (49.57%), Postives = 64/115 (55.65%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSP---GLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 6139
G+ G+ G G AG GPPG+ GP G +G G P GLRGIP GPVG+QG PG G DG G G PG G G+ G G G PG G G PGE G G G PG+ G PG
Sbjct: 568 GRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIP---GPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPG 679

HSP 4 Score: 55.8398 bits (133), Expect = 2.13992e-06
Identity = 57/115 (49.57%), Postives = 64/115 (55.65%), Query Frame = -2
Query: 2412 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSP---GLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 2747
G+ G+ G G AG GPPG+ GP G +G G P GLRGIP GPVG+QG PG G DG G G PG G G+ G G G PG G G PGE G G G PG+ G PG
Sbjct: 568 GRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIP---GPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPG 679
BLAST of collagen vs. RefSeq Human
Match: gi|299523257|ref|NP_001177638.1| (collagen alpha-1(XI) chain isoform E preproprotein [Homo sapiens])

HSP 1 Score: 104.375 bits (259), Expect = 5.02253e-21
Identity = 73/218 (33.49%), Postives = 102/218 (46.79%), Query Frame = 2
Query: 7781 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKI-SAQQTCIRPINGETPLK--TWPSSSVNGHSWIQALTMNNEVQY------SIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG--INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDA-SLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+K P GT+ PA+TCK L +S+P+ PDGEYWIDPN G D+ KV+C S +TCI P ++ +WP SW + Y SI Q++FLK + SA Q T+ C +G +K R L +D M ++ T+ D C K E +T+IE++ PI DV + N KFG + VCF
Sbjct: 1554 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPG--SWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKAL--RFLGSNDEEMSYDNNPFIKTLY-DGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1765

HSP 2 Score: 104.375 bits (259), Expect = 5.02253e-21
Identity = 73/218 (33.49%), Postives = 102/218 (46.79%), Query Frame = -2
Query:  153 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKI-SAQQTCIRPINGETPLK--TWPSSSVNGHSWIQALTMNNEVQY------SIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG--INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDA-SLFPIRDVGVTIISKSNSKFGLKFEEVCF 770
+K P GT+ PA+TCK L +S+P+ PDGEYWIDPN G D+ KV+C S +TCI P ++ +WP SW + Y SI Q++FLK + SA Q T+ C +G +K R L +D M ++ T+ D C K E +T+IE++ PI DV + N KFG + VCF
Sbjct: 1554 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPG--SWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKAL--RFLGSNDEEMSYDNNPFIKTLY-DGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1765

HSP 3 Score: 60.4622 bits (145), Expect = 1.16827e-07
Identity = 65/160 (40.62%), Postives = 79/160 (49.38%), Query Frame = 2
Query: 5882 KGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE------VGKLGPVGIPGAAGQRGYPGELGVHGKNGAPG------SNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPS 6325
+G G+ G+RG+ G G G+ G PG KG+ G +G +G G GP GE G+ GP G PG +GQ G G+LGV G G PG S G PG PGA+G G ARGV G+ G G G GP G+ G G GKPGP
Sbjct: 723 RGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKG------------------ARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 864

HSP 4 Score: 60.4622 bits (145), Expect = 1.16827e-07
Identity = 65/160 (40.62%), Postives = 79/160 (49.38%), Query Frame = -2
Query: 2226 KGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE------VGKLGPVGIPGAAGQRGYPGELGVHGKNGAPG------SNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPS 2669
+G G+ G+RG+ G G G+ G PG KG+ G +G +G G GP GE G+ GP G PG +GQ G G+LGV G G PG S G PG PGA+G G ARGV G+ G G G GP G+ G G GKPGP
Sbjct: 723 RGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKG------------------ARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 864

HSP 5 Score: 55.8398 bits (133), Expect = 2.61886e-06
Identity = 57/115 (49.57%), Postives = 64/115 (55.65%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSP---GLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 6139
G+ G+ G G AG GPPG+ GP G +G G P GLRGIP GPVG+QG PG G DG G G PG G G+ G G G PG G G PGE G G G PG+ G PG
Sbjct: 1333 GRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIP---GPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPG 1444

HSP 6 Score: 55.8398 bits (133), Expect = 2.61886e-06
Identity = 57/115 (49.57%), Postives = 64/115 (55.65%), Query Frame = -2
Query: 2412 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSP---GLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 2747
G+ G+ G G AG GPPG+ GP G +G G P GLRGIP GPVG+QG PG G DG G G PG G G+ G G G PG G G PGE G G G PG+ G PG
Sbjct: 1333 GRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIP---GPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPG 1444
BLAST of collagen vs. RefSeq Human
Match: gi|299523253|ref|NP_542197.3| (collagen alpha-1(XI) chain isoform C preproprotein [Homo sapiens])

HSP 1 Score: 104.375 bits (259), Expect = 5.24166e-21
Identity = 73/218 (33.49%), Postives = 102/218 (46.79%), Query Frame = 2
Query: 7781 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKI-SAQQTCIRPINGETPLK--TWPSSSVNGHSWIQALTMNNEVQY------SIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG--INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDA-SLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+K P GT+ PA+TCK L +S+P+ PDGEYWIDPN G D+ KV+C S +TCI P ++ +WP SW + Y SI Q++FLK + SA Q T+ C +G +K R L +D M ++ T+ D C K E +T+IE++ PI DV + N KFG + VCF
Sbjct: 1477 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPG--SWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKAL--RFLGSNDEEMSYDNNPFIKTLY-DGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1688

HSP 2 Score: 104.375 bits (259), Expect = 5.24166e-21
Identity = 73/218 (33.49%), Postives = 102/218 (46.79%), Query Frame = -2
Query:  153 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKI-SAQQTCIRPINGETPLK--TWPSSSVNGHSWIQALTMNNEVQY------SIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG--INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDA-SLFPIRDVGVTIISKSNSKFGLKFEEVCF 770
+K P GT+ PA+TCK L +S+P+ PDGEYWIDPN G D+ KV+C S +TCI P ++ +WP SW + Y SI Q++FLK + SA Q T+ C +G +K R L +D M ++ T+ D C K E +T+IE++ PI DV + N KFG + VCF
Sbjct: 1477 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPG--SWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKAL--RFLGSNDEEMSYDNNPFIKTLY-DGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1688

HSP 3 Score: 60.4622 bits (145), Expect = 1.02226e-07
Identity = 65/160 (40.62%), Postives = 79/160 (49.38%), Query Frame = 2
Query: 5882 KGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE------VGKLGPVGIPGAAGQRGYPGELGVHGKNGAPG------SNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPS 6325
+G G+ G+RG+ G G G+ G PG KG+ G +G +G G GP GE G+ GP G PG +GQ G G+LGV G G PG S G PG PGA+G G ARGV G+ G G G GP G+ G G GKPGP
Sbjct: 646 RGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKG------------------ARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 787

HSP 4 Score: 60.4622 bits (145), Expect = 1.02226e-07
Identity = 65/160 (40.62%), Postives = 79/160 (49.38%), Query Frame = -2
Query: 2226 KGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE------VGKLGPVGIPGAAGQRGYPGELGVHGKNGAPG------SNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPS 2669
+G G+ G+RG+ G G G+ G PG KG+ G +G +G G GP GE G+ GP G PG +GQ G G+LGV G G PG S G PG PGA+G G ARGV G+ G G G GP G+ G G GKPGP
Sbjct: 646 RGVKGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKG------------------ARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 787

HSP 5 Score: 55.8398 bits (133), Expect = 2.43232e-06
Identity = 57/115 (49.57%), Postives = 64/115 (55.65%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSP---GLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 6139
G+ G+ G G AG GPPG+ GP G +G G P GLRGIP GPVG+QG PG G DG G G PG G G+ G G G PG G G PGE G G G PG+ G PG
Sbjct: 1256 GRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIP---GPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPG 1367

HSP 6 Score: 55.8398 bits (133), Expect = 2.43232e-06
Identity = 57/115 (49.57%), Postives = 64/115 (55.65%), Query Frame = -2
Query: 2412 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSP---GLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 2747
G+ G+ G G AG GPPG+ GP G +G G P GLRGIP GPVG+QG PG G DG G G PG G G+ G G G PG G G PGE G G G PG+ G PG
Sbjct: 1256 GRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIP---GPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPG 1367

HSP 7 Score: 53.9138 bits (128), Expect = 9.57428e-06
Identity = 52/114 (45.61%), Postives = 59/114 (51.75%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 6139
++G GD G+ G G RG G GP G G TG PG G G+ G +G G PG G G +G G PGF G +GE G G G PG GQR G G G GA G GKPG
Sbjct: 675 DMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQR---GPTGPRGSRGARGPTGKPG 785

HSP 8 Score: 53.9138 bits (128), Expect = 9.57428e-06
Identity = 52/114 (45.61%), Postives = 59/114 (51.75%), Query Frame = -2
Query: 2412 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPG 2753
++G GD G+ G G RG G GP G G TG PG G G+ G +G G PG G G +G G PGF G +GE G G G PG GQR G G G GA G GKPG
Sbjct: 675 DMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQR---GPTGPRGSRGARGPTGKPG 785
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15040033 (dd_smedV4_702_0_1|m.35199|m.6295)

HSP 1 Score: 360.918 bits (925), Expect = 1.70343e-101
Identity = 156/237 (65.82%), Postives = 197/237 (83.12%), Query Frame = 2
Query: 7694 VMAMQMRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS* 8404
+MAMQMRSPTKG+ YGDD A+LLG NAIKNP+GTK++PA TCK LSV +PN PDGEYWIDPN GR++DAVKV+C+IS Q+TCI+PIN E L++W S S NGH+W++++ E+QYSIPN Q++FLK SDSA+QRVTF+C+NHPIIG K+NKVT+PRLLADDD+++++ H LKYTVI D+CQY K+SEAE+IIEV N A+L PIRD+GV+II+ SKFG+ EEVCFS*
Sbjct: 1050 IMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS* 1286

HSP 2 Score: 360.918 bits (925), Expect = 1.70343e-101
Identity = 156/237 (65.82%), Postives = 197/237 (83.12%), Query Frame = -2
Query:  147 VMAMQMRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS* 857
+MAMQMRSPTKG+ YGDD A+LLG NAIKNP+GTK++PA TCK LSV +PN PDGEYWIDPN GR++DAVKV+C+IS Q+TCI+PIN E L++W S S NGH+W++++ E+QYSIPN Q++FLK SDSA+QRVTF+C+NHPIIG K+NKVT+PRLLADDD+++++ H LKYTVI D+CQY K+SEAE+IIEV N A+L PIRD+GV+II+ SKFG+ EEVCFS*
Sbjct: 1050 IMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS* 1286

HSP 3 Score: 139.428 bits (350), Expect = 1.61022e-32
Identity = 216/343 (62.97%), Postives = 242/343 (70.55%), Query Frame = 2
Query: 4547 MLTNTFLIGVFLGILSSTEFVSGQFKSLQEAVGPPGIRXXXXXXXXXXXXXXXXXXXXXXFMGKDGFRXXXXXXXXXXXXXTDGKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXXDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGT 5575
M N+ G L IL +F GQF++L EA GP GIRGNPG +GK GPDGD G++GP G GKDG RG PGP GPAG G DGK+G G TG PGSRGE G G +G+EG+ GP GY G G+KGD G GEQGD G IGP GP GP GP GQ GPTG QG G RG GPDG VGPPGP+GRMGS G PG PGE+G KGE G EG KGGKG GK G+N K GK G G G G +G+QGR+G G+IG+TG QG G RG RG +GNPG+ GPKGS+GDQGPIG+EGKPG GP GQKGDRGRPG G+ GP GP G +G G KG RGEIGPNG PGT
Sbjct: 1 MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLGPPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKKGEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGT 343

HSP 4 Score: 139.428 bits (350), Expect = 1.61022e-32
Identity = 216/343 (62.97%), Postives = 242/343 (70.55%), Query Frame = -2
Query: 2976 MLTNTFLIGVFLGILSSTEFVSGQFKSLQEAVGPPGIRXXXXXXXXXXXXXXXXXXXXXGFMGKDGFRXXXXXXXXXXXXGTDGKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGT 4004
M N+ G L IL +F GQF++L EA GP GIRGNPG +GK GPDGD G++GP G GKDG RG PGP GPAG G DGK+G G TG PGSRGE G G +G+EG+ GP GY G G+KGD G GEQGD G IGP GP GP GP GQ GPTG QG G RG GPDG VGPPGP+GRMGS G PG PGE+G KGE G EG KGGKG GK G+N K GK G G G G +G+QGR+G G+IG+TG QG G RG RG +GNPG+ GPKGS+GDQGPIG+EGKPG GP GQKGDRGRPG G+ GP GP G +G G KG RGEIGPNG PGT
Sbjct: 1 MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLGPPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKKGEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGT 343

HSP 5 Score: 78.9518 bits (193), Expect = 4.54912e-14
Identity = 96/177 (54.24%), Postives = 111/177 (62.71%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 6328
N GKDG +G G G+RGPPG +G G KG G PG +G G+ G G G G+ G++G G GSPGF GP+G+ G GP G G AG GYPG G+ GKNG PG GKPGK G GS GK G PGP GD G+ GP G G+ G GI GVPG+YGPNG+ G G LGK GP G
Sbjct: 418 NPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEG 594

HSP 6 Score: 78.9518 bits (193), Expect = 4.54912e-14
Identity = 96/177 (54.24%), Postives = 111/177 (62.71%), Query Frame = -2
Query: 2223 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 2753
N GKDG +G G G+RGPPG +G G KG G PG +G G+ G G G G+ G++G G GSPGF GP+G+ G GP G G AG GYPG G+ GKNG PG GKPGK G GS GK G PGP GD G+ GP G G+ G GI GVPG+YGPNG+ G G LGK GP G
Sbjct: 418 NPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEG 594

HSP 7 Score: 54.299 bits (129), Expect = 1.21823e-06
Identity = 80/203 (39.41%), Postives = 94/203 (46.31%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPG------------------------ELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
GK G GKSG GIRGP G +G +G +G+ G G G+ G G +G +G G GN G+ G +GS G GP G GK GP G G G RG PG E+G +G G PG NGKPG G G+ G G G GQ G +G P GPNGA GP G +G GP GK G
Sbjct: 216 GKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKPGATGPPGTPGHPGNA---------------GPGGQAGPIGRP---GPNGAPGPRGEIGPNGPDGKSGR 400

HSP 8 Score: 54.299 bits (129), Expect = 1.21823e-06
Identity = 80/203 (39.41%), Postives = 94/203 (46.31%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPG------------------------ELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
GK G GKSG GIRGP G +G +G +G+ G G G+ G G +G +G G GN G+ G +GS G GP G GK GP G G G RG PG E+G +G G PG NGKPG G G+ G G G GQ G +G P GPNGA GP G +G GP GK G
Sbjct: 216 GKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKPGATGPPGTPGHPGNA---------------GPGGQAGPIGRP---GPNGAPGPRGEIGPNGPDGKSGR 400
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15002271 (Asxlregen_comp67208_c0_seq1|m.27270|m.10319)

HSP 1 Score: 227.639 bits (579), Expect = 1.51898e-59
Identity = 112/234 (47.86%), Postives = 154/234 (65.81%), Query Frame = 2
Query: 7709 MRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPII-GINGKINKV-TSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS* 8404
+RSPTKG+ + DD A G NAI P+GTK++PA++CKHLS P+ DGEYWIDPN GR+ DAV V+C+I+ QQTCI+PI+ +W H W Q + E +Y I N QL++LKA S++A Q+++ +C N II GK++ V TS LL DDD+++ + H K ++ VI D+CQY K SEAETI+EV AS PI+DVG+ I S + K G++ EVC+S*
Sbjct: 1064 LRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWTS--LLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS* 1295

HSP 2 Score: 227.639 bits (579), Expect = 1.51898e-59
Identity = 112/234 (47.86%), Postives = 154/234 (65.81%), Query Frame = -2
Query:  147 MRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPII-GINGKINKV-TSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS* 842
+RSPTKG+ + DD A G NAI P+GTK++PA++CKHLS P+ DGEYWIDPN GR+ DAV V+C+I+ QQTCI+PI+ +W H W Q + E +Y I N QL++LKA S++A Q+++ +C N II GK++ V TS LL DDD+++ + H K ++ VI D+CQY K SEAETI+EV AS PI+DVG+ I S + K G++ EVC+S*
Sbjct: 1064 LRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWTS--LLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS* 1295

HSP 3 Score: 104.375 bits (259), Expect = 7.38621e-22
Identity = 157/281 (55.87%), Postives = 176/281 (62.63%), Query Frame = 2
Query: 4733 GKDGFRXXXXXXXXXXXXXTDGKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXXDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGT 5575
G+DG RG G G +G PG DG G+ GV G G RGEPGL G +G EG GP G GL GDKGD GL G +G G G GP G +GP G+ GP G QG TG RG G DG G GPQG +G G G PGE+GNKG +G G KG KG G PGL K G G G G PG DG+ G RG G +G G G GQRG RG GNPG GPKGS+G++GPIG+EGK G+ GP GQKGD GRPG+ GD GP G GVVG G KG RGE GP+G PG
Sbjct: 70 GRDGARGKSGKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGN 350

HSP 4 Score: 104.375 bits (259), Expect = 7.38621e-22
Identity = 157/281 (55.87%), Postives = 176/281 (62.63%), Query Frame = -2
Query: 2976 GKDGFRXXXXXXXXXXXXGTDGKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGT 3818
G+DG RG G G +G PG DG G+ GV G G RGEPGL G +G EG GP G GL GDKGD GL G +G G G GP G +GP G+ GP G QG TG RG G DG G GPQG +G G G PGE+GNKG +G G KG KG G PGL K G G G G PG DG+ G RG G +G G G GQRG RG GNPG GPKGS+G++GPIG+EGK G+ GP GQKGD GRPG+ GD GP G GVVG G KG RGE GP+G PG
Sbjct: 70 GRDGARGKSGKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGN 350

HSP 5 Score: 69.3218 bits (168), Expect = 4.0286e-11
Identity = 77/189 (40.74%), Postives = 94/189 (49.74%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKL------GPVGIPGAAGQRGYPGE---LGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G+ G G+ G GIRG E G GAKG +G+PGL G GP G GPPG G DG G +G G GP G VGK+ GP G PG +G +G GE +G+ GK G+ G G+ G PG G G G G+ G++G G+ G G SGPDG G PG G PG+D
Sbjct: 196 GQSGIPGEIGNKGIRG---ESGIKGAKGDSGNPGLAG---KTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGD------------------EGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKD 360

HSP 6 Score: 69.3218 bits (168), Expect = 4.0286e-11
Identity = 77/189 (40.74%), Postives = 94/189 (49.74%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKL------GPVGIPGAAGQRGYPGE---LGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
G+ G G+ G GIRG E G GAKG +G+PGL G GP G GPPG G DG G +G G GP G VGK+ GP G PG +G +G GE +G+ GK G+ G G+ G PG G G G G+ G++G G+ G G SGPDG G PG G PG+D
Sbjct: 196 GQSGIPGEIGNKGIRG---ESGIKGAKGDSGNPGLAG---KTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGD------------------EGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKD 360

HSP 7 Score: 68.1662 bits (165), Expect = 8.8195e-11
Identity = 75/185 (40.54%), Postives = 94/185 (50.81%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGP---PGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSG---EVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G G +GK G G RGP PG GP G++G+ G G+ G G GP G++G PG G G+EG +G G GP+G G+ GP G PG G G PG+ G+HG G+ G G G PGA G +G GA G G+ G+ G G G GA GP G +G PG G PG
Sbjct: 258 VGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLG---------------LNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPG 427

HSP 8 Score: 68.1662 bits (165), Expect = 8.8195e-11
Identity = 75/185 (40.54%), Postives = 94/185 (50.81%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGP---PGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSG---EVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G G +GK G G RGP PG GP G++G+ G G+ G G GP G++G PG G G+EG +G G GP+G G+ GP G PG G G PG+ G+HG G+ G G G PGA G +G GA G G+ G+ G G G GA GP G +G PG G PG
Sbjct: 258 VGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLG---------------LNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPG 427

HSP 9 Score: 66.2402 bits (160), Expect = 3.04294e-10
Identity = 77/179 (43.02%), Postives = 97/179 (54.19%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G G+ G SGP G +G G +G +G +G G G +G PG G G +GP G +G G G +GS G +GP G G G GIPG G G PG G G G+PG+ GK G GA G G+ G G +G G G +G +G G G+ G+PG+ G G GP GI G GP G PG+
Sbjct: 274 GPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGD 452

HSP 10 Score: 66.2402 bits (160), Expect = 3.04294e-10
Identity = 77/179 (43.02%), Postives = 97/179 (54.19%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
G G+ G SGP G +G G +G +G +G G G +G PG G G +GP G +G G G +GS G +GP G G G GIPG G G PG G G G+PG+ GK G GA G G+ G G +G G G +G +G G G+ G+PG+ G G GP GI G GP G PG+
Sbjct: 274 GPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGD 452

HSP 11 Score: 65.0846 bits (157), Expect = 7.12548e-10
Identity = 75/197 (38.07%), Postives = 90/197 (45.69%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGS---PGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHG------------KNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
++G +G G G G+ G G++G G KG G PGL+G G GP G+ GP G++G G G QG+ PG GP G +G G GIPG G +G GE G+ G K G GS G PG PG DG G RG G VG G G G G GP G G GP G GE+
Sbjct: 113 SIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPG------------------VRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEE 291

HSP 12 Score: 65.0846 bits (157), Expect = 7.12548e-10
Identity = 75/197 (38.07%), Postives = 90/197 (45.69%), Query Frame = -2
Query: 2208 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGS---PGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHG------------KNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2753
++G +G G G G+ G G++G G KG G PGL+G G GP G+ GP G++G G G QG+ PG GP G +G G GIPG G +G GE G+ G K G GS G PG PG DG G RG G VG G G G G GP G G GP G GE+
Sbjct: 113 SIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPG------------------VRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEE 291

HSP 13 Score: 61.6178 bits (148), Expect = 7.16463e-09
Identity = 85/194 (43.81%), Postives = 105/194 (54.12%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQ------RGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQV---------GILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G G MG GP GIRGP G +G G KG G G+ G+ GD+G +G+QGPP G DG+EG GSP GP+G PG AG+ G G G G G PG+NGK GK G DG G G GP G +G GP+G G+ G++ GI+G PG++G NG GP G+ GPSG PG+
Sbjct: 427 GNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPP---GEDGSEGPSGSP------------GPMGFPGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPS---GEAGPSGAPGK 602

HSP 14 Score: 61.6178 bits (148), Expect = 7.16463e-09
Identity = 85/194 (43.81%), Postives = 105/194 (54.12%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQ------RGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQV---------GILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
G G MG GP GIRGP G +G G KG G G+ G+ GD+G +G+QGPP G DG+EG GSP GP+G PG AG+ G G G G G PG+NGK GK G DG G G GP G +G GP+G G+ G++ GI+G PG++G NG GP G+ GPSG PG+
Sbjct: 427 GNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPP---GEDGSEGPSGSP------------GPMGFPGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPS---GEAGPSGAPGK 602

HSP 15 Score: 57.3806 bits (137), Expect = 1.36594e-07
Identity = 72/181 (39.78%), Postives = 85/181 (46.96%), Query Frame = 2
Query: 5849 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGK------------QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVG------IPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
GPPGE+G G G G G G+ G G VG GPPG +G GN +G+ GF GP+G GK GPVG IPG+ G G G++GV G G G+NGKPG+ G G G + GQ G+ GV G GPNG GP G G PG G PG
Sbjct: 844 GPPGEIGEHGEMGDPGPTGKEGLVGPQGNVGPPGPIGSPGNPGIAGPPGPQGKRGN---RGNTGFVGPAGPRGKRGPVGPGGEKGIPGSPGLEGQRGQIGVSGARGNNGNNGKPGRTGRAGPAGTM---------------------GQKGVRGVKGFTGPNGLKGPQGPSGYPGEDGSPG 1000

HSP 16 Score: 57.3806 bits (137), Expect = 1.36594e-07
Identity = 72/181 (39.78%), Postives = 85/181 (46.96%), Query Frame = -2
Query: 2214 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGK------------QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVG------IPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2702
GPPGE+G G G G G G+ G G VG GPPG +G GN +G+ GF GP+G GK GPVG IPG+ G G G++GV G G G+NGKPG+ G G G + GQ G+ GV G GPNG GP G G PG G PG
Sbjct: 844 GPPGEIGEHGEMGDPGPTGKEGLVGPQGNVGPPGPIGSPGNPGIAGPPGPQGKRGN---RGNTGFVGPAGPRGKRGPVGPGGEKGIPGSPGLEGQRGQIGVSGARGNNGNNGKPGRTGRAGPAGTM---------------------GQKGVRGVKGFTGPNGLKGPQGPSGYPGEDGSPG 1000

HSP 17 Score: 55.0694 bits (131), Expect = 8.8587e-07
Identity = 74/177 (41.81%), Postives = 92/177 (51.98%), Query Frame = 2
Query: 5867 GPDGAKGKTGSPGLRGIPGDN---------GPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQ---------RGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G DGA+GK+G PG GIPG + GP+G +G PGL G+ G EGG G G G +G+ G +G G+ G+ G+ RG G +G G G G GK G G GS+G GA GP G G G IG +G+ G+ GI G G G G +G G G GP G PG D
Sbjct: 70 GRDGARGKSGKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVD 246

HSP 18 Score: 55.0694 bits (131), Expect = 8.8587e-07
Identity = 74/177 (41.81%), Postives = 92/177 (51.98%), Query Frame = -2
Query: 2208 GPDGAKGKTGSPGLRGIPGDN---------GPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQ---------RGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2684
G DGA+GK+G PG GIPG + GP+G +G PGL G+ G EGG G G G +G+ G +G G+ G+ G+ RG G +G G G G GK G G GS+G GA GP G G G IG +G+ G+ GI G G G G +G G G GP G PG D
Sbjct: 70 GRDGARGKSGKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVD 246

HSP 19 Score: 54.299 bits (129), Expect = 1.36109e-06
Identity = 68/178 (38.20%), Postives = 85/178 (47.75%), Query Frame = 2
Query: 5849 GPPGELGPDGAKGKTGSPGLRGIPGDNG---------PVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNG------APGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
GPPG DGA+GK+G PG GIPG +G P+G +G PGL G+ G EGG G G G +G+ G +G G+ G+ G+ G G G+ G G G G+ GK G DG G + G +G G G G+PG G G G GI G G SG PG
Sbjct: 67 GPPGR---DGARGKSGKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSL---------------GPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPG 226

HSP 20 Score: 54.299 bits (129), Expect = 1.36109e-06
Identity = 68/178 (38.20%), Postives = 85/178 (47.75%), Query Frame = -2
Query: 2214 GPPGELGPDGAKGKTGSPGLRGIPGDNG---------PVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNG------APGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2702
GPPG DGA+GK+G PG GIPG +G P+G +G PGL G+ G EGG G G G +G+ G +G G+ G+ G+ G G G+ G G G G+ GK G DG G + G +G G G G+PG G G G GI G G SG PG
Sbjct: 67 GPPGR---DGARGKSGKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSL---------------GPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPG 226

HSP 21 Score: 53.5286 bits (127), Expect = 2.29417e-06
Identity = 59/138 (42.75%), Postives = 68/138 (49.28%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPG---DNGPVGKQGPPGLKGNDGNEGGQGSPGF------------AGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVG 6166
N G DG GK G G G GE+G G+ G G GL G PG +NG G G PG KG G +G GSPG GP G G LGPVG PG G +G G GV G +G G G PG+ G++G G
Sbjct: 350 NPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSG 487

HSP 22 Score: 53.5286 bits (127), Expect = 2.29417e-06
Identity = 59/138 (42.75%), Postives = 68/138 (49.28%), Query Frame = -2
Query: 2385 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPG---DNGPVGKQGPPGLKGNDGNEGGQGSPGF------------AGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVG 2753
N G DG GK G G G GE+G G+ G G GL G PG +NG G G PG KG G +G GSPG GP G G LGPVG PG G +G G GV G +G G G PG+ G++G G
Sbjct: 350 NPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSG 487

HSP 23 Score: 52.7582 bits (125), Expect = 3.67635e-06
Identity = 89/263 (33.84%), Postives = 111/263 (42.21%), Query Frame = 2
Query: 4796 GKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVGPPGPQGRMGSQG---PPGNPGEMXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXXDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGT 5575
G G +G+ G+ G G PGL G G G GPPGYPG+ G PG+ GE G VGP GP G++G +G P GNPG G G+ GP G G G G +G++G+PG G TG +GP G+RG G GN G G G +G G G +G PG G +G G +G G G G G +G+ G PG +G G G NG PG
Sbjct: 208 GIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGV---DGRPGVRGEAGI---------------------------------------VGPQGPVGKVGQRGQRGPSGNPGLSGP---------------------KGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGA 407

HSP 24 Score: 52.7582 bits (125), Expect = 3.67635e-06
Identity = 89/263 (33.84%), Postives = 111/263 (42.21%), Query Frame = -2
Query: 2976 GKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVGPPGPQGRMGSQG---PPGNPGEMXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGT 3755
G G +G+ G+ G G PGL G G G GPPGYPG+ G PG+ GE G VGP GP G++G +G P GNPG G G+ GP G G G G +G++G+PG G TG +GP G+RG G GN G G G +G G G +G PG G +G G +G G G G G +G+ G PG +G G G NG PG
Sbjct: 208 GIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGV---DGRPGVRGEAGI---------------------------------------VGPQGPVGKVGQRGQRGPSGNPGLSGP---------------------KGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGA 407
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15029208 (SmedSxlregen_c102983_g1_i1|m.43148|m.11576)

HSP 1 Score: 152.14 bits (383), Expect = 1.93092e-36
Identity = 89/231 (38.53%), Postives = 122/231 (52.81%), Query Frame = 2
Query: 7742 DDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGH-SWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDN--------HPIIGINGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGV-TIISKSNSKFGLKFEEVCFS* 8404
DD+ K LG + +K P GTKDIPA+TCK L + PN DG Y+IDPN G+ DDA +V C+ +++CI P + LK W +S V + SW +T + Y I SQL FLK +S +A QR+T +C HP+I L +D D + N KY+VI D C+ T +E+ +A PIRD+ + T SK +FGL +VCFS*
Sbjct: 1102 DDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVI-------------LYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS* 1319

HSP 2 Score: 152.14 bits (383), Expect = 1.93092e-36
Identity = 89/231 (38.53%), Postives = 122/231 (52.81%), Query Frame = -2
Query:  147 DDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGH-SWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDN--------HPIIGINGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGV-TIISKSNSKFGLKFEEVCFS* 809
DD+ K LG + +K P GTKDIPA+TCK L + PN DG Y+IDPN G+ DDA +V C+ +++CI P + LK W +S V + SW +T + Y I SQL FLK +S +A QR+T +C HP+I L +D D + N KY+VI D C+ T +E+ +A PIRD+ + T SK +FGL +VCFS*
Sbjct: 1102 DDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVI-------------LYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS* 1319

HSP 3 Score: 76.6406 bits (187), Expect = 2.07423e-13
Identity = 92/215 (42.79%), Postives = 105/215 (48.84%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---------GFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGK---------------------------IXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G G G+ G GI GP G LGP +G TG+PG RG G GPVG G PG++G G G QG P G GP GE G G +GI G+ GQ GYPG GK GAPG +G PGK G DG G IG G GD G GP G+ G+ G G++G GS G GA GP GILG PGP G+ G
Sbjct: 159 GDKGQRGRMGKDGILGPRGNLGP---QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGS---DGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS 367

HSP 4 Score: 76.6406 bits (187), Expect = 2.07423e-13
Identity = 92/215 (42.79%), Postives = 105/215 (48.84%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---------GFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGK---------------------------IXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
G G G+ G GI GP G LGP +G TG+PG RG G GPVG G PG++G G G QG P G GP GE G G +GI G+ GQ GYPG GK GAPG +G PGK G DG G IG G GD G GP G+ G+ G G++G GS G GA GP GILG PGP G+ G
Sbjct: 159 GDKGQRGRMGKDGILGPRGNLGP---QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGS---DGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGS 367

HSP 5 Score: 69.707 bits (169), Expect = 3.11894e-11
Identity = 84/185 (45.41%), Postives = 97/185 (52.43%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGI---RGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPN---GASGPDGILGKPGPSGKPG 6337
LG+ G GKSG G+ GPPG+ G G G G+ G RG+PG NGP G KGN G++G G PG AG +G G GP G G G G G +G G G G NG PG PG DG GK G G+ G G G RG G GI G PGS G G++GP G +G PG GKPG
Sbjct: 443 LGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPS------GTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPG 621

HSP 6 Score: 69.707 bits (169), Expect = 3.11894e-11
Identity = 84/185 (45.41%), Postives = 97/185 (52.43%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGI---RGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPN---GASGPDGILGKPGPSGKPG 2750
LG+ G GKSG G+ GPPG+ G G G G+ G RG+PG NGP G KGN G++G G PG AG +G G GP G G G G G +G G G G NG PG PG DG GK G G+ G G G RG G GI G PGS G G++GP G +G PG GKPG
Sbjct: 443 LGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPS------GTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPG 621

HSP 7 Score: 65.4698 bits (158), Expect = 4.94233e-10
Identity = 85/203 (41.87%), Postives = 97/203 (47.78%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVG---------KQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNG---ASGPDG------------ILGKPGPSGKPGE 6340
GK+ G GP G RGPPG+ G DG G G PG G+ G GP G GP G KGN G++G G PG AG +G G GP G G G G G +G G G G NG PG PG DG GK G G+ G G G RG G GI G PGS G G ++GP G I+G PGP G G+
Sbjct: 432 GKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGD 634

HSP 8 Score: 65.4698 bits (158), Expect = 4.94233e-10
Identity = 85/203 (41.87%), Postives = 97/203 (47.78%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVG---------KQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNG---ASGPDG------------ILGKPGPSGKPGE 2747
GK+ G GP G RGPPG+ G DG G G PG G+ G GP G GP G KGN G++G G PG AG +G G GP G G G G G +G G G G NG PG PG DG GK G G+ G G G RG G GI G PGS G G ++GP G I+G PGP G G+
Sbjct: 432 GKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGD 634

HSP 9 Score: 62.7734 bits (151), Expect = 3.40081e-09
Identity = 87/183 (47.54%), Postives = 97/183 (53.01%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGL---KGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
++G G+ G +G G GPPG G GA G G GL G PG G VG+ GPPG GN G G G G GP G +G GP G+PG GQ+G G G G NG PG G G PGA GS GK G PG GD G SGP+G G G VG G PG G G GP G +G GP G G
Sbjct: 716 SIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQG 898

HSP 10 Score: 62.7734 bits (151), Expect = 3.40081e-09
Identity = 87/183 (47.54%), Postives = 97/183 (53.01%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGL---KGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
++G G+ G +G G GPPG G GA G G GL G PG G VG+ GPPG GN G G G G GP G +G GP G+PG GQ+G G G G NG PG G G PGA GS GK G PG GD G SGP+G G G VG G PG G G GP G +G GP G G
Sbjct: 716 SIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQG 898

HSP 11 Score: 60.4622 bits (145), Expect = 1.60166e-08
Identity = 69/165 (41.82%), Postives = 81/165 (49.09%), Query Frame = 2
Query: 5849 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G PG+ G G G G+PG PG GP+G++GPPG G+DG PG GP G+ G GP+G PG +GQRG PG G G G GS G GKPG G G G +G G+ G LG G GP G G GI G G G PG+D
Sbjct: 414 GHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDG------VPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG---------------ASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD 557

HSP 12 Score: 60.4622 bits (145), Expect = 1.60166e-08
Identity = 69/165 (41.82%), Postives = 81/165 (49.09%), Query Frame = -2
Query: 2208 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2702
G PG+ G G G G+PG PG GP+G++GPPG G+DG PG GP G+ G GP+G PG +GQRG PG G G G GS G GKPG G G G +G G+ G LG G GP G G GI G G G PG+D
Sbjct: 414 GHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDG------VPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNG---------------ASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKD 557

HSP 13 Score: 57.7658 bits (138), Expect = 1.30382e-07
Identity = 67/170 (39.41%), Postives = 81/170 (47.65%), Query Frame = 2
Query: 5849 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGEL------GVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G PG+ G G +G TG PG+ G G G G +GP G+KG+ G G G G GP G +G GP G PG G G PG + GV G +G PG+ G+PG G G G G G G G LG+ GS G +G G DG G PG G PG+
Sbjct: 120 GKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPG---------------LRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK 274

HSP 14 Score: 57.7658 bits (138), Expect = 1.30382e-07
Identity = 67/170 (39.41%), Postives = 81/170 (47.65%), Query Frame = -2
Query: 2211 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGEL------GVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2702
G PG+ G G +G TG PG+ G G G G +GP G+KG+ G G G G GP G +G GP G PG G G PG + GV G +G PG+ G+PG G G G G G G G LG+ GS G +G G DG G PG G PG+
Sbjct: 120 GKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPG---------------LRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGK 274

HSP 15 Score: 56.225 bits (134), Expect = 3.83093e-07
Identity = 74/183 (40.44%), Postives = 88/183 (48.09%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRG---PPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
N G+ G +G+ G AGIRG PG G DG GK G +G G G G++GP G+ G G G G G G +G +G++G GIPG G G PG G G G PG+ G PG G G GK RG G +G + G G G SGP GKPGPSGKPG
Sbjct: 529 NTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGK------------------RGKAGGLGKVSFTGRSG--GQSGP---RGKPGPSGKPG 688

HSP 16 Score: 56.225 bits (134), Expect = 3.83093e-07
Identity = 74/183 (40.44%), Postives = 88/183 (48.09%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRG---PPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
N G+ G +G+ G AGIRG PG G DG GK G +G G G G++GP G+ G G G G G G +G +G++G GIPG G G PG G G G PG+ G PG G G GK RG G +G + G G G SGP GKPGPSGKPG
Sbjct: 529 NTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGK------------------RGKAGGLGKVSFTGRSG--GQSGP---RGKPGPSGKPG 688

HSP 17 Score: 55.0694 bits (131), Expect = 8.24272e-07
Identity = 73/204 (35.78%), Postives = 94/204 (46.08%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAG----PSGEVGKLGPVGIPGAAGQRGYP------------------GELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
++G G MG+ G GI G PG +GP G +G G GL G PG G +G QG L+G G GG G F G SG GK GP G PG +G +G G +G+ G+ G G +G G PG +G+ G + G G +G+ G PG+ G G GP G +G G SGKPG+D
Sbjct: 601 DIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQG---LRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAV------------------GPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDD 783

HSP 18 Score: 55.0694 bits (131), Expect = 8.24272e-07
Identity = 73/204 (35.78%), Postives = 94/204 (46.08%), Query Frame = -2
Query: 2208 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAG----PSGEVGKLGPVGIPGAAGQRGYP------------------GELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2753
++G G MG+ G GI G PG +GP G +G G GL G PG G +G QG L+G G GG G F G SG GK GP G PG +G +G G +G+ G+ G G +G G PG +G+ G + G G +G+ G PG+ G G GP G +G G SGKPG+D
Sbjct: 601 DIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQG---LRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAV------------------GPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDD 783

HSP 19 Score: 51.9878 bits (123), Expect = 6.65103e-06
Identity = 75/180 (41.67%), Postives = 92/180 (51.11%), Query Frame = 2
Query: 5843 IRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN---------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
I G G G G G +GSPGLRG PG G +G QG PG +G G G G G G G G +G G+PG G+ G G++G+ GKN G PG +GKPG G G+ GK + G GP+G RG G+ G GVPG+ GP G SG G +G PG SG+ G
Sbjct: 310 IIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGK------NMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRG 483

HSP 20 Score: 51.9878 bits (123), Expect = 6.65103e-06
Identity = 75/180 (41.67%), Postives = 92/180 (51.11%), Query Frame = -2
Query: 2214 IRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN---------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2708
I G G G G G +GSPGLRG PG G +G QG PG +G G G G G G G G +G G+PG G+ G G++G+ GKN G PG +GKPG G G+ GK + G GP+G RG G+ G GVPG+ GP G SG G +G PG SG+ G
Sbjct: 310 IIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGK------NMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRG 483
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15036469 (dd_smedV4_1070_0_1|m.1593|m.7941)

HSP 1 Score: 151.369 bits (381), Expect = 3.59305e-36
Identity = 81/225 (36.00%), Postives = 128/225 (56.89%), Query Frame = 2
Query: 7730 IMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSNSKFGLKF--EEVCF 8398
I+ DD AK LG +AI P GT + PA++C HL+ P+ PDG YWIDPN G+IDDAV+V+CKI ++TCI+P+ + L+ N W N + YS+ Q++FLK S+ A Q +T +C N P+I N V R+ D+D ++ + Q Y V+ D+CQ+ + T +E+++ + PI+D+ V ++ + + +++ EEVCF
Sbjct: 1078 IIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQK---PKFN---WFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVI-----KNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCF 1291

HSP 2 Score: 151.369 bits (381), Expect = 3.59305e-36
Identity = 81/225 (36.00%), Postives = 128/225 (56.89%), Query Frame = -2
Query:  153 IMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSNSKFGLKF--EEVCF 821
I+ DD AK LG +AI P GT + PA++C HL+ P+ PDG YWIDPN G+IDDAV+V+CKI ++TCI+P+ + L+ N W N + YS+ Q++FLK S+ A Q +T +C N P+I N V R+ D+D ++ + Q Y V+ D+CQ+ + T +E+++ + PI+D+ V ++ + + +++ EEVCF
Sbjct: 1078 IIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQK---PKFN---WFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVI-----KNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCF 1291

HSP 3 Score: 62.7734 bits (151), Expect = 3.44164e-09
Identity = 91/227 (40.09%), Postives = 103/227 (45.37%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRG------YPGELGVHGKNGAPGS---------NGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXA----------------------------RGVTGQVGILGVPGSYGPNGASGPDGIL---GKPGPSGKPGED 6343
+GK G G G G G G LGP G GK G+PG G PG NG GK G DG+ G G+PG GP G GK GP G PG GQ+G PG G+ G G PGS GKPG P DG G+ G GP G G GP G+ G+ G G+ G PG GP G +GPDG+L G PG GKPGED
Sbjct: 493 VGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDG------EDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPVGVRGKVGKPGPPSKDGPPGQAGPQGPPGLDGPPGPDGSVKISGRSGGGRGSPGPKGHKGQPGKNGMNGLQGPTGLSGNPGKQGPPGEAGPDGLLGPMGPPGKDGKPGED 713

HSP 4 Score: 62.7734 bits (151), Expect = 3.44164e-09
Identity = 91/227 (40.09%), Postives = 103/227 (45.37%), Query Frame = -2
Query: 2208 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRG------YPGELGVHGKNGAPGS---------NGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGA----------------------------RGVTGQVGILGVPGSYGPNGASGPDGIL---GKPGPSGKPGED 2750
+GK G G G G G G LGP G GK G+PG G PG NG GK G DG+ G G+PG GP G GK GP G PG GQ+G PG G+ G G PGS GKPG P DG G+ G GP G G GP G+ G+ G G+ G PG GP G +GPDG+L G PG GKPGED
Sbjct: 493 VGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDG------EDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPVGVRGKVGKPGPPSKDGPPGQAGPQGPPGLDGPPGPDGSVKISGRSGGGRGSPGPKGHKGQPGKNGMNGLQGPTGLSGNPGKQGPPGEAGPDGLLGPMGPPGKDGKPGED 713

HSP 5 Score: 60.4622 bits (145), Expect = 1.70534e-08
Identity = 82/192 (42.71%), Postives = 106/192 (55.21%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGS---------PGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKP---GKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
+G G+ G GP+G +GP GE GPDG +G G PG +G PG +G G QGP GL+G DG G G G G G G +GP G+ G AG++G LG G G+PG NG P G+PG GS GK G G G+ G G +G +G++G G+ G G GP G+ G +G +G GP+G PG
Sbjct: 124 VGMPGNQGPDGPSGSKGPVGEKGPDGPQGNPGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGV---LGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGS 312

HSP 6 Score: 60.4622 bits (145), Expect = 1.70534e-08
Identity = 82/192 (42.71%), Postives = 106/192 (55.21%), Query Frame = -2
Query: 2211 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGS---------PGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKP---GKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2750
+G G+ G GP+G +GP GE GPDG +G G PG +G PG +G G QGP GL+G DG G G G G G G +GP G+ G AG++G LG G G+PG NG P G+PG GS GK G G G+ G G +G +G++G G+ G G GP G+ G +G +G GP+G PG
Sbjct: 124 VGMPGNQGPDGPSGSKGPVGEKGPDGPQGNPGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGV---LGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGS 312

HSP 7 Score: 58.151 bits (139), Expect = 8.8868e-08
Identity = 80/194 (41.24%), Postives = 97/194 (50.00%), Query Frame = 2
Query: 5804 GKDGDMGKSG---PAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGV------------TGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
GK G +G SG G+ G PG +G G G G G GI G+NGP+G GP GL G G +G G PG G G GK+GPVG G+ G G GE+G G+NG G+ G G G GS G G GP G G G G G+ G +G +G PG G +G GP G G PGP+G+ G
Sbjct: 221 GKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGS 414

HSP 8 Score: 58.151 bits (139), Expect = 8.8868e-08
Identity = 80/194 (41.24%), Postives = 97/194 (50.00%), Query Frame = -2
Query: 2211 GKDGDMGKSG---PAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGV------------TGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
GK G +G SG G+ G PG +G G G G G GI G+NGP+G GP GL G G +G G PG G G GK+GPVG G+ G G GE+G G+NG G+ G G G GS G G GP G G G G G+ G +G +G PG G +G GP G G PGP+G+ G
Sbjct: 221 GKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGS 414
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15040144 (dd_smedV4_740_0_1|m.36260|m.3408)

HSP 1 Score: 147.517 bits (371), Expect = 5.23479e-35
Identity = 84/226 (37.17%), Postives = 127/226 (56.19%), Query Frame = 2
Query: 7733 MYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL-ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSN-SKFGLKFEEVCFS* 8404
MY DD+ A +LG + I P GTKD+PA++C HL + + DG Y+IDPN G+++DA +VFCK+ +TCI P ++ + +N + L+ Y I N+QL FLK S A Q + +C+N + + K P ++ D++ + + L Y VI D+CQ + EAET++ VS D+ PIRD +T+ S S+ S+F LK +VCFS*
Sbjct: 1101 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAV------VEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRD--LTLGSDSDISEFRLKLSKVCFS* 1318

HSP 2 Score: 147.517 bits (371), Expect = 5.23479e-35
Identity = 84/226 (37.17%), Postives = 127/226 (56.19%), Query Frame = -2
Query:  147 MYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL-ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEVSNDASLFPIRDVGVTIISKSN-SKFGLKFEEVCFS* 818
MY DD+ A +LG + I P GTKD+PA++C HL + + DG Y+IDPN G+++DA +VFCK+ +TCI P ++ + +N + L+ Y I N+QL FLK S A Q + +C+N + + K P ++ D++ + + L Y VI D+CQ + EAET++ VS D+ PIRD +T+ S S+ S+F LK +VCFS*
Sbjct: 1101 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAV------VEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRD--LTLGSDSDISEFRLKLSKVCFS* 1318

HSP 3 Score: 65.0846 bits (157), Expect = 7.15813e-10
Identity = 81/189 (42.86%), Postives = 100/189 (52.91%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGK------------TGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKP 6334
G+DG +G G G G PG++GP GAKGK TG G +G G +G VG +G PG G DG G QG PG +G GE G G +G+P G PGE G+ NG PG +G+PG G G G+ G GP G G +G G G G+ G G PG+ GP G +G GI G G +GKP
Sbjct: 731 GRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP------GIPGETGM---NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKP 910

HSP 4 Score: 65.0846 bits (157), Expect = 7.15813e-10
Identity = 81/189 (42.86%), Postives = 100/189 (52.91%), Query Frame = -2
Query: 2217 GKDGDMGKSGPAGIRGPPGELGPDGAKGK------------TGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKP 2747
G+DG +G G G G PG++GP GAKGK TG G +G G +G VG +G PG G DG G QG PG +G GE G G +G+P G PGE G+ NG PG +G+PG G G G+ G GP G G +G G G G+ G G PG+ GP G +G GI G G +GKP
Sbjct: 731 GRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP------GIPGETGM---NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKP 910

HSP 5 Score: 63.929 bits (154), Expect = 1.73333e-09
Identity = 83/184 (45.11%), Postives = 94/184 (51.09%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGA---KGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGK------PGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSY---GPNGASGPDGILGKPG 6319
G G+ G +G G +G G GP G G TG PGL G+ G G G GP GL G G G G PG GP G G G G G G RG PG G G NG PG NG PG PG DG+ GK G+ GP G +G +G G GV G VG+ G PG+ GP G GP G+ GKPG
Sbjct: 271 GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPG 454

HSP 6 Score: 63.929 bits (154), Expect = 1.73333e-09
Identity = 83/184 (45.11%), Postives = 94/184 (51.09%), Query Frame = -2
Query: 2232 GKDGDMGKSGPAGIRGPPGELGPDGA---KGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGK------PGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSY---GPNGASGPDGILGKPG 2747
G G+ G +G G +G G GP G G TG PGL G+ G G G GP GL G G G G PG GP G G G G G G RG PG G G NG PG NG PG PG DG+ GK G+ GP G +G +G G GV G VG+ G PG+ GP G GP G+ GKPG
Sbjct: 271 GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPG 454

HSP 7 Score: 61.2326 bits (147), Expect = 1.00771e-08
Identity = 83/190 (43.68%), Postives = 101/190 (53.16%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKP------------GKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G+ G +G GP G GP G G G G+ G+PG RGIPG G G GPPG+ G+ G +G G PG G +G+ G GP G G AG G G +G G +G PG+N P GKPG++G G +G PGP G +G SG G G G +G +G PGS G GA G G G PG G PG
Sbjct: 328 GRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPG 517

HSP 8 Score: 61.2326 bits (147), Expect = 1.00771e-08
Identity = 83/190 (43.68%), Postives = 101/190 (53.16%), Query Frame = -2
Query: 2214 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKP------------GKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2747
G+ G +G GP G GP G G G G+ G+PG RGIPG G G GPPG+ G+ G +G G PG G +G+ G GP G G AG G G +G G +G PG+N P GKPG++G G +G PGP G +G SG G G G +G +G PGS G GA G G G PG G PG
Sbjct: 328 GRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPG 517

HSP 9 Score: 60.8474 bits (146), Expect = 1.42328e-08
Identity = 85/184 (46.20%), Postives = 98/184 (53.26%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVG---KQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPD---GILGKPGPSGKPG 6337
G+DGD GK G G PGE+GP G G TG G G PG GPVG K G G G DG++G GSPG GP G GK+GP G PG G G G G G +G G GKPG PG DG G G G SG G RG G++G+ G+PG G NG G D G+ G G +G+PG
Sbjct: 683 GEDGDAGKPGSPGS---PGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGN------QGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPG 857

HSP 10 Score: 60.8474 bits (146), Expect = 1.42328e-08
Identity = 85/184 (46.20%), Postives = 98/184 (53.26%), Query Frame = -2
Query: 2214 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVG---KQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPD---GILGKPGPSGKPG 2747
G+DGD GK G G PGE+GP G G TG G G PG GPVG K G G G DG++G GSPG GP G GK+GP G PG G G G G G +G G GKPG PG DG G G G SG G RG G++G+ G+PG G NG G D G+ G G +G+PG
Sbjct: 683 GEDGDAGKPGSPGS---PGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGN------QGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPG 857

HSP 11 Score: 57.7658 bits (138), Expect = 1.22899e-07
Identity = 89/219 (40.64%), Postives = 107/219 (48.86%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEG---------GQGSPGFAGPSGEVGKLGPVGIP------------------GAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGK------------IXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G GD G+ GP G GP G G G G G PG +G PG+ GP G G G+ G GN G G+G PG GPSG VG+ G G+P G AG+ G PG++G GK G PG GKPGK G G VG+ +G PGP GDRG G G+ G+ G G +G G GP G +GP+G +G GP G G D
Sbjct: 848 GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRD 1066

HSP 12 Score: 57.7658 bits (138), Expect = 1.22899e-07
Identity = 89/219 (40.64%), Postives = 107/219 (48.86%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEG---------GQGSPGFAGPSGEVGKLGPVGIP------------------GAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGK------------IXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
G GD G+ GP G GP G G G G G PG +G PG+ GP G G G+ G GN G G+G PG GPSG VG+ G G+P G AG+ G PG++G GK G PG GKPGK G G VG+ +G PGP GDRG G G+ G+ G G +G G GP G +GP+G +G GP G G D
Sbjct: 848 GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRD 1066

HSP 13 Score: 56.225 bits (134), Expect = 3.26404e-07
Identity = 84/190 (44.21%), Postives = 96/190 (50.53%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPV---GKQGPPGLKGN---DGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
+G GD+G +G +G G PG GP G GK G G G+ G GP GK GP G KG G GG GS G +GP G+ G +GP G PG G G+PG GV G +G G G GK G G G+ G G G G G G RG TGQ G G G G GA G G +GKPG GKPG
Sbjct: 699 EIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGN 888

HSP 14 Score: 56.225 bits (134), Expect = 3.26404e-07
Identity = 84/190 (44.21%), Postives = 96/190 (50.53%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPV---GKQGPPGLKGN---DGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
+G GD+G +G +G G PG GP G GK G G G+ G GP GK GP G KG G GG GS G +GP G+ G +GP G PG G G+PG GV G +G G G GK G G G+ G G G G G G RG TGQ G G G G GA G G +GKPG GKPG
Sbjct: 699 EIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGN 888

HSP 15 Score: 54.299 bits (129), Expect = 1.29857e-06
Identity = 71/184 (38.59%), Postives = 87/184 (47.28%), Query Frame = 2
Query: 5813 GDMGKSGPAGIRGPPGELGPDGAKG------------KTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 6328
G++G +GP G+ G G+LG G G + G PG GI G +G G GP G KG+ G +G +G G G G GK G VG PGA G+ HG NG PGS G G G G +G GA G G+ G +GI GV G GP G +G GI+G GP G
Sbjct: 178 GELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGE---------HGSNGIPGSKGSQGGTGPQGIIGNAGATGRP------------GLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPG 340

HSP 16 Score: 54.299 bits (129), Expect = 1.29857e-06
Identity = 71/184 (38.59%), Postives = 87/184 (47.28%), Query Frame = -2
Query: 2223 GDMGKSGPAGIRGPPGELGPDGAKG------------KTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 2738
G++G +GP G+ G G+LG G G + G PG GI G +G G GP G KG+ G +G +G G G G GK G VG PGA G+ HG NG PGS G G G G +G GA G G+ G +GI GV G GP G +G GI+G GP G
Sbjct: 178 GELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGE---------HGSNGIPGSKGSQGGTGPQGIIGNAGATGRP------------GLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPG 340

HSP 17 Score: 53.9138 bits (128), Expect = 2.01191e-06
Identity = 71/193 (36.79%), Postives = 87/193 (45.08%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPG---DNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGA------------AGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G DG G SG G+ GP G G G +GK G G+ G PG +G VG G PG G++G G +GS G GP G +G G G PG +G +G G G+ G G PGS G G PG G G+I G G G+PG+ G G +GP GI G PG G+ G
Sbjct: 220 GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRI---------------------GTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDG 391

HSP 18 Score: 53.9138 bits (128), Expect = 2.01191e-06
Identity = 71/193 (36.79%), Postives = 87/193 (45.08%), Query Frame = -2
Query: 2214 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPG---DNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGA------------AGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2747
G DG G SG G+ GP G G G +GK G G+ G PG +G VG G PG G++G G +GS G GP G +G G G PG +G +G G G+ G G PGS G G PG G G+I G G G+PG+ G G +GP GI G PG G+ G
Sbjct: 220 GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRI---------------------GTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDG 391

HSP 19 Score: 53.5286 bits (127), Expect = 2.30205e-06
Identity = 88/210 (41.90%), Postives = 103/210 (49.05%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGK------TGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSV------GKIXXXXXXXXXXXXXXXXARGVTGQVGI------------------LGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
GKDG G GP G +GP G +G G G TG PGL G G G G +GP G +G G+ G G G GP GE+G GP+G+PG G G G +G HG G PG G+ G PGADG G IG G GDRG G G GV G GI G+PGS G G +GP GI+G G +G+PG D
Sbjct: 100 GKDGKPGPIGPVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLD 309

HSP 20 Score: 53.5286 bits (127), Expect = 2.30205e-06
Identity = 88/210 (41.90%), Postives = 103/210 (49.05%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGK------TGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSV------GKIXXXXXXXXXXXXXXXGARGVTGQVGI------------------LGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
GKDG G GP G +GP G +G G G TG PGL G G G G +GP G +G G+ G G G GP GE+G GP+G+PG G G G +G HG G PG G+ G PGADG G IG G GDRG G G GV G GI G+PGS G G +GP GI+G G +G+PG D
Sbjct: 100 GKDGKPGPIGPVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLD 309

HSP 21 Score: 53.1434 bits (126), Expect = 2.67875e-06
Identity = 72/174 (41.38%), Postives = 85/174 (48.85%), Query Frame = 2
Query: 5837 AGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDG------ILGKPGPSGKPGE 6340
AG+ G G++GP G G G G+ G+PG NGP G QG G G G G GSPG G G+ G G G AG+ G G G PG +G GKPG+ GS G+IG PG G TGQ G LG PG GP G G DG + G GP+G PG+
Sbjct: 594 AGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGR-----SSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDI------------GPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGK 750

HSP 22 Score: 53.1434 bits (126), Expect = 2.67875e-06
Identity = 72/174 (41.38%), Postives = 85/174 (48.85%), Query Frame = -2
Query: 2211 AGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDG------ILGKPGPSGKPGE 2714
AG+ G G++GP G G G G+ G+PG NGP G QG G G G G GSPG G G+ G G G AG+ G G G PG +G GKPG+ GS G+IG PG G TGQ G LG PG GP G G DG + G GP+G PG+
Sbjct: 594 AGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGR-----SSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDI------------GPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGK 750

HSP 23 Score: 51.9878 bits (123), Expect = 6.32251e-06
Identity = 84/202 (41.58%), Postives = 104/202 (51.49%), Query Frame = 2
Query: 5801 LGKDGDMGKSGP------AGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS----------GEVGKLGPVGIPGAAGQRGYPGELGVHGKNGA---PGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGP---DGILGKPGPSGKPGE 6340
+G GD+G +GP GI G PG GP G +G G+ GL G G VG GPPG +G G+ G G+ AG S GE G G G PG+ G+ G PG++G G++GA PG G G PG DG G++G G G G G +G +G G+VG G PG G G SGP DG+ G GP GKPG
Sbjct: 597 MGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSG---KTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGN 795

HSP 24 Score: 51.9878 bits (123), Expect = 6.32251e-06
Identity = 84/202 (41.58%), Postives = 104/202 (51.49%), Query Frame = -2
Query: 2211 LGKDGDMGKSGP------AGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS----------GEVGKLGPVGIPGAAGQRGYPGELGVHGKNGA---PGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGP---DGILGKPGPSGKPGE 2750
+G GD+G +GP GI G PG GP G +G G+ GL G G VG GPPG +G G+ G G+ AG S GE G G G PG+ G+ G PG++G G++GA PG G G PG DG G++G G G G G +G +G G+VG G PG G G SGP DG+ G GP GKPG
Sbjct: 597 MGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSG---KTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGN 795
BLAST of collagen vs. uniprot
Match: gi|123797137|sp|Q3U962|CO5A2_MOUSE (RecName: Full=Collagen alpha-2(V) chain; Flags: Precursor)

HSP 1 Score: 117.472 bits (293), Expect = 1.36596e-24
Identity = 73/220 (33.18%), Postives = 112/220 (50.91%), Query Frame = 2
Query: 7781 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTW--PSSSVNGHSWIQALTMNNEVQ-----YSIPN---SQLSFLKAYSDSAIQRVTFSCDNHPIIG-INGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+++P G+K PA+TC L + +P K GEYWIDPN G +DA+KV+C + +TCI P KTW S N W L MN Q Y PN +Q++FL+ S A Q +T+ C N +G ++ + + +L ++D + + + +YTV+ D C + +TI E + + + PI DVG I ++ +FGL VCF
Sbjct: 1280 MRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPDNKPVWY-GLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRN--TVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNADQEFGLDIGPVCF 1496

HSP 2 Score: 117.472 bits (293), Expect = 1.36596e-24
Identity = 73/220 (33.18%), Postives = 112/220 (50.91%), Query Frame = -2
Query:  153 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTW--PSSSVNGHSWIQALTMNNEVQ-----YSIPN---SQLSFLKAYSDSAIQRVTFSCDNHPIIG-INGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 770
+++P G+K PA+TC L + +P K GEYWIDPN G +DA+KV+C + +TCI P KTW S N W L MN Q Y PN +Q++FL+ S A Q +T+ C N +G ++ + + +L ++D + + + +YTV+ D C + +TI E + + + PI DVG I ++ +FGL VCF
Sbjct: 1280 MRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPDNKPVWY-GLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRN--TVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNADQEFGLDIGPVCF 1496

HSP 3 Score: 66.2402 bits (160), Expect = 4.1134e-09
Identity = 83/184 (45.11%), Postives = 98/184 (53.26%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGE---LGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G G MG GP G RG PGE LGP GA GK G+ G+ G PG GP+G G G GN G +G G G GP G G+ G G PG AG +G PG +G +G PG+ G G G G G G PG G +G +GP G RG +G G+ G G GP G GP GI G GP G+ G+
Sbjct: 320 EAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGT---DGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGK 500

HSP 4 Score: 66.2402 bits (160), Expect = 4.1134e-09
Identity = 83/184 (45.11%), Postives = 98/184 (53.26%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGE---LGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
G G MG GP G RG PGE LGP GA GK G+ G+ G PG GP+G G G GN G +G G G GP G G+ G G PG AG +G PG +G +G PG+ G G G G G G PG G +G +GP G RG +G G+ G G GP G GP GI G GP G+ G+
Sbjct: 320 EAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGT---DGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGK 500

HSP 5 Score: 60.4622 bits (145), Expect = 2.62674e-07
Identity = 86/183 (46.99%), Postives = 97/183 (53.01%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G+ GD G G G GP GE GP G +G G PG RG GD G VG GP G +G GN G GS G GP G G+ GPVG G G +G PG G G GA G G PG G +G +G +GAPG DG G G IG RG G +G+ G GS G G G G G PG G PG+D
Sbjct: 463 GQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKD 645

HSP 6 Score: 60.4622 bits (145), Expect = 2.62674e-07
Identity = 86/183 (46.99%), Postives = 97/183 (53.01%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
G+ GD G G G GP GE GP G +G G PG RG GD G VG GP G +G GN G GS G GP G G+ GPVG G G +G PG G G GA G G PG G +G +G +GAPG DG G G IG RG G +G+ G GS G G G G G PG G PG+D
Sbjct: 463 GQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKD 645

HSP 7 Score: 58.9214 bits (141), Expect = 6.91223e-07
Identity = 70/158 (44.30%), Postives = 85/158 (53.80%), Query Frame = 2
Query: 5864 LGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
GP G +G++G PG+ G G+ GP G+ GP G++G GP GE GK GP G PG G G GE G G G PGS+G PG GA G G +G+ GP G +GD G G G+ G G+ G PG GP G GP LG PG G+PG
Sbjct: 456 TGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGP------------IGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGP---LGAPGEDGRPG 598

HSP 8 Score: 58.9214 bits (141), Expect = 6.91223e-07
Identity = 70/158 (44.30%), Postives = 85/158 (53.80%), Query Frame = -2
Query: 2214 LGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2687
GP G +G++G PG+ G G+ GP G+ GP G++G GP GE GK GP G PG G G GE G G G PGS+G PG GA G G +G+ GP G +GD G G G+ G G+ G PG GP G GP LG PG G+PG
Sbjct: 456 TGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGP------------IGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGP---LGAPGEDGRPG 598

HSP 9 Score: 58.5362 bits (140), Expect = 9.75945e-07
Identity = 61/141 (43.26%), Postives = 76/141 (53.90%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDN---GPVGKQGPPGLKGNDGNEGGQGSPGFAGP---------------SGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGK 6169
+G G+ GK GP RG PG +GP G G+ G+PG RG PG + GP G QG G G+ G +GGQG PG G G GKLGP+G PG G+ G PG +G+ G+ PGS G PG G+ G +GK
Sbjct: 492 IGPPGEEGKRGP---RGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQ---PGSMGLPGPKGSSGDLGK 626

HSP 10 Score: 58.5362 bits (140), Expect = 9.75945e-07
Identity = 61/141 (43.26%), Postives = 76/141 (53.90%), Query Frame = -2
Query: 2382 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDN---GPVGKQGPPGLKGNDGNEGGQGSPGFAGP---------------SGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGK 2750
+G G+ GK GP RG PG +GP G G+ G+PG RG PG + GP G QG G G+ G +GGQG PG G G GKLGP+G PG G+ G PG +G+ G+ PGS G PG G+ G +GK
Sbjct: 492 IGPPGEEGKRGP---RGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQ---PGSMGLPGPKGSSGDLGK 626

HSP 11 Score: 57.3806 bits (137), Expect = 2.30201e-06
Identity = 69/169 (40.83%), Postives = 80/169 (47.34%), Query Frame = 2
Query: 5849 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGN---EGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVP---GSYGPNGASGPDGILGKPGPSGKPG 6337
G PG G G G +GSPG RG PG G PGLKG+ G+ EG +G G G GE G GP+G G G RG PGE G G GAPG G G PG G +G + G+ G G G P G GP GA GP+G G+ G +G PG
Sbjct: 265 GEPGRNGNTGEVGFSGSPGARGFPG------APGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPL------------------GIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPG 409

HSP 12 Score: 57.3806 bits (137), Expect = 2.30201e-06
Identity = 69/169 (40.83%), Postives = 80/169 (47.34%), Query Frame = -2
Query: 2214 GPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGN---EGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVP---GSYGPNGASGPDGILGKPGPSGKPG 2702
G PG G G G +GSPG RG PG G PGLKG+ G+ EG +G G G GE G GP+G G G RG PGE G G GAPG G G PG G +G + G+ G G G P G GP GA GP+G G+ G +G PG
Sbjct: 265 GEPGRNGNTGEVGFSGSPGARGFPG------APGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPL------------------GIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPG 409
BLAST of collagen vs. uniprot
Match: gi|18202250|sp|O93484|CO1A2_ONCMY (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor [Oncorhynchus mykiss])

HSP 1 Score: 114.775 bits (286), Expect = 7.91381e-24
Identity = 71/217 (32.72%), Postives = 109/217 (50.23%), Query Frame = 2
Query: 7790 PQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVN-GHSWIQALTMNNEVQYSI------PNS---QLSFLKAYSDSAIQRVTFSCDNHP--IIGINGKINKVTSPRLLADDDSVMRI-NHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
P+G+K PA+TC+ + +S+P+ G YWIDPN G I DA+K +C S TCI P K W SS N H W T+N +++ P S QL+F++ ++ A Q +T+ C N + G NG + K L +D +R + + + V+ D C ++T+IE +N S PI D+ I +++ +FGL VCF
Sbjct: 1142 PEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWF-GETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAV--LLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355

HSP 2 Score: 114.775 bits (286), Expect = 7.91381e-24
Identity = 71/217 (32.72%), Postives = 109/217 (50.23%), Query Frame = -2
Query:  153 PQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVN-GHSWIQALTMNNEVQYSI------PNS---QLSFLKAYSDSAIQRVTFSCDNHP--IIGINGKINKVTSPRLLADDDSVMRI-NHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 761
P+G+K PA+TC+ + +S+P+ G YWIDPN G I DA+K +C S TCI P K W SS N H W T+N +++ P S QL+F++ ++ A Q +T+ C N + G NG + K L +D +R + + + V+ D C ++T+IE +N S PI D+ I +++ +FGL VCF
Sbjct: 1142 PEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWF-GETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAV--LLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355
BLAST of collagen vs. uniprot
Match: gi|82202407|sp|Q6P4Z2|CO2A1_XENTR (RecName: Full=Collagen alpha-1(II) chain; AltName: Full=Alpha-1 type II collagen; Flags: Precursor)

HSP 1 Score: 111.309 bits (277), Expect = 8.33771e-23
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = 2
Query: 7778 AIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNG----HSWIQALTMNNEVQY------SIPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+I++P GTK PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P + P K W S G H W T+N Q+ S PN+ Q++FL+ S A Q +T+ C N I ++ + LL ++D + + + Y + D C+ ++T+IE + S PI D+ I ++ +FG+ VCF
Sbjct: 1273 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWF-GETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNS-IAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491

HSP 2 Score: 111.309 bits (277), Expect = 8.33771e-23
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = -2
Query:  153 AIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNG----HSWIQALTMNNEVQY------SIPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 773
+I++P GTK PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P + P K W S G H W T+N Q+ S PN+ Q++FL+ S A Q +T+ C N I ++ + LL ++D + + + Y + D C+ ++T+IE + S PI D+ I ++ +FG+ VCF
Sbjct: 1273 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWF-GETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNS-IAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491

HSP 3 Score: 68.5514 bits (166), Expect = 8.44835e-10
Identity = 75/192 (39.06%), Postives = 92/192 (47.92%), Query Frame = 2
Query: 5864 LGPDGAKGKTGSPGLRGIPGDNGPVGK------QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAP------------GSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPD---------------GILGKPGPSGKPGE 6340
GP G KG+TG PG+ G G++GP G+ QG PG G +G G +G PG AGP LGP G GA G RG+PG+ G+ G GAP G+NG PG+PG G G ARG+TG+ G G G GP+GASG D G++G PGP G GE
Sbjct: 451 TGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGP------LGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPG------------------ARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGE 618

HSP 4 Score: 68.5514 bits (166), Expect = 8.44835e-10
Identity = 75/192 (39.06%), Postives = 92/192 (47.92%), Query Frame = -2
Query: 2211 LGPDGAKGKTGSPGLRGIPGDNGPVGK------QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAP------------GSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPD---------------GILGKPGPSGKPGE 2687
GP G KG+TG PG+ G G++GP G+ QG PG G +G G +G PG AGP LGP G GA G RG+PG+ G+ G GAP G+NG PG+PG G G ARG+TG+ G G G GP+GASG D G++G PGP G GE
Sbjct: 451 TGPLGPKGQTGDPGVAGFKGEHGPKGEIGSAGPQGAPGPAGEEGKRGARGEPGAAGP------LGPPGERGAPGNRGFPGQDGLAGPKGAPGERGVPGLGGPKGANGDPGRPGEPGLPG------------------ARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGE 618

HSP 5 Score: 56.6102 bits (135), Expect = 4.11101e-06
Identity = 81/205 (39.51%), Postives = 93/205 (45.37%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGK---------QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYP---------------------GELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 6328
G+ G G GP G RG PGE G G +G G GL G PG +GP G QGPPGL+G G G G G G G+ G+ GP G PG G RG G G+ G GAPG G+ G PG G G P G G +G G +G +GQ G G PG GP+GA GP G G GP G
Sbjct: 692 GEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAG------PPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKG 890

HSP 6 Score: 56.6102 bits (135), Expect = 4.11101e-06
Identity = 81/205 (39.51%), Postives = 93/205 (45.37%), Query Frame = -2
Query: 2223 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGK---------QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYP---------------------GELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 2747
G+ G G GP G RG PGE G G +G G GL G PG +GP G QGPPGL+G G G G G G G+ G+ GP G PG G RG G G+ G GAPG G+ G PG G G P G G +G G +G +GQ G G PG GP+GA GP G G GP G
Sbjct: 692 GEAGAPGLVGPRGERGFPGERGSSGPQGLQGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGFAG------PPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKG 890
BLAST of collagen vs. uniprot
Match: gi|146286085|sp|Q91717|CO2A1_XENLA (RecName: Full=Collagen alpha-1(II) chain; AltName: Full=Alpha-1 type II collagen; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 110.538 bits (275), Expect = 1.70332e-22
Identity = 70/222 (31.53%), Postives = 109/222 (49.10%), Query Frame = 2
Query: 7781 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNG----HSWIQALTMNNEVQY------SIPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
I++P GTK PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P + P K W S G H W T+N Q+ S PN+ Q++FL+ S A Q +T+ C N I ++ + LL ++D + + + Y + D C+ ++T+IE + S PI D+ I ++ +FG+ VCF
Sbjct: 1268 IRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCDMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWF-GETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDASQNITYHCKNS-IAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1485

HSP 2 Score: 110.538 bits (275), Expect = 1.70332e-22
Identity = 70/222 (31.53%), Postives = 109/222 (49.10%), Query Frame = -2
Query:  153 IKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSVNG----HSWIQALTMNNEVQY------SIPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL--ADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 770
I++P GTK PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P + P K W S G H W T+N Q+ S PN+ Q++FL+ S A Q +T+ C N I ++ + LL ++D + + + Y + D C+ ++T+IE + S PI D+ I ++ +FG+ VCF
Sbjct: 1268 IRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCDMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWF-GETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDASQNITYHCKNS-IAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1485

HSP 3 Score: 58.9214 bits (141), Expect = 6.90246e-07
Identity = 78/178 (43.82%), Postives = 92/178 (51.69%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEG---GQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 6328
G DG G SGP+G G G G G G+ G+ G+ G GD G G++GP G G DG+ G G PG AGP+GE G+ GP G PG G RG PG+ G+NG PG G G PGADG G G +G +GQ G G PG GP+GA GP G G GP G
Sbjct: 728 GTDGPKGASGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGASGKDGSRGLTGPIGPPGPAGPNGEKGESGPSGPPGIVGARGAPGD---RGENGPPGPAGFAGPPGADGQSG---------------LKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVFGPKG 887

HSP 4 Score: 58.9214 bits (141), Expect = 6.90246e-07
Identity = 78/178 (43.82%), Postives = 92/178 (51.69%), Query Frame = -2
Query: 2223 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEG---GQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSG 2747
G DG G SGP+G G G G G G+ G+ G+ G GD G G++GP G G DG+ G G PG AGP+GE G+ GP G PG G RG PG+ G+NG PG G G PGADG G G +G +GQ G G PG GP+GA GP G G GP G
Sbjct: 728 GTDGPKGASGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGPEGASGKDGSRGLTGPIGPPGPAGPNGEKGESGPSGPPGIVGARGAPGD---RGENGPPGPAGFAGPPGADGQSG---------------LKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVFGPKG 887
BLAST of collagen vs. uniprot
Match: gi|125987808|sp|P28481|CO2A1_MOUSE (RecName: Full=Collagen alpha-1(II) chain; AltName: Full=Alpha-1 type II collagen; Contains: RecName: Full=Collagen alpha-1(II) chain; Contains: RecName: Full=Chondrocalcin; Flags: Precursor)

HSP 1 Score: 110.153 bits (274), Expect = 2.28848e-22
Identity = 70/221 (31.67%), Postives = 105/221 (47.51%), Query Frame = 2
Query: 7778 AIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSV--NGHSWIQALTMNNEVQYS------IPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL-ADDDSVMRI-NHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 8398
+I++P G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P P K W SS H W TMN +S PN+ Q++FL+ S Q +T+ C N I ++ + L+ +D MR + + YT + D C +T+IE S S PI D+ I + +FG+ VCF
Sbjct: 1268 SIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWF-GETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNS-IAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1486

HSP 2 Score: 110.153 bits (274), Expect = 2.28848e-22
Identity = 70/221 (31.67%), Postives = 105/221 (47.51%), Query Frame = -2
Query:  153 AIKNPQGTKDIPAKTCKHLSVSYPNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSSV--NGHSWIQALTMNNEVQYS------IPNS---QLSFLKAYSDSAIQRVTFSCDNHPIIGINGKINKVTSPRLL-ADDDSVMRI-NHQKLKYTVISDDCQYGKASEAETIIEV-SNDASLFPIRDVGVTIISKSNSKFGLKFEEVCF 773
+I++P G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P P K W SS H W TMN +S PN+ Q++FL+ S Q +T+ C N I ++ + L+ +D MR + + YT + D C +T+IE S S PI D+ I + +FG+ VCF
Sbjct: 1268 SIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWF-GETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNS-IAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1486

HSP 3 Score: 55.8398 bits (133), Expect = 7.46621e-06
Identity = 77/206 (37.38%), Postives = 94/206 (45.63%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRG---IPGDNGPVGK---QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKL---------------------GPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G+ G+ G GPAG GPPG G GAKG G G +G PG GP G QGP G+ G G G QG PG G G G++ GP G+ G +G G G+ G+ G GAPG G+PG G G G P G +G+ GQ GI+G+PG G G G PGPSG+PG+
Sbjct: 822 GERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDG---------------PPGPQGLAGQRGIVGLPGQRGER------GFPGLPGPSGEPGK 1006

HSP 4 Score: 55.8398 bits (133), Expect = 7.46621e-06
Identity = 77/206 (37.38%), Postives = 94/206 (45.63%), Query Frame = -2
Query: 2211 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRG---IPGDNGPVGK---QGPPGLKGNDGNEGGQGSPGFAGPSGEVGKL---------------------GPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2747
G+ G+ G GPAG GPPG G GAKG G G +G PG GP G QGP G+ G G G QG PG G G G++ GP G+ G +G G G+ G+ G GAPG G+PG G G G P G +G+ GQ GI+G+PG G G G PGPSG+PG+
Sbjct: 822 GERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDG---------------PPGPQGLAGQRGIVGLPGQRGER------GFPGLPGPSGEPGK 1006
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581820|ref|NP_723044.1| (collagen type IV, isoform A [Drosophila melanogaster])

HSP 1 Score: 66.2402 bits (160), Expect = 5.08653e-10
Identity = 84/190 (44.21%), Postives = 100/190 (52.63%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXX------XXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
N G G G GP G+ GP GE G GA G G+PG LRGIPG NG G +G PG+ G G G G G G+ G GP+G PGA G GYPG+ G G PG +G+PG G G VG IG G G G G GA+G G G++G+PG+ G GA G DG G G +G PG+
Sbjct: 793 NTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGD---RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGK 978

HSP 2 Score: 66.2402 bits (160), Expect = 5.08653e-10
Identity = 84/190 (44.21%), Postives = 100/190 (52.63%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXX------XXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
N G G G GP G+ GP GE G GA G G+PG LRGIPG NG G +G PG+ G G G G G G+ G GP+G PGA G GYPG+ G G PG +G+PG G G VG IG G G G G GA+G G G++G+PG+ G GA G DG G G +G PG+
Sbjct: 793 NTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGD---RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGK 978

HSP 3 Score: 63.929 bits (154), Expect = 2.47019e-09
Identity = 69/166 (41.57%), Postives = 86/166 (51.81%), Query Frame = 2
Query: 5840 GIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G RG PG LGP G KG+ G PG+ G GD G++G PG G G++G +GSPG G +G G GP G PGA G G+ G G++G PG G G PG G G++G+ G G+ A+G G+ G G G GP G G G G GP G G
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDK---GQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGIN---GKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKG 248

HSP 4 Score: 63.929 bits (154), Expect = 2.47019e-09
Identity = 69/166 (41.57%), Postives = 86/166 (51.81%), Query Frame = -2
Query: 2214 GIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2711
G RG PG LGP G KG+ G PG+ G GD G++G PG G G++G +GSPG G +G G GP G PGA G G+ G G++G PG G G PG G G++G+ G G+ A+G G+ G G G GP G G G G GP G G
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDK---GQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGIN---GKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKG 248

HSP 5 Score: 60.4622 bits (145), Expect = 3.07495e-08
Identity = 79/206 (38.35%), Postives = 105/206 (50.97%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG------LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK--------------------PGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G GD G+ G +G+ G GE GP G +G TG+PG +RG PG V P ++G+ G++G +G G G GE G GP G+ GA G RG G G G NG PG+ G PG+PG +G G IGAPG G+RG G+ G+ G++G+PG GP G+ G G+ G P G+PG+D
Sbjct: 1171 GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV-----PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLP------GLAGEPGLVGLPGPIGPAGSKGERGLAGSP---GQPGQD 1362

HSP 6 Score: 60.4622 bits (145), Expect = 3.07495e-08
Identity = 79/206 (38.35%), Postives = 105/206 (50.97%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG------LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK--------------------PGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
G GD G+ G +G+ G GE GP G +G TG+PG +RG PG V P ++G+ G++G +G G G GE G GP G+ GA G RG G G G NG PG+ G PG+PG +G G IGAPG G+RG G+ G+ G++G+PG GP G+ G G+ G P G+PG+D
Sbjct: 1171 GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV-----PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLP------GLAGEPGLVGLPGPIGPAGSKGERGLAGSP---GQPGQD 1362

HSP 7 Score: 58.9214 bits (141), Expect = 8.08368e-08
Identity = 74/209 (35.41%), Postives = 92/209 (44.02%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPP------GELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN------------------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G+ GD+G GPAG+ GPP G G DGAKG+ GSPGL G+PG+ KG+ G G G GFAG +G GK GP GIPG +G +G G G+ G + GAPG G G PG G+ G G+ G G+ G G G GP G+ G GP+G PG
Sbjct: 907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGN------------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQG------------------FPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085

HSP 8 Score: 58.9214 bits (141), Expect = 8.08368e-08
Identity = 74/209 (35.41%), Postives = 92/209 (44.02%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGPP------GELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN------------------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G+ GD+G GPAG+ GPP G G DGAKG+ GSPGL G+PG+ KG+ G G G GFAG +G GK GP GIPG +G +G G G+ G + GAPG G G PG G+ G G+ G G+ G G G GP G+ G GP+G PG
Sbjct: 907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGN------------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQG------------------FPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085

HSP 9 Score: 58.5362 bits (140), Expect = 1.22029e-07
Identity = 76/182 (41.76%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 5831 GPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRG---YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQ------VGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
GPAG +G G G G G+ G PG G+ GD GP G +G GL G +G +G +G G GPSG VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ +GI G G G G G G +G+PGP G GE
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGE 1523

HSP 10 Score: 58.5362 bits (140), Expect = 1.22029e-07
Identity = 76/182 (41.76%), Postives = 92/182 (50.55%), Query Frame = -2
Query: 2211 GPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRG---YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQ------VGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2720
GPAG +G G G G G+ G PG G+ GD GP G +G GL G +G +G +G G GPSG VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ +GI G G G G G G +G+PGP G GE
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGE 1523

HSP 11 Score: 58.5362 bits (140), Expect = 1.29424e-07
Identity = 79/206 (38.35%), Postives = 95/206 (46.12%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGP--------DGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGN---DGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK---PGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGP------------SGKPGED 6343
G GD G G G++G GE G D G+ G+PG G PG G G+ G PG KG+ G+ GG+ S AGP G+ G G GIPG G RG PGE G G+ G G NG+ PG+ G DG G GA G G + G G G PG+ G G G +G+ G PGP SG PG D
Sbjct: 496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701

HSP 12 Score: 58.5362 bits (140), Expect = 1.29424e-07
Identity = 79/206 (38.35%), Postives = 95/206 (46.12%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGP--------DGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGN---DGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK---PGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGP------------SGKPGED 2747
G GD G G G++G GE G D G+ G+PG G PG G G+ G PG KG+ G+ GG+ S AGP G+ G G GIPG G RG PGE G G+ G G NG+ PG+ G DG G GA G G + G G G PG+ G G G +G+ G PGP SG PG D
Sbjct: 496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701

HSP 13 Score: 57.7658 bits (138), Expect = 1.95375e-07
Identity = 70/184 (38.04%), Postives = 89/184 (48.37%), Query Frame = 2
Query: 5813 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPG---------LKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G G GP G RG PGE G DG G+TG PG +G G G G G PG ++ G++G G+PG G G G G GIPG G+ G+ GE G+ +GAPG++G PG+ G DG G+ GQ I G PG +G +GA G G G+ G G+PG
Sbjct: 591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL---SGAPGNDGTPGRAGRDGYP---------------------GIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPG 749

HSP 14 Score: 57.7658 bits (138), Expect = 1.95375e-07
Identity = 70/184 (38.04%), Postives = 89/184 (48.37%), Query Frame = -2
Query: 2214 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPG---------LKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2738
G G GP G RG PGE G DG G+TG PG +G G G G G PG ++ G++G G+PG G G G G GIPG G+ G+ GE G+ +GAPG++G PG+ G DG G+ GQ I G PG +G +GA G G G+ G G+PG
Sbjct: 591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL---SGAPGNDGTPGRAGRDGYP---------------------GIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPG 749

HSP 15 Score: 57.7658 bits (138), Expect = 2.25382e-07
Identity = 84/185 (45.41%), Postives = 95/185 (51.35%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---GFAGPSGEVGKLGPVGIPGAA--GQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
N G+ G G GP G G PGE G G KG TG +G PG GP G GP G KGN G G G+P G G G G+ GP G PG + G G PG G+ G+ G G G G PGADGSVG G G G G SG G G G VG +G G GP G G DG+ G+ G G+PG
Sbjct: 763 NKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGP---QGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPG 944

HSP 16 Score: 57.7658 bits (138), Expect = 2.25382e-07
Identity = 84/185 (45.41%), Postives = 95/185 (51.35%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---GFAGPSGEVGKLGPVGIPGAA--GQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
N G+ G G GP G G PGE G G KG TG +G PG GP G GP G KGN G G G+P G G G G+ GP G PG + G G PG G+ G+ G G G G PGADGSVG G G G G SG G G G VG +G G GP G G DG+ G+ G G+PG
Sbjct: 763 NKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGP---QGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPG 944

HSP 17 Score: 57.3806 bits (137), Expect = 2.9742e-07
Identity = 77/197 (39.09%), Postives = 100/197 (50.76%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAK------------GKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS---GEVGKLGPVGIPGAAGQR---GYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G+ G G +G G+ G PG +GP G+K G+ G PG G+ GD GP G +G GL G +G +G +G G GPS G VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ G G+ G G G G G++G+ G G+PG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPG 1516

HSP 18 Score: 57.3806 bits (137), Expect = 2.9742e-07
Identity = 77/197 (39.09%), Postives = 100/197 (50.76%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGPPGELGPDGAK------------GKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS---GEVGKLGPVGIPGAAGQR---GYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G+ G G +G G+ G PG +GP G+K G+ G PG G+ GD GP G +G GL G +G +G +G G GPS G VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ G G+ G G G G G++G+ G G+PG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPG 1516

HSP 19 Score: 56.6102 bits (135), Expect = 4.84248e-07
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = 2
Query: 5819 MGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
MG G G+ G PG+ G DG G+ G+ G G+ GPPGL G+ +G +G PG PSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G+ G+ G G+ G +G G G +G PG G PG D
Sbjct: 1018 MGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL---------DGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGR---------------------DGINGEKGEQGLQGVWG---QPGEKGSVGAPGIPGAPGMD 1155

HSP 20 Score: 56.6102 bits (135), Expect = 4.84248e-07
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = -2
Query: 2208 MGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2732
MG G G+ G PG+ G DG G+ G+ G G+ GPPGL G+ +G +G PG PSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G+ G+ G G+ G +G G G +G PG G PG D
Sbjct: 1018 MGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL---------DGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGR---------------------DGINGEKGEQGLQGVWG---QPGEKGSVGAPGIPGAPGMD 1155

HSP 21 Score: 54.6842 bits (130), Expect = 1.93776e-06
Identity = 71/181 (39.23%), Postives = 83/181 (45.86%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
N G G +G +G G G PG GP G KG+ G PG G GD G G G G G G +G G+PG G +G+ G G GIPG G G PG G G+ G+ G G+P K D + G+ G G RG G G G PG G G SGP G G G G GE
Sbjct: 90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGE------------KGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGE 258

HSP 22 Score: 54.6842 bits (130), Expect = 1.93776e-06
Identity = 71/181 (39.23%), Postives = 83/181 (45.86%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
N G G +G +G G G PG GP G KG+ G PG G GD G G G G G G +G G+PG G +G+ G G GIPG G G PG G G+ G+ G G+P K D + G+ G G RG G G G PG G G SGP G G G G GE
Sbjct: 90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGE------------KGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGE 258

HSP 23 Score: 54.299 bits (129), Expect = 2.62236e-06
Identity = 75/210 (35.71%), Postives = 85/210 (40.48%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLR------------------GIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFA------------------GPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPG 6319
N G G G +G G RGP G G GAKG G+ GL GI GD G G G GL G G +G QG PG GPSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G G G+ G+ GV G G G+ G GI G PG
Sbjct: 963 NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGRDG------------------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPG 1153

HSP 24 Score: 54.299 bits (129), Expect = 2.62236e-06
Identity = 75/210 (35.71%), Postives = 85/210 (40.48%), Query Frame = -2
Query: 2232 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLR------------------GIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFA------------------GPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPG 2753
N G G G +G G RGP G G GAKG G+ GL GI GD G G G GL G G +G QG PG GPSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G G G+ G+ GV G G G+ G GI G PG
Sbjct: 963 NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGRDG------------------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPG 1153
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581822|ref|NP_723045.1| (collagen type IV, isoform B [Drosophila melanogaster])

HSP 1 Score: 66.2402 bits (160), Expect = 5.08653e-10
Identity = 84/190 (44.21%), Postives = 100/190 (52.63%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXX------XXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
N G G G GP G+ GP GE G GA G G+PG LRGIPG NG G +G PG+ G G G G G G+ G GP+G PGA G GYPG+ G G PG +G+PG G G VG IG G G G G GA+G G G++G+PG+ G GA G DG G G +G PG+
Sbjct: 793 NTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGD---RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGK 978

HSP 2 Score: 66.2402 bits (160), Expect = 5.08653e-10
Identity = 84/190 (44.21%), Postives = 100/190 (52.63%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXX------XXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
N G G G GP G+ GP GE G GA G G+PG LRGIPG NG G +G PG+ G G G G G G+ G GP+G PGA G GYPG+ G G PG +G+PG G G VG IG G G G G GA+G G G++G+PG+ G GA G DG G G +G PG+
Sbjct: 793 NTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGD---RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGK 978

HSP 3 Score: 63.929 bits (154), Expect = 2.47019e-09
Identity = 69/166 (41.57%), Postives = 86/166 (51.81%), Query Frame = 2
Query: 5840 GIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G RG PG LGP G KG+ G PG+ G GD G++G PG G G++G +GSPG G +G G GP G PGA G G+ G G++G PG G G PG G G++G+ G G+ A+G G+ G G G GP G G G G GP G G
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDK---GQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGIN---GKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKG 248

HSP 4 Score: 63.929 bits (154), Expect = 2.47019e-09
Identity = 69/166 (41.57%), Postives = 86/166 (51.81%), Query Frame = -2
Query: 2214 GIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2711
G RG PG LGP G KG+ G PG+ G GD G++G PG G G++G +GSPG G +G G GP G PGA G G+ G G++G PG G G PG G G++G+ G G+ A+G G+ G G G GP G G G G GP G G
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDK---GQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGIN---GKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKG 248

HSP 5 Score: 60.4622 bits (145), Expect = 3.07495e-08
Identity = 79/206 (38.35%), Postives = 105/206 (50.97%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG------LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK--------------------PGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G GD G+ G +G+ G GE GP G +G TG+PG +RG PG V P ++G+ G++G +G G G GE G GP G+ GA G RG G G G NG PG+ G PG+PG +G G IGAPG G+RG G+ G+ G++G+PG GP G+ G G+ G P G+PG+D
Sbjct: 1171 GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV-----PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLP------GLAGEPGLVGLPGPIGPAGSKGERGLAGSP---GQPGQD 1362

HSP 6 Score: 60.4622 bits (145), Expect = 3.07495e-08
Identity = 79/206 (38.35%), Postives = 105/206 (50.97%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG------LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK--------------------PGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
G GD G+ G +G+ G GE GP G +G TG+PG +RG PG V P ++G+ G++G +G G G GE G GP G+ GA G RG G G G NG PG+ G PG+PG +G G IGAPG G+RG G+ G+ G++G+PG GP G+ G G+ G P G+PG+D
Sbjct: 1171 GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV-----PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLP------GLAGEPGLVGLPGPIGPAGSKGERGLAGSP---GQPGQD 1362

HSP 7 Score: 58.9214 bits (141), Expect = 8.08368e-08
Identity = 74/209 (35.41%), Postives = 92/209 (44.02%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPP------GELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN------------------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G+ GD+G GPAG+ GPP G G DGAKG+ GSPGL G+PG+ KG+ G G G GFAG +G GK GP GIPG +G +G G G+ G + GAPG G G PG G+ G G+ G G+ G G G GP G+ G GP+G PG
Sbjct: 907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGN------------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQG------------------FPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085

HSP 8 Score: 58.9214 bits (141), Expect = 8.08368e-08
Identity = 74/209 (35.41%), Postives = 92/209 (44.02%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGPP------GELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN------------------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G+ GD+G GPAG+ GPP G G DGAKG+ GSPGL G+PG+ KG+ G G G GFAG +G GK GP GIPG +G +G G G+ G + GAPG G G PG G+ G G+ G G+ G G G GP G+ G GP+G PG
Sbjct: 907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGN------------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQG------------------FPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085

HSP 9 Score: 58.5362 bits (140), Expect = 1.22029e-07
Identity = 76/182 (41.76%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 5831 GPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRG---YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQ------VGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
GPAG +G G G G G+ G PG G+ GD GP G +G GL G +G +G +G G GPSG VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ +GI G G G G G G +G+PGP G GE
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGE 1523

HSP 10 Score: 58.5362 bits (140), Expect = 1.22029e-07
Identity = 76/182 (41.76%), Postives = 92/182 (50.55%), Query Frame = -2
Query: 2211 GPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRG---YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQ------VGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2720
GPAG +G G G G G+ G PG G+ GD GP G +G GL G +G +G +G G GPSG VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ +GI G G G G G G +G+PGP G GE
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGE 1523

HSP 11 Score: 58.5362 bits (140), Expect = 1.29424e-07
Identity = 79/206 (38.35%), Postives = 95/206 (46.12%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGP--------DGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGN---DGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK---PGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGP------------SGKPGED 6343
G GD G G G++G GE G D G+ G+PG G PG G G+ G PG KG+ G+ GG+ S AGP G+ G G GIPG G RG PGE G G+ G G NG+ PG+ G DG G GA G G + G G G PG+ G G G +G+ G PGP SG PG D
Sbjct: 496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701

HSP 12 Score: 58.5362 bits (140), Expect = 1.29424e-07
Identity = 79/206 (38.35%), Postives = 95/206 (46.12%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGP--------DGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGN---DGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK---PGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGP------------SGKPGED 2747
G GD G G G++G GE G D G+ G+PG G PG G G+ G PG KG+ G+ GG+ S AGP G+ G G GIPG G RG PGE G G+ G G NG+ PG+ G DG G GA G G + G G G PG+ G G G +G+ G PGP SG PG D
Sbjct: 496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701

HSP 13 Score: 57.7658 bits (138), Expect = 1.95375e-07
Identity = 70/184 (38.04%), Postives = 89/184 (48.37%), Query Frame = 2
Query: 5813 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPG---------LKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G G GP G RG PGE G DG G+TG PG +G G G G G PG ++ G++G G+PG G G G G GIPG G+ G+ GE G+ +GAPG++G PG+ G DG G+ GQ I G PG +G +GA G G G+ G G+PG
Sbjct: 591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL---SGAPGNDGTPGRAGRDGYP---------------------GIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPG 749

HSP 14 Score: 57.7658 bits (138), Expect = 1.95375e-07
Identity = 70/184 (38.04%), Postives = 89/184 (48.37%), Query Frame = -2
Query: 2214 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPG---------LKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2738
G G GP G RG PGE G DG G+TG PG +G G G G G PG ++ G++G G+PG G G G G GIPG G+ G+ GE G+ +GAPG++G PG+ G DG G+ GQ I G PG +G +GA G G G+ G G+PG
Sbjct: 591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL---SGAPGNDGTPGRAGRDGYP---------------------GIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPG 749

HSP 15 Score: 57.7658 bits (138), Expect = 2.25382e-07
Identity = 84/185 (45.41%), Postives = 95/185 (51.35%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---GFAGPSGEVGKLGPVGIPGAA--GQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
N G+ G G GP G G PGE G G KG TG +G PG GP G GP G KGN G G G+P G G G G+ GP G PG + G G PG G+ G+ G G G G PGADGSVG G G G G SG G G G VG +G G GP G G DG+ G+ G G+PG
Sbjct: 763 NKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGP---QGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPG 944

HSP 16 Score: 57.7658 bits (138), Expect = 2.25382e-07
Identity = 84/185 (45.41%), Postives = 95/185 (51.35%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---GFAGPSGEVGKLGPVGIPGAA--GQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
N G+ G G GP G G PGE G G KG TG +G PG GP G GP G KGN G G G+P G G G G+ GP G PG + G G PG G+ G+ G G G G PGADGSVG G G G G SG G G G VG +G G GP G G DG+ G+ G G+PG
Sbjct: 763 NKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGP---QGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPG 944

HSP 17 Score: 57.3806 bits (137), Expect = 2.9742e-07
Identity = 77/197 (39.09%), Postives = 100/197 (50.76%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAK------------GKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS---GEVGKLGPVGIPGAAGQR---GYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G+ G G +G G+ G PG +GP G+K G+ G PG G+ GD GP G +G GL G +G +G +G G GPS G VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ G G+ G G G G G++G+ G G+PG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPG 1516

HSP 18 Score: 57.3806 bits (137), Expect = 2.9742e-07
Identity = 77/197 (39.09%), Postives = 100/197 (50.76%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGPPGELGPDGAK------------GKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS---GEVGKLGPVGIPGAAGQR---GYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G+ G G +G G+ G PG +GP G+K G+ G PG G+ GD GP G +G GL G +G +G +G G GPS G VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ G G+ G G G G G++G+ G G+PG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPG 1516

HSP 19 Score: 56.6102 bits (135), Expect = 4.84248e-07
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = 2
Query: 5819 MGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
MG G G+ G PG+ G DG G+ G+ G G+ GPPGL G+ +G +G PG PSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G+ G+ G G+ G +G G G +G PG G PG D
Sbjct: 1018 MGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL---------DGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGR---------------------DGINGEKGEQGLQGVWG---QPGEKGSVGAPGIPGAPGMD 1155

HSP 20 Score: 56.6102 bits (135), Expect = 4.84248e-07
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = -2
Query: 2208 MGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2732
MG G G+ G PG+ G DG G+ G+ G G+ GPPGL G+ +G +G PG PSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G+ G+ G G+ G +G G G +G PG G PG D
Sbjct: 1018 MGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL---------DGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGR---------------------DGINGEKGEQGLQGVWG---QPGEKGSVGAPGIPGAPGMD 1155

HSP 21 Score: 54.6842 bits (130), Expect = 1.93776e-06
Identity = 71/181 (39.23%), Postives = 83/181 (45.86%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
N G G +G +G G G PG GP G KG+ G PG G GD G G G G G G +G G+PG G +G+ G G GIPG G G PG G G+ G+ G G+P K D + G+ G G RG G G G PG G G SGP G G G G GE
Sbjct: 90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGE------------KGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGE 258

HSP 22 Score: 54.6842 bits (130), Expect = 1.93776e-06
Identity = 71/181 (39.23%), Postives = 83/181 (45.86%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
N G G +G +G G G PG GP G KG+ G PG G GD G G G G G G +G G+PG G +G+ G G GIPG G G PG G G+ G+ G G+P K D + G+ G G RG G G G PG G G SGP G G G G GE
Sbjct: 90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGE------------KGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGE 258

HSP 23 Score: 54.299 bits (129), Expect = 2.62236e-06
Identity = 75/210 (35.71%), Postives = 85/210 (40.48%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLR------------------GIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFA------------------GPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPG 6319
N G G G +G G RGP G G GAKG G+ GL GI GD G G G GL G G +G QG PG GPSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G G G+ G+ GV G G G+ G GI G PG
Sbjct: 963 NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGRDG------------------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPG 1153

HSP 24 Score: 54.299 bits (129), Expect = 2.62236e-06
Identity = 75/210 (35.71%), Postives = 85/210 (40.48%), Query Frame = -2
Query: 2232 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLR------------------GIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFA------------------GPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPG 2753
N G G G +G G RGP G G GAKG G+ GL GI GD G G G GL G G +G QG PG GPSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G G G+ G+ GV G G G+ G GI G PG
Sbjct: 963 NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGRDG------------------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPG 1153
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581824|ref|NP_723046.1| (collagen type IV, isoform C [Drosophila melanogaster])

HSP 1 Score: 66.2402 bits (160), Expect = 5.08653e-10
Identity = 84/190 (44.21%), Postives = 100/190 (52.63%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXX------XXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
N G G G GP G+ GP GE G GA G G+PG LRGIPG NG G +G PG+ G G G G G G+ G GP+G PGA G GYPG+ G G PG +G+PG G G VG IG G G G G GA+G G G++G+PG+ G GA G DG G G +G PG+
Sbjct: 793 NTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGD---RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGK 978

HSP 2 Score: 66.2402 bits (160), Expect = 5.08653e-10
Identity = 84/190 (44.21%), Postives = 100/190 (52.63%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG---LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXX------XXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
N G G G GP G+ GP GE G GA G G+PG LRGIPG NG G +G PG+ G G G G G G+ G GP+G PGA G GYPG+ G G PG +G+PG G G VG IG G G G G GA+G G G++G+PG+ G GA G DG G G +G PG+
Sbjct: 793 NTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGD---RGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGK 978

HSP 3 Score: 63.929 bits (154), Expect = 2.47019e-09
Identity = 69/166 (41.57%), Postives = 86/166 (51.81%), Query Frame = 2
Query: 5840 GIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G RG PG LGP G KG+ G PG+ G GD G++G PG G G++G +GSPG G +G G GP G PGA G G+ G G++G PG G G PG G G++G+ G G+ A+G G+ G G G GP G G G G GP G G
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDK---GQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGIN---GKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKG 248

HSP 4 Score: 63.929 bits (154), Expect = 2.47019e-09
Identity = 69/166 (41.57%), Postives = 86/166 (51.81%), Query Frame = -2
Query: 2214 GIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2711
G RG PG LGP G KG+ G PG+ G GD G++G PG G G++G +GSPG G +G G GP G PGA G G+ G G++G PG G G PG G G++G+ G G+ A+G G+ G G G GP G G G G GP G G
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDK---GQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGIN---GKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKG 248

HSP 5 Score: 60.4622 bits (145), Expect = 3.07495e-08
Identity = 79/206 (38.35%), Postives = 105/206 (50.97%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG------LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK--------------------PGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G GD G+ G +G+ G GE GP G +G TG+PG +RG PG V P ++G+ G++G +G G G GE G GP G+ GA G RG G G G NG PG+ G PG+PG +G G IGAPG G+RG G+ G+ G++G+PG GP G+ G G+ G P G+PG+D
Sbjct: 1171 GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV-----PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLP------GLAGEPGLVGLPGPIGPAGSKGERGLAGSP---GQPGQD 1362

HSP 6 Score: 60.4622 bits (145), Expect = 3.07495e-08
Identity = 79/206 (38.35%), Postives = 105/206 (50.97%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPG------LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK--------------------PGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2747
G GD G+ G +G+ G GE GP G +G TG+PG +RG PG V P ++G+ G++G +G G G GE G GP G+ GA G RG G G G NG PG+ G PG+PG +G G IGAPG G+RG G+ G+ G++G+PG GP G+ G G+ G P G+PG+D
Sbjct: 1171 GDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATV-----PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLP------GLAGEPGLVGLPGPIGPAGSKGERGLAGSP---GQPGQD 1362

HSP 7 Score: 58.9214 bits (141), Expect = 8.08368e-08
Identity = 74/209 (35.41%), Postives = 92/209 (44.02%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPP------GELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN------------------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G+ GD+G GPAG+ GPP G G DGAKG+ GSPGL G+PG+ KG+ G G G GFAG +G GK GP GIPG +G +G G G+ G + GAPG G G PG G+ G G+ G G+ G G G GP G+ G GP+G PG
Sbjct: 907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGN------------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQG------------------FPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085

HSP 8 Score: 58.9214 bits (141), Expect = 8.08368e-08
Identity = 74/209 (35.41%), Postives = 92/209 (44.02%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGPP------GELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKN------------------------GAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G+ GD+G GPAG+ GPP G G DGAKG+ GSPGL G+PG+ KG+ G G G GFAG +G GK GP GIPG +G +G G G+ G + GAPG G G PG G+ G G+ G G+ G G G GP G+ G GP+G PG
Sbjct: 907 VGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGN------------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQG------------------FPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085

HSP 9 Score: 58.5362 bits (140), Expect = 1.22029e-07
Identity = 76/182 (41.76%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 5831 GPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRG---YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQ------VGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
GPAG +G G G G G+ G PG G+ GD GP G +G GL G +G +G +G G GPSG VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ +GI G G G G G G +G+PGP G GE
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGE 1523

HSP 10 Score: 58.5362 bits (140), Expect = 1.22029e-07
Identity = 76/182 (41.76%), Postives = 92/182 (50.55%), Query Frame = -2
Query: 2211 GPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGE---VGKLGPVGIPGAAGQRG---YPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQ------VGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2720
GPAG +G G G G G+ G PG G+ GD GP G +G GL G +G +G +G G GPSG VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ +GI G G G G G G +G+PGP G GE
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGE 1523

HSP 11 Score: 58.5362 bits (140), Expect = 1.29424e-07
Identity = 79/206 (38.35%), Postives = 95/206 (46.12%), Query Frame = 2
Query: 5804 GKDGDMGKSGPAGIRGPPGELGP--------DGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGN---DGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK---PGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGP------------SGKPGED 6343
G GD G G G++G GE G D G+ G+PG G PG G G+ G PG KG+ G+ GG+ S AGP G+ G G GIPG G RG PGE G G+ G G NG+ PG+ G DG G GA G G + G G G PG+ G G G +G+ G PGP SG PG D
Sbjct: 496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701

HSP 12 Score: 58.5362 bits (140), Expect = 1.29424e-07
Identity = 79/206 (38.35%), Postives = 95/206 (46.12%), Query Frame = -2
Query: 2208 GKDGDMGKSGPAGIRGPPGELGP--------DGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGN---DGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGK---PGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGP------------SGKPGED 2747
G GD G G G++G GE G D G+ G+PG G PG G G+ G PG KG+ G+ GG+ S AGP G+ G G GIPG G RG PGE G G+ G G NG+ PG+ G DG G GA G G + G G G PG+ G G G +G+ G PGP SG PG D
Sbjct: 496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGND 701

HSP 13 Score: 57.7658 bits (138), Expect = 1.95375e-07
Identity = 70/184 (38.04%), Postives = 89/184 (48.37%), Query Frame = 2
Query: 5813 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPG---------LKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G G GP G RG PGE G DG G+TG PG +G G G G G PG ++ G++G G+PG G G G G GIPG G+ G+ GE G+ +GAPG++G PG+ G DG G+ GQ I G PG +G +GA G G G+ G G+PG
Sbjct: 591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL---SGAPGNDGTPGRAGRDGYP---------------------GIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPG 749

HSP 14 Score: 57.7658 bits (138), Expect = 1.95375e-07
Identity = 70/184 (38.04%), Postives = 89/184 (48.37%), Query Frame = -2
Query: 2214 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPG---------LKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2738
G G GP G RG PGE G DG G+TG PG +G G G G G PG ++ G++G G+PG G G G G GIPG G+ G+ GE G+ +GAPG++G PG+ G DG G+ GQ I G PG +G +GA G G G+ G G+PG
Sbjct: 591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL---SGAPGNDGTPGRAGRDGYP---------------------GIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPG 749

HSP 15 Score: 57.7658 bits (138), Expect = 2.25382e-07
Identity = 84/185 (45.41%), Postives = 95/185 (51.35%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---GFAGPSGEVGKLGPVGIPGAA--GQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
N G+ G G GP G G PGE G G KG TG +G PG GP G GP G KGN G G G+P G G G G+ GP G PG + G G PG G+ G+ G G G G PGADGSVG G G G G SG G G G VG +G G GP G G DG+ G+ G G+PG
Sbjct: 763 NKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGP---QGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPG 944

HSP 16 Score: 57.7658 bits (138), Expect = 2.25382e-07
Identity = 84/185 (45.41%), Postives = 95/185 (51.35%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSP---GFAGPSGEVGKLGPVGIPGAA--GQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
N G+ G G GP G G PGE G G KG TG +G PG GP G GP G KGN G G G+P G G G G+ GP G PG + G G PG G+ G+ G G G G PGADGSVG G G G G SG G G G VG +G G GP G G DG+ G+ G G+PG
Sbjct: 763 NKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGP---QGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPG 944

HSP 17 Score: 57.3806 bits (137), Expect = 2.9742e-07
Identity = 77/197 (39.09%), Postives = 100/197 (50.76%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAK------------GKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS---GEVGKLGPVGIPGAAGQR---GYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
+G+ G G +G G+ G PG +GP G+K G+ G PG G+ GD GP G +G GL G +G +G +G G GPS G VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ G G+ G G G G G++G+ G G+PG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPG 1516

HSP 18 Score: 57.3806 bits (137), Expect = 2.9742e-07
Identity = 77/197 (39.09%), Postives = 100/197 (50.76%), Query Frame = -2
Query: 2214 LGKDGDMGKSGPAGIRGPPGELGPDGAK------------GKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPS---GEVGKLGPVGIPGAAGQR---GYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2750
+G+ G G +G G+ G PG +GP G+K G+ G PG G+ GD GP G +G GL G +G +G +G G GPS G VG+ G G PG G G PGE G G G G +G PG PG G G + PGP G+ G G G +G G+ G G+ G G G G G++G+ G G+PG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPG 1516

HSP 19 Score: 56.6102 bits (135), Expect = 4.84248e-07
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = 2
Query: 5819 MGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
MG G G+ G PG+ G DG G+ G+ G G+ GPPGL G+ +G +G PG PSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G+ G+ G G+ G +G G G +G PG G PG D
Sbjct: 1018 MGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL---------DGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGR---------------------DGINGEKGEQGLQGVWG---QPGEKGSVGAPGIPGAPGMD 1155

HSP 20 Score: 56.6102 bits (135), Expect = 4.84248e-07
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = -2
Query: 2208 MGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2732
MG G G+ G PG+ G DG G+ G+ G G+ GPPGL G+ +G +G PG PSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G+ G+ G G+ G +G G G +G PG G PG D
Sbjct: 1018 MGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL---------DGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGR---------------------DGINGEKGEQGLQGVWG---QPGEKGSVGAPGIPGAPGMD 1155

HSP 21 Score: 54.6842 bits (130), Expect = 1.93776e-06
Identity = 71/181 (39.23%), Postives = 83/181 (45.86%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
N G G +G +G G G PG GP G KG+ G PG G GD G G G G G G +G G+PG G +G+ G G GIPG G G PG G G+ G+ G G+P K D + G+ G G RG G G G PG G G SGP G G G G GE
Sbjct: 90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGE------------KGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGE 258

HSP 22 Score: 54.6842 bits (130), Expect = 1.93776e-06
Identity = 71/181 (39.23%), Postives = 83/181 (45.86%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
N G G +G +G G G PG GP G KG+ G PG G GD G G G G G G +G G+PG G +G+ G G GIPG G G PG G G+ G+ G G+P K D + G+ G G RG G G G PG G G SGP G G G G GE
Sbjct: 90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGE------------KGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGE 258

HSP 23 Score: 54.299 bits (129), Expect = 2.62236e-06
Identity = 75/210 (35.71%), Postives = 85/210 (40.48%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLR------------------GIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFA------------------GPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPG 6319
N G G G +G G RGP G G GAKG G+ GL GI GD G G G GL G G +G QG PG GPSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G G G+ G+ GV G G G+ G GI G PG
Sbjct: 963 NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGRDG------------------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPG 1153

HSP 24 Score: 54.299 bits (129), Expect = 2.62236e-06
Identity = 75/210 (35.71%), Postives = 85/210 (40.48%), Query Frame = -2
Query: 2232 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLR------------------GIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFA------------------GPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPG 2753
N G G G +G G RGP G G GAKG G+ GL GI GD G G G GL G G +G QG PG GPSG G GP G PG G++G PG L VHG+ G PG G G+ G DG G G G+ G+ GV G G G+ G GI G PG
Sbjct: 963 NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPG-LAVHGRAGPPGEKGDQGRSGIDGRDG------------------INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPG 1153
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|17137252|ref|NP_477190.1| (viking, isoform A [Drosophila melanogaster])

HSP 1 Score: 63.929 bits (154), Expect = 2.54847e-09
Identity = 81/216 (37.50%), Postives = 100/216 (46.30%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT---------GSPGLRGIPGDNGPVGKQGPPGLKGN---------------------DGNEGGQGSPGFAGPSGEVGKLGPVG--IPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXX---ARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G+ GD G +G G G PG G DGA G+ G PG GI G+ G G G G+KG G +G +G G G GE+G GP G IPG G +GYPG G +G+ GAPG G+ G+PG DG +G G G G G IG G+ G G +G PG YG G GP G+ G+ GP G G+
Sbjct: 645 ETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQ 860

HSP 2 Score: 63.929 bits (154), Expect = 2.54847e-09
Identity = 81/216 (37.50%), Postives = 100/216 (46.30%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT---------GSPGLRGIPGDNGPVGKQGPPGLKGN---------------------DGNEGGQGSPGFAGPSGEVGKLGPVG--IPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXG---ARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
G+ GD G +G G G PG G DGA G+ G PG GI G+ G G G G+KG G +G +G G G GE+G GP G IPG G +GYPG G +G+ GAPG G+ G+PG DG +G G G G G IG G+ G G +G PG YG G GP G+ G+ GP G G+
Sbjct: 645 ETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQ 860

HSP 3 Score: 61.2326 bits (147), Expect = 2.03014e-08
Identity = 70/193 (36.27%), Postives = 93/193 (48.19%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGP-----------NGASGPDGILGKPGPSGKPGED 6343
+LG++G G G G G G LG G +G GSPG+ G+PG G +G++G G G G+ GP G G+ GP G+ G G GYPG G+ G+ G G+ G PG+PGA G G G G G+TG +G G PG+ G +G +G G +G PGP+G PG
Sbjct: 904 SLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD---------IGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAY---------SGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRH 1078

HSP 4 Score: 61.2326 bits (147), Expect = 2.03014e-08
Identity = 70/193 (36.27%), Postives = 93/193 (48.19%), Query Frame = -2
Query: 2208 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGP-----------NGASGPDGILGKPGPSGKPGED 2753
+LG++G G G G G G LG G +G GSPG+ G+PG G +G++G G G G+ GP G G+ GP G+ G G GYPG G+ G+ G G+ G PG+PGA G G G G G+TG +G G PG+ G +G +G G +G PGP+G PG
Sbjct: 904 SLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD---------IGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAY---------SGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRH 1078

HSP 5 Score: 60.8474 bits (146), Expect = 2.52576e-08
Identity = 71/180 (39.44%), Postives = 87/180 (48.33%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
LG G G G GI G PG +G G +G+ G G +G G GP G+ GP GL G+DG +G G+ G G GE G G G PGA G Y G G G++G G G PG PGA G G + GV G+ G +G P GPNG G G+ G+ G G PG+
Sbjct: 926 LGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPV----------GDSQPALDGVAGRKGEVGSP---GPNGLPGRHGLKGQRGDRGLPGQ 1092

HSP 6 Score: 60.8474 bits (146), Expect = 2.52576e-08
Identity = 71/180 (39.44%), Postives = 87/180 (48.33%), Query Frame = -2
Query: 2211 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2750
LG G G G GI G PG +G G +G+ G G +G G GP G+ GP GL G+DG +G G+ G G GE G G G PGA G Y G G G++G G G PG PGA G G + GV G+ G +G P GPNG G G+ G+ G G PG+
Sbjct: 926 LGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPV----------GDSQPALDGVAGRKGEVGSP---GPNGLPGRHGLKGQRGDRGLPGQ 1092

HSP 7 Score: 57.3806 bits (137), Expect = 2.83908e-07
Identity = 73/180 (40.56%), Postives = 90/180 (50.00%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
++G G G +G G +G GE GPDGA G+TG PG +G GD N G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+IG G G G G IG RG G+ G G+ G GP+G G +G+ G+ G +G PG
Sbjct: 830 DVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRN----GRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPG 1005

HSP 8 Score: 57.3806 bits (137), Expect = 2.83908e-07
Identity = 73/180 (40.56%), Postives = 90/180 (50.00%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
++G G G +G G +G GE GPDGA G+TG PG +G GD N G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+IG G G G G IG RG G+ G G+ G GP+G G +G+ G+ G +G PG
Sbjct: 830 DVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRN----GRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPG 1005

HSP 9 Score: 55.0694 bits (131), Expect = 1.37744e-06
Identity = 74/189 (39.15%), Postives = 87/189 (46.03%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT--------GSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
+ G GD G +G G +G PG GP G G G PG +G PGD+ + LKG G G QG G GP+GE G +G G+PGA G+ G PGE G GK+G PG G G GA G G G G G RG G G+ GV G GP G P PGP G G+
Sbjct: 189 DRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTG---------ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGD 368

HSP 10 Score: 55.0694 bits (131), Expect = 1.37744e-06
Identity = 74/189 (39.15%), Postives = 87/189 (46.03%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT--------GSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
+ G GD G +G G +G PG GP G G G PG +G PGD+ + LKG G G QG G GP+GE G +G G+PGA G+ G PGE G GK+G PG G G GA G G G G G RG G G+ GV G GP G P PGP G G+
Sbjct: 189 DRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTG---------ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGD 368

HSP 11 Score: 53.9138 bits (128), Expect = 3.05957e-06
Identity = 67/194 (34.54%), Postives = 85/194 (43.81%), Query Frame = 2
Query: 5813 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGG-----------------QGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G++G G +GI+G PG++G G G G PG +G+ G+ GP G G GL GN G G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+I G G++G G G GP G + G+ GP G G+D
Sbjct: 814 GEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEI------------------GERGEIGYNGRQGDIGPRGPN------GEFGPKGLSGDD 983

HSP 12 Score: 53.9138 bits (128), Expect = 3.05957e-06
Identity = 67/194 (34.54%), Postives = 85/194 (43.81%), Query Frame = -2
Query: 2208 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGG-----------------QGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2738
G++G G +GI+G PG++G G G G PG +G+ G+ GP G G GL GN G G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+I G G++G G G GP G + G+ GP G G+D
Sbjct: 814 GEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEI------------------GERGEIGYNGRQGDIGPRGPN------GEFGPKGLSGDD 983

HSP 13 Score: 53.5286 bits (127), Expect = 4.03694e-06
Identity = 91/256 (35.55%), Postives = 111/256 (43.36%), Query Frame = 2
Query: 4796 GKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXXDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNG 5563
G+ G+ G GS G+RG GLTG G +G+ G PG G G G G+PGE G KVG GP G+ G GE+G+ G+ G G G G G+ G + G+ G TGQ G G G QGR G PG G G+ G LIG PG G KG GD G G +G G P + G PG+ G GP+G G G+ G G+RGEIG G
Sbjct: 540 GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPG---------------------------------------KVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRG 755

HSP 14 Score: 53.5286 bits (127), Expect = 4.03694e-06
Identity = 91/256 (35.55%), Postives = 111/256 (43.36%), Query Frame = -2
Query: 2988 GKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNG 3755
G+ G+ G GS G+RG GLTG G +G+ G PG G G G G+PGE G KVG GP G+ G GE+G+ G+ G G G G G+ G + G+ G TGQ G G G QGR G PG G G+ G LIG PG G KG GD G G +G G P + G PG+ G GP+G G G+ G G+RGEIG G
Sbjct: 540 GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPG---------------------------------------KVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRG 755

HSP 15 Score: 53.5286 bits (127), Expect = 4.50276e-06
Identity = 77/185 (41.62%), Postives = 90/185 (48.65%), Query Frame = 2
Query: 5822 GKSGPAGIRGPPGELGPDGAKGKTGSPG--LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSN--------GKPGKPGADGSVGKIXXXXXXXXXXXXXXXXA---RGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G +G G+ GP GELG G +G+ G G + G GD G +G QG PG DG +G QG PG G +G VG GP G G AG G G G+ G G PG G G+PG DG G+ G G G G G GA RG G+VG G G G G G G+ G PG G PG
Sbjct: 1318 GHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGW---DGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG 1499

HSP 16 Score: 53.5286 bits (127), Expect = 4.50276e-06
Identity = 77/185 (41.62%), Postives = 90/185 (48.65%), Query Frame = -2
Query: 2214 GKSGPAGIRGPPGELGPDGAKGKTGSPG--LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSN--------GKPGKPGADGSVGKIXXXXXXXXXXXXXXXGA---RGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2729
G +G G+ GP GELG G +G+ G G + G GD G +G QG PG DG +G QG PG G +G VG GP G G AG G G G+ G G PG G G+PG DG G+ G G G G G GA RG G+VG G G G G G G+ G PG G PG
Sbjct: 1318 GHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGW---DGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG 1499
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|442626067|ref|NP_001260071.1| (viking, isoform B [Drosophila melanogaster])

HSP 1 Score: 63.929 bits (154), Expect = 2.54847e-09
Identity = 81/216 (37.50%), Postives = 100/216 (46.30%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT---------GSPGLRGIPGDNGPVGKQGPPGLKGN---------------------DGNEGGQGSPGFAGPSGEVGKLGPVG--IPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXX---ARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
G+ GD G +G G G PG G DGA G+ G PG GI G+ G G G G+KG G +G +G G G GE+G GP G IPG G +GYPG G +G+ GAPG G+ G+PG DG +G G G G G IG G+ G G +G PG YG G GP G+ G+ GP G G+
Sbjct: 645 ETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQ 860

HSP 2 Score: 63.929 bits (154), Expect = 2.54847e-09
Identity = 81/216 (37.50%), Postives = 100/216 (46.30%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT---------GSPGLRGIPGDNGPVGKQGPPGLKGN---------------------DGNEGGQGSPGFAGPSGEVGKLGPVG--IPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXG---ARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
G+ GD G +G G G PG G DGA G+ G PG GI G+ G G G G+KG G +G +G G G GE+G GP G IPG G +GYPG G +G+ GAPG G+ G+PG DG +G G G G G IG G+ G G +G PG YG G GP G+ G+ GP G G+
Sbjct: 645 ETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQ 860

HSP 3 Score: 61.2326 bits (147), Expect = 2.03014e-08
Identity = 70/193 (36.27%), Postives = 93/193 (48.19%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGP-----------NGASGPDGILGKPGPSGKPGED 6343
+LG++G G G G G G LG G +G GSPG+ G+PG G +G++G G G G+ GP G G+ GP G+ G G GYPG G+ G+ G G+ G PG+PGA G G G G G+TG +G G PG+ G +G +G G +G PGP+G PG
Sbjct: 904 SLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD---------IGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAY---------SGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRH 1078

HSP 4 Score: 61.2326 bits (147), Expect = 2.03014e-08
Identity = 70/193 (36.27%), Postives = 93/193 (48.19%), Query Frame = -2
Query: 2208 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGP-----------NGASGPDGILGKPGPSGKPGED 2753
+LG++G G G G G G LG G +G GSPG+ G+PG G +G++G G G G+ GP G G+ GP G+ G G GYPG G+ G+ G G+ G PG+PGA G G G G G+TG +G G PG+ G +G +G G +G PGP+G PG
Sbjct: 904 SLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGD---------IGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAY---------SGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRH 1078

HSP 5 Score: 60.8474 bits (146), Expect = 2.52576e-08
Identity = 71/180 (39.44%), Postives = 87/180 (48.33%), Query Frame = 2
Query: 5801 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
LG G G G GI G PG +G G +G+ G G +G G GP G+ GP GL G+DG +G G+ G G GE G G G PGA G Y G G G++G G G PG PGA G G + GV G+ G +G P GPNG G G+ G+ G G PG+
Sbjct: 926 LGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPV----------GDSQPALDGVAGRKGEVGSP---GPNGLPGRHGLKGQRGDRGLPGQ 1092

HSP 6 Score: 60.8474 bits (146), Expect = 2.52576e-08
Identity = 71/180 (39.44%), Postives = 87/180 (48.33%), Query Frame = -2
Query: 2211 LGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2750
LG G G G GI G PG +G G +G+ G G +G G GP G+ GP GL G+DG +G G+ G G GE G G G PGA G Y G G G++G G G PG PGA G G + GV G+ G +G P GPNG G G+ G+ G G PG+
Sbjct: 926 LGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPV----------GDSQPALDGVAGRKGEVGSP---GPNGLPGRHGLKGQRGDRGLPGQ 1092

HSP 7 Score: 57.3806 bits (137), Expect = 2.83908e-07
Identity = 73/180 (40.56%), Postives = 90/180 (50.00%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
++G G G +G G +G GE GPDGA G+TG PG +G GD N G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+IG G G G G IG RG G+ G G+ G GP+G G +G+ G+ G +G PG
Sbjct: 830 DVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRN----GRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPG 1005

HSP 8 Score: 57.3806 bits (137), Expect = 2.83908e-07
Identity = 73/180 (40.56%), Postives = 90/180 (50.00%), Query Frame = -2
Query: 2214 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2753
++G G G +G G +G GE GPDGA G+TG PG +G GD N G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+IG G G G G IG RG G+ G G+ G GP+G G +G+ G+ G +G PG
Sbjct: 830 DVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRN----GRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPG 1005

HSP 9 Score: 55.0694 bits (131), Expect = 1.37744e-06
Identity = 74/189 (39.15%), Postives = 87/189 (46.03%), Query Frame = 2
Query: 5798 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT--------GSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 6340
+ G GD G +G G +G PG GP G G G PG +G PGD+ + LKG G G QG G GP+GE G +G G+PGA G+ G PGE G GK+G PG G G GA G G G G G RG G G+ GV G GP G P PGP G G+
Sbjct: 189 DRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTG---------ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGD 368

HSP 10 Score: 55.0694 bits (131), Expect = 1.37744e-06
Identity = 74/189 (39.15%), Postives = 87/189 (46.03%), Query Frame = -2
Query: 2211 NLGKDGDMGKSGPAGIRGPPGELGPDGAKGKT--------GSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGE 2753
+ G GD G +G G +G PG GP G G G PG +G PGD+ + LKG G G QG G GP+GE G +G G+PGA G+ G PGE G GK+G PG G G GA G G G G G RG G G+ GV G GP G P PGP G G+
Sbjct: 189 DRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTG---------ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGD 368

HSP 11 Score: 53.9138 bits (128), Expect = 3.05957e-06
Identity = 67/194 (34.54%), Postives = 85/194 (43.81%), Query Frame = 2
Query: 5813 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGG-----------------QGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXXARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 6343
G++G G +GI+G PG++G G G G PG +G+ G+ GP G G GL GN G G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+I G G++G G G GP G + G+ GP G G+D
Sbjct: 814 GEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEI------------------GERGEIGYNGRQGDIGPRGPN------GEFGPKGLSGDD 983

HSP 12 Score: 53.9138 bits (128), Expect = 3.05957e-06
Identity = 67/194 (34.54%), Postives = 85/194 (43.81%), Query Frame = -2
Query: 2208 GDMGKSGPAGIRGPPGELGPDGAKGKTGSPGLRGIPGDNGPVGKQGPPGLKGNDGNEGG-----------------QGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIXXXXXXXXXXXXXXXGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGED 2738
G++G G +GI+G PG++G G G G PG +G+ G+ GP G G GL GN G G Q G G GEVG LG G GA G G+ G G+ G G G G PG PG G +G+I G G++G G G GP G + G+ GP G G+D
Sbjct: 814 GEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEI------------------GERGEIGYNGRQGDIGPRGPN------GEFGPKGLSGDD 983

HSP 13 Score: 53.5286 bits (127), Expect = 4.03694e-06
Identity = 91/256 (35.55%), Postives = 111/256 (43.36%), Query Frame = 2
Query: 4796 GKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXXDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNG 5563
G+ G+ G GS G+RG GLTG G +G+ G PG G G G G+PGE G KVG GP G+ G GE+G+ G+ G G G G G+ G + G+ G TGQ G G G QGR G PG G G+ G LIG PG G KG GD G G +G G P + G PG+ G GP+G G G+ G G+RGEIG G
Sbjct: 540 GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPG---------------------------------------KVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRG 755

HSP 14 Score: 53.5286 bits (127), Expect = 4.03694e-06
Identity = 91/256 (35.55%), Postives = 111/256 (43.36%), Query Frame = -2
Query: 2988 GKAGNAGVTGSPGSRGEPGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVGPPGPQGRMGSQGPPGNPGEMXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGNIGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEXXXXXXXXXXXXGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNG 3755
G+ G+ G GS G+RG GLTG G +G+ G PG G G G G+PGE G KVG GP G+ G GE+G+ G+ G G G G G+ G + G+ G TGQ G G G QGR G PG G G+ G LIG PG G KG GD G G +G G P + G PG+ G GP+G G G+ G G+RGEIG G
Sbjct: 540 GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPG---------------------------------------KVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRG 755

HSP 15 Score: 53.5286 bits (127), Expect = 4.50276e-06
Identity = 77/185 (41.62%), Postives = 90/185 (48.65%), Query Frame = 2
Query: 5822 GKSGPAGIRGPPGELGPDGAKGKTGSPG--LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSN--------GKPGKPGADGSVGKIXXXXXXXXXXXXXXXXA---RGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 6337
G +G G+ GP GELG G +G+ G G + G GD G +G QG PG DG +G QG PG G +G VG GP G G AG G G G+ G G PG G G+PG DG G+ G G G G G GA RG G+VG G G G G G G+ G PG G PG
Sbjct: 1318 GHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGW---DGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG 1499

HSP 16 Score: 53.5286 bits (127), Expect = 4.50276e-06
Identity = 77/185 (41.62%), Postives = 90/185 (48.65%), Query Frame = -2
Query: 2214 GKSGPAGIRGPPGELGPDGAKGKTGSPG--LRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPVGIPGAAGQRGYPGELGVHGKNGAPGSN--------GKPGKPGADGSVGKIXXXXXXXXXXXXXXXGA---RGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPG 2729
G +G G+ GP GELG G +G+ G G + G GD G +G QG PG DG +G QG PG G +G VG GP G G AG G G G+ G G PG G G+PG DG G+ G G G G G GA RG G+VG G G G G G G+ G PG G PG
Sbjct: 1318 GHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGW---DGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG 1499
The following BLAST results are available for this feature:
BLAST of collagen vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767973253|ref|XP_011536237.1|5.231240e-2230.32PREDICTED: collagen alpha-1(II) chain isoform X3 [... [more]
gi|4502951|ref|NP_000081.1|2.955450e-2131.08collagen alpha-1(III) chain preproprotein [Homo sa... [more]
gi|767902460|ref|XP_011539023.1|4.652310e-2133.64PREDICTED: collagen alpha-1(XI) chain isoform X3 [... [more]
gi|299523257|ref|NP_001177638.1|5.022530e-2133.49collagen alpha-1(XI) chain isoform E preproprotein... [more]
gi|299523253|ref|NP_542197.3|5.241660e-2133.49collagen alpha-1(XI) chain isoform C preproprotein... [more]
back to top
BLAST of collagen vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150400331.703430e-10165.82dd_smedV4_702_0_1|m.35199|m.6295[more]
SMU150022711.518980e-5947.86Asxlregen_comp67208_c0_seq1|m.27270|m.10319[more]
SMU150292081.930920e-3638.53SmedSxlregen_c102983_g1_i1|m.43148|m.11576[more]
SMU150364693.593050e-3636.00dd_smedV4_1070_0_1|m.1593|m.7941[more]
SMU150401445.234790e-3537.17dd_smedV4_740_0_1|m.36260|m.3408[more]
back to top
BLAST of collagen vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|123797137|sp|Q3U962|CO5A2_MOUSE1.365960e-2433.18RecName: Full=Collagen alpha-2(V) chain; Flags: Pr... [more]
gi|18202250|sp|O93484|CO1A2_ONCMY7.913810e-2432.72RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|82202407|sp|Q6P4Z2|CO2A1_XENTR8.337710e-2331.39RecName: Full=Collagen alpha-1(II) chain; AltName:... [more]
gi|146286085|sp|Q91717|CO2A1_XENLA1.703320e-2231.53RecName: Full=Collagen alpha-1(II) chain; AltName:... [more]
gi|125987808|sp|P28481|CO2A1_MOUSE2.288480e-2231.67RecName: Full=Collagen alpha-1(II) chain; AltName:... [more]
back to top
BLAST of collagen vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24581820|ref|NP_723044.1|5.086530e-1044.21collagen type IV, isoform A [Drosophila melanogast... [more]
gi|24581822|ref|NP_723045.1|5.086530e-1044.21collagen type IV, isoform B [Drosophila melanogast... [more]
gi|24581824|ref|NP_723046.1|5.086530e-1044.21collagen type IV, isoform C [Drosophila melanogast... [more]
gi|17137252|ref|NP_477190.1|2.548470e-937.50viking, isoform A [Drosophila melanogaster][more]
gi|442626067|ref|NP_001260071.1|2.548470e-937.50viking, isoform B [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_010667 ID=Pgr_010667|Name=collagen|organism=Phagocata gracilis|type=mRNA|length=8550bp
TTTCCGTAATAGGTATGATAAAAGATTTTTTTAAATATTCGTTTCAGTCC
CCCTTTGACAAAATAGTGTAAAAATTAACAACATTTACTATTACGTACCG
TACCATGCATATCAATACATAAAGAAAATAGTGAATATCATTATTTTTAT
GAAAAACAGACTTCCTCGAATTTCAGTCCAAATTTGCTGTTACTCTTACT
GATAATAGTTACACCGACATCACGGATGGGAAATAGGCTAGCATCATTTG
AAACCTCAATAATTGTTTCGGCCTCACTGGCTTTTCCGTATTGACAGTCA
TCCGAGATAACTGTGTACTTTAATTTTTGATGATTAATTCTCATAACACT
GTCATCGTCTGCTAGAAGTCGTGGCGACGTCACTTTATTAATTTTGCCAT
TAATTCCAATTATCGGATGATTATCACAAGAGAATGTCACACGTTGAATG
GCACTGTCACTGTACGCCTTCAGGAAGGACAATTGACTGTTGGGTATGGA
ATATTGGACCTCATTATTCATTGTTAGTGCCTGAATCCACGAATGACCGT
TTACACTACTACTGGGCCAGGTCTTAAGAGGAGTTTCACCATTGATTGGT
CTTATGCACGTCTGCTGGGCGGATATTTTGCAGAAAACCTTCACGGCATC
GTCAATACGACCACTGTTAGGATCGATCCAGTACTCTCCGTCGGGTTTAT
TGGGATAACTGACGCTCAAATGCTTGCATGTTTTCGCCGGAATATCCTTC
GTTCCTTGGGGATTTTTTATGGCATTACCACCAAGTAATTTAGCGGTCTT
CGAATCATCACCGTACATAATTCCCTTTGTTGGTGATCTCATCTGCATTG
CCATAACTCCACCTGGGGGTCCAGGAGGGCCTGGTGGGCCAATCGGACCT
CTTTGTCCTATGGGTCCACTTTCACCCTGTCTTCCAGGTAAACCAGCGAC
TCCAACAGGTCCTAGAACACCAGGATCACCTCGTGGTCCAATCACTCCAG
TAGGACCAGTGAGTCCTGCTGGACCACTTGGACCTGGGGGACCATTTGGG
CCAGGATAGCCAATAGCACCCCTGTCACCATCAGCTCCAGTTGGTCCATC
AAAACCAGGACTTCCTTTGGGTCCTTTTGTGCCTGCAGGGCCCCTTGGAC
CTGGTCGTCCAGCTTGTCCTGGTTTTCCATTTGCTCCTGATACACCTTTA
TCACCAGCCAGACCAGTTTCTCCAATAGCACCATTAGACCCTGGAGCACC
CAAAGGACCAGCATCTCCAGCTGGTCCCGGAGTTCCACTCGCACCCCTAG
CACCAGGAATGCCAGCAAAACCTCCATTTCCTGGCTTTCCAGCCTTCCCA
GCAGGTCCTGGTTTTCCTTTGCCTCCCGGTAAACCAGACGGCCCTCGTGC
TCCTGCTGTTCCAGAATTTCCAGGTGCTCCATCTGGTCCTGCTGGACCCG
GAACTCCCATTTCTCCATAATCTCCTGGTAAGCCATCGCTACCAGCTGGA
CCAGGTTTCCCAGGTTTACCAAGGCTTCCTTGTGGTCCAGATGGACCTGG
CGAACCCATAAATCCAGGGTCTCCGGGTGAACCATCAGATCCCGGTTTTC
CTTCAGTACCTGGTCCTCCTGGCTTGCCTTTGTCACCAGGTGGCCCCCTT
GGACCTAAAGGTCCTTTTCGCCCATCAGCTCCATTATTTCCTGGAGCACC
GATGACTCCAGGACTACCTACTTTTCCTACGGCGCCTTCTTTACCTGGCT
CACCTGGTTTTCCCTGTCTTCCAGGTAAACCTAGGCTACCATCTCGACCT
GGTGCTCCAACGGGACCAGGGGCACCTGTTGCCCCTGGGTCTCCCGCTTC
TCCAGAGGGACCAGGAGATCCTATATTTCCTTCTAACCCTTGTGGACCTA
AAAGACCAGGTTTCCCAGGGGCTCCAGGAGCTCCTTCTTTACCTTCCTCC
CCATCTTGCCCCGGTGCTCCAGTCTCTCCTGGATCTCCTGGATCTCCATC
AGGGCCTGGAGCACCGGGTTTACCACTGGGTCCAATCTCTCCAGGAATGC
CATCAAGACCAGGTTTTCCTGCTTCTCCTTTGGGACCAGCAGGTCCAGCC
CCCCGAGGCTGAGGCTTACTAATACGAGGCATACCTGGATTTCCAGGATC
ACCACCTTCTCCAGGAGGACCTTTTGGACCAGGCGAACCCGGGATACCAG
GGGCCCCATCTTCACCAGGTTTTCCTGAAGGACCAGGTTTACCGAGAATT
CCATCGGGACCTGAGGCACCGTTTGGACCATATGATCCTGGTACTCCTAG
AATACCTACTTGGCCAGTTACTCCTCTAGCTCCGATTGGTCCACTGTCTC
CTCGATCACCATCAGGACCTGGAGCGCCAATTTTTCCAACCGATCCATCA
GCCCCAGGTTTCCCTGGCTTTCCGTTACTGCCGGGGGCTCCATTTTTACC
ATGAACACCTAGCTCCCCTGGATATCCTCTCTGGCCTGCTGCACCTGGGA
TACCAACTGGTCCCAATTTACCTACTTCCCCTGATGGTCCCGCAAATCCT
GGACTACCTTGACCCCCTTCATTACCATCATTTCCCTTCAGGCCAGGTGG
GCCTTGTTTCCCTACCGGACCATTATCACCAGGAATACCTCTTAATCCTG
GTGATCCTGTTTTTCCTTTTGCTCCATCTGGGCCCAGTTCACCTGGAGGG
CCTCTGATACCAGCTGGTCCTGATTTCCCCATGTCACCATCTTTACCTAG
GTTACCGGCTAATCCAGTTTGTCCAGGAGGACCTGGGGGTCCTGGACTTC
CTTTAGCACCCGGTGTTCCATCATTACCACTGGGGCCAGGTTCACCACGA
GGTCCTGGTGTTCCGTTTGGACCAGGTCTTCCTAATGATCCAGGCTGACC
AGCTGGGCCAGTACCACCGGGATTTCCAGGAGTACCAGGAGGACCATTTT
TTCCTGGTGCTCCATTTTGTCCTGGTGTTCCAGGCCTTCCATTTGGACCA
ATTTCTCCTCTGACTCCTTTTGTTCCCGGTTTACCTACCACTCCGATTGG
ACCTTCAGGTCCATTATCTCCAATTTGACCAGGACGACCTCTGTCTCCTT
TCTGACCATTCGGACCTTTGTTCCCTGGTTTTCCTTCTACGCCAATCGGA
CCTTGATCCCCTTCAGATCCCTTAGGCCCAACTTCACCGGGATTTCCAAT
TAATCCTCTAGGACCACGTTGTCCTGCTGGACCTTGTGAACCAGTTACTC
CAATATTCCCGGGATTTCCACGTCGACCCTGTTGACCGTCTTTCCCAGGA
GTACCAGCTTGACCCGTGGGACCCAATTTTCCAGGCTTAGCATTTAATCC
AGGCTTTCCGACACTTCCTTTACCTCCTTTTCGGCCTTCACTTCCCTTTT
CTCCTTTGTTACCCATTTCGCCAGGATTTCCTGGAGGTCCTTGAGAACCC
ATTCTTCCTTGCGGACCTGGTGGACCAACCTTTCCGTCTGGCCCAGTTAT
ACCTCTATTGCCAGTACCTCCTTGTTTACCAGTTGGTCCAGGTTGACCAA
TTGGACCTTTCGGCCCGACTGGTCCTACTGGACCAATAGGTCCAACATCA
CCTTGCTCTCCGGGAAGTCCAGGATCACCTTTATCCCCAATCAAGCCAGG
ATATCCTGGAGGTCCGGCAACTCCTTCCTGCCCCATTCCACCTGTTAAAC
CCGGCTCACCACGAGAACCAGGTGAACCCGTGACTCCAGCATTTCCAGCT
TTTCCATCAGTGCCAGGTTTCCCAGCTGGTCCAACAGGCCCAGGAGGCCC
TCTGAATCCATCTTTACCCATAAAACCTGTTGGTCCGGCTGCTCCATCAT
CTCCATCTGGACCTGGTTTTCCTTGAGGACCAGGATTCCCCCTAATTCCC
GGAGGTCCAACGGCTTCTTGCAATGATTTAAACTGACCTGAAACAAATTC
CGTTGAGCTTAAAATGCCCAAAAAGACACCAATTAAGAAGGTGTTAGTGA
GCATTTGTAAATTCCAAGATCAATTCTAAGATATACTTCCAATGTAATAA
ATTATAGAATTATTAACAATTTCCAGGATAATACGAATAGGAATGAAAAA
TTTTCTTCATAAATTGTCAGGGCACATTTTAATAGGCCAACATAGTAATT
CTGCATTGCATAGTGGATATCAAGCACACACAACGTGCACATTCTCTGTC
GTCTACTTTTCTAATAACCTTTAACGAATGCAAATCTATATATTTAGCGA
TATTCTGTCATATCTGACATTTAGCGCTAAATGTCAGATATGACAGAATA
TCGCTAAATATATAGATTTGCATTCGTTAAAGGTTATTAGAAAAGTAGAC
GACAGAGAATGTGCACGTTGTGTGTGCTTGATATCCACTATGCAATGCAG
AATTACTATGTTGGCCTATTAAAATGTGCCCTGACAATTTATGAAGAAAA
TTTTTCATTCCTATTCGTATTATCCTGGAAATTGTTAATAATTCTATAAT
TTATTACATTGGAAGTATATCTTAGAATTGATCTTGGAATTTACAAATGC
TCACTAACACCTTCTTAATTGGTGTCTTTTTGGGCATTTTAAGCTCAACG
GAATTTGTTTCAGGTCAGTTTAAATCATTGCAAGAAGCCGTTGGACCTCC
GGGAATTAGGGGGAATCCTGGTCCTCAAGGAAAACCAGGTCCAGATGGAG
ATGATGGAGCAGCCGGACCAACAGGTTTTATGGGTAAAGATGGATTCAGA
GGGCCTCCTGGGCCTGTTGGACCAGCTGGGAAACCTGGCACTGATGGAAA
AGCTGGAAATGCTGGAGTCACGGGTTCACCTGGTTCTCGTGGTGAGCCGG
GTTTAACAGGTGGAATGGGGCAGGAAGGAGTTGCCGGACCTCCAGGATAT
CCTGGCTTGATTGGGGATAAAGGTGATCCTGGACTTCCCGGAGAGCAAGG
TGATGTTGGACCTATTGGTCCAGTAGGACCAGTCGGGCCGAAAGGTCCAA
TTGGTCAACCTGGACCAACTGGTAAACAAGGAGGTACTGGCAATAGAGGT
ATAACTGGGCCAGACGGAAAGGTTGGTCCACCAGGTCCGCAAGGAAGAAT
GGGTTCTCAAGGACCTCCAGGAAATCCTGGCGAAATGGGTAACAAAGGAG
AAAAGGGAAGTGAAGGCCGAAAAGGAGGTAAAGGAAGTGTCGGAAAGCCT
GGATTAAATGCTAAGCCTGGAAAATTGGGTCCCACGGGTCAAGCTGGTAC
TCCTGGGAAAGACGGTCAACAGGGTCGACGTGGAAATCCCGGGAATATTG
GAGTAACTGGTTCACAAGGTCCAGCAGGACAACGTGGTCCTAGAGGATTA
ATTGGAAATCCCGGTGAAGTTGGGCCTAAGGGATCTGAAGGGGATCAAGG
TCCGATTGGCGTAGAAGGAAAACCAGGGAACAAAGGTCCGAATGGTCAGA
AAGGAGACAGAGGTCGTCCTGGTCAAATTGGAGATAATGGACCTGAAGGT
CCAATCGGAGTGGTAGGTAAACCGGGAACAAAAGGAGTCAGAGGAGAAAT
TGGTCCAAATGGAAGGCCTGGAACACCAGGACAAAATGGAGCACCAGGAA
AAAATGGTCCTCCTGGTACTCCTGGAAATCCCGGTGGTACTGGCCCAGCT
GGTCAGCCTGGATCATTAGGAAGACCTGGTCCAAACGGAACACCAGGACC
TCGTGGTGAACCTGGCCCCAGTGGTAATGATGGAACACCGGGTGCTAAAG
GAAGTCCAGGACCCCCAGGTCCTCCTGGACAAACTGGATTAGCCGGTAAC
CTAGGTAAAGATGGTGACATGGGGAAATCAGGACCAGCTGGTATCAGAGG
CCCTCCAGGTGAACTGGGCCCAGATGGAGCAAAAGGAAAAACAGGATCAC
CAGGATTAAGAGGTATTCCTGGTGATAATGGTCCGGTAGGGAAACAAGGC
CCACCTGGCCTGAAGGGAAATGATGGTAATGAAGGGGGTCAAGGTAGTCC
AGGATTTGCGGGACCATCAGGGGAAGTAGGTAAATTGGGACCAGTTGGTA
TCCCAGGTGCAGCAGGCCAGAGAGGATATCCAGGGGAGCTAGGTGTTCAT
GGTAAAAATGGAGCCCCCGGCAGTAACGGAAAGCCAGGGAAACCTGGGGC
TGATGGATCGGTTGGAAAAATTGGCGCTCCAGGTCCTGATGGTGATCGAG
GAGACAGTGGACCAATCGGAGCTAGAGGAGTAACTGGCCAAGTAGGTATT
CTAGGAGTACCAGGATCATATGGTCCAAACGGTGCCTCAGGTCCCGATGG
AATTCTCGGTAAACCTGGTCCTTCAGGAAAACCTGGTGAAGATGGGGCCC
CTGGTATCCCGGGTTCGCCTGGTCCAAAAGGTCCTCCTGGAGAAGGTGGT
GATCCTGGAAATCCAGGTATGCCTCGTATTAGTAAGCCTCAGCCTCGGGG
GGCTGGACCTGCTGGTCCCAAAGGAGAAGCAGGAAAACCTGGTCTTGATG
GCATTCCTGGAGAGATTGGACCCAGTGGTAAACCCGGTGCTCCAGGCCCT
GATGGAGATCCAGGAGATCCAGGAGAGACTGGAGCACCGGGGCAAGATGG
GGAGGAAGGTAAAGAAGGAGCTCCTGGAGCCCCTGGGAAACCTGGTCTTT
TAGGTCCACAAGGGTTAGAAGGAAATATAGGATCTCCTGGTCCCTCTGGA
GAAGCGGGAGACCCAGGGGCAACAGGTGCCCCTGGTCCCGTTGGAGCACC
AGGTCGAGATGGTAGCCTAGGTTTACCTGGAAGACAGGGAAAACCAGGTG
AGCCAGGTAAAGAAGGCGCCGTAGGAAAAGTAGGTAGTCCTGGAGTCATC
GGTGCTCCAGGAAATAATGGAGCTGATGGGCGAAAAGGACCTTTAGGTCC
AAGGGGGCCACCTGGTGACAAAGGCAAGCCAGGAGGACCAGGTACTGAAG
GAAAACCGGGATCTGATGGTTCACCCGGAGACCCTGGATTTATGGGTTCG
CCAGGTCCATCTGGACCACAAGGAAGCCTTGGTAAACCTGGGAAACCTGG
TCCAGCTGGTAGCGATGGCTTACCAGGAGATTATGGAGAAATGGGAGTTC
CGGGTCCAGCAGGACCAGATGGAGCACCTGGAAATTCTGGAACAGCAGGA
GCACGAGGGCCGTCTGGTTTACCGGGAGGCAAAGGAAAACCAGGACCTGC
TGGGAAGGCTGGAAAGCCAGGAAATGGAGGTTTTGCTGGCATTCCTGGTG
CTAGGGGTGCGAGTGGAACTCCGGGACCAGCTGGAGATGCTGGTCCTTTG
GGTGCTCCAGGGTCTAATGGTGCTATTGGAGAAACTGGTCTGGCTGGTGA
TAAAGGTGTATCAGGAGCAAATGGAAAACCAGGACAAGCTGGACGACCAG
GTCCAAGGGGCCCTGCAGGCACAAAAGGACCCAAAGGAAGTCCTGGTTTT
GATGGACCAACTGGAGCTGATGGTGACAGGGGTGCTATTGGCTATCCTGG
CCCAAATGGTCCCCCAGGTCCAAGTGGTCCAGCAGGACTCACTGGTCCTA
CTGGAGTGATTGGACCACGAGGTGATCCTGGTGTTCTAGGACCTGTTGGA
GTCGCTGGTTTACCTGGAAGACAGGGTGAAAGTGGACCCATAGGACAAAG
AGGTCCGATTGGCCCACCAGGCCCTCCTGGACCCCCAGGTGGAGTTATGG
CAATGCAGATGAGATCACCAACAAAGGGAATTATGTACGGTGATGATTCG
AAGACCGCTAAATTACTTGGTGGTAATGCCATAAAAAATCCCCAAGGAAC
GAAGGATATTCCGGCGAAAACATGCAAGCATTTGAGCGTCAGTTATCCCA
ATAAACCCGACGGAGAGTACTGGATCGATCCTAACAGTGGTCGTATTGAC
GATGCCGTGAAGGTTTTCTGCAAAATATCCGCCCAGCAGACGTGCATAAG
ACCAATCAATGGTGAAACTCCTCTTAAGACCTGGCCCAGTAGTAGTGTAA
ACGGTCATTCGTGGATTCAGGCACTAACAATGAATAATGAGGTCCAATAT
TCCATACCCAACAGTCAATTGTCCTTCCTGAAGGCGTACAGTGACAGTGC
CATTCAACGTGTGACATTCTCTTGTGATAATCATCCGATAATTGGAATTA
ATGGCAAAATTAATAAAGTGACGTCGCCACGACTTCTAGCAGACGATGAC
AGTGTTATGAGAATTAATCATCAAAAATTAAAGTACACAGTTATCTCGGA
TGACTGTCAATACGGAAAAGCCAGTGAGGCCGAAACAATTATTGAGGTTT
CAAATGATGCTAGCCTATTTCCCATCCGTGATGTCGGTGTAACTATTATC
AGTAAGAGTAACAGCAAATTTGGACTGAAATTCGAGGAAGTCTGTTTTTC
ATAAAAATAATGATATTCACTATTTTCTTTATGTATTGATATGCATGGTA
CGGTACGTAATAGTAAATGTTGTTAATTTTTACACTATTTTGTCAAAGGG
GGACTGAAACGAATATTTAAAAAAATCTTTTATCATACCTATTACGGAAA

Design Primers for collagen

back to top

protein sequence

>Pgr_010667-protein ID=Pgr_010667-protein|Name=collagen|organism=Phagocata gracilis|type=polypeptide|length=1286bp
MLTNTFLIGVFLGILSSTEFVSGQFKSLQEAVGPPGIRGNPGPQGKPGPD
GDDGAAGPTGFMGKDGFRGPPGPVGPAGKPGTDGKAGNAGVTGSPGSRGE
PGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEQGDVGPIGPVGPVGPKG
PIGQPGPTGKQGGTGNRGITGPDGKVGPPGPQGRMGSQGPPGNPGEMGNK
GEKGSEGRKGGKGSVGKPGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGN
IGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEGKPGNKGPNG
QKGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGTPGQNGAP
GKNGPPGTPGNPGGTGPAGQPGSLGRPGPNGTPGPRGEPGPSGNDGTPGA
KGSPGPPGPPGQTGLAGNLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTG
SPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPV
GIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIGAPGPDGD
RGDSGPIGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGEDG
APGIPGSPGPKGPPGEGGDPGNPGMPRISKPQPRGAGPAGPKGEAGKPGL
DGIPGEIGPSGKPGAPGPDGDPGDPGETGAPGQDGEEGKEGAPGAPGKPG
LLGPQGLEGNIGSPGPSGEAGDPGATGAPGPVGAPGRDGSLGLPGRQGKP
GEPGKEGAVGKVGSPGVIGAPGNNGADGRKGPLGPRGPPGDKGKPGGPGT
EGKPGSDGSPGDPGFMGSPGPSGPQGSLGKPGKPGPAGSDGLPGDYGEMG
VPGPAGPDGAPGNSGTAGARGPSGLPGGKGKPGPAGKAGKPGNGGFAGIP
GARGASGTPGPAGDAGPLGAPGSNGAIGETGLAGDKGVSGANGKPGQAGR
PGPRGPAGTKGPKGSPGFDGPTGADGDRGAIGYPGPNGPPGPSGPAGLTG
PTGVIGPRGDPGVLGPVGVAGLPGRQGESGPIGQRGPIGPPGPPGPPGGV
MAMQMRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSY
PNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSS
VNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG
INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIE
VSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS*
back to top

coding sequence

>Pgr_010667.4547.8404 ID=Pgr_010667.4547.8404|Name=Pgr_010667.4547.8404|organism=Phagocata gracilis|type=CDS|length=3858bp
ATGCTCACTAACACCTTCTTAATTGGTGTCTTTTTGGGCATTTTAAGCTC
AACGGAATTTGTTTCAGGTCAGTTTAAATCATTGCAAGAAGCCGTTGGAC
CTCCGGGAATTAGGGGGAATCCTGGTCCTCAAGGAAAACCAGGTCCAGAT
GGAGATGATGGAGCAGCCGGACCAACAGGTTTTATGGGTAAAGATGGATT
CAGAGGGCCTCCTGGGCCTGTTGGACCAGCTGGGAAACCTGGCACTGATG
GAAAAGCTGGAAATGCTGGAGTCACGGGTTCACCTGGTTCTCGTGGTGAG
CCGGGTTTAACAGGTGGAATGGGGCAGGAAGGAGTTGCCGGACCTCCAGG
ATATCCTGGCTTGATTGGGGATAAAGGTGATCCTGGACTTCCCGGAGAGC
AAGGTGATGTTGGACCTATTGGTCCAGTAGGACCAGTCGGGCCGAAAGGT
CCAATTGGTCAACCTGGACCAACTGGTAAACAAGGAGGTACTGGCAATAG
AGGTATAACTGGGCCAGACGGAAAGGTTGGTCCACCAGGTCCGCAAGGAA
GAATGGGTTCTCAAGGACCTCCAGGAAATCCTGGCGAAATGGGTAACAAA
GGAGAAAAGGGAAGTGAAGGCCGAAAAGGAGGTAAAGGAAGTGTCGGAAA
GCCTGGATTAAATGCTAAGCCTGGAAAATTGGGTCCCACGGGTCAAGCTG
GTACTCCTGGGAAAGACGGTCAACAGGGTCGACGTGGAAATCCCGGGAAT
ATTGGAGTAACTGGTTCACAAGGTCCAGCAGGACAACGTGGTCCTAGAGG
ATTAATTGGAAATCCCGGTGAAGTTGGGCCTAAGGGATCTGAAGGGGATC
AAGGTCCGATTGGCGTAGAAGGAAAACCAGGGAACAAAGGTCCGAATGGT
CAGAAAGGAGACAGAGGTCGTCCTGGTCAAATTGGAGATAATGGACCTGA
AGGTCCAATCGGAGTGGTAGGTAAACCGGGAACAAAAGGAGTCAGAGGAG
AAATTGGTCCAAATGGAAGGCCTGGAACACCAGGACAAAATGGAGCACCA
GGAAAAAATGGTCCTCCTGGTACTCCTGGAAATCCCGGTGGTACTGGCCC
AGCTGGTCAGCCTGGATCATTAGGAAGACCTGGTCCAAACGGAACACCAG
GACCTCGTGGTGAACCTGGCCCCAGTGGTAATGATGGAACACCGGGTGCT
AAAGGAAGTCCAGGACCCCCAGGTCCTCCTGGACAAACTGGATTAGCCGG
TAACCTAGGTAAAGATGGTGACATGGGGAAATCAGGACCAGCTGGTATCA
GAGGCCCTCCAGGTGAACTGGGCCCAGATGGAGCAAAAGGAAAAACAGGA
TCACCAGGATTAAGAGGTATTCCTGGTGATAATGGTCCGGTAGGGAAACA
AGGCCCACCTGGCCTGAAGGGAAATGATGGTAATGAAGGGGGTCAAGGTA
GTCCAGGATTTGCGGGACCATCAGGGGAAGTAGGTAAATTGGGACCAGTT
GGTATCCCAGGTGCAGCAGGCCAGAGAGGATATCCAGGGGAGCTAGGTGT
TCATGGTAAAAATGGAGCCCCCGGCAGTAACGGAAAGCCAGGGAAACCTG
GGGCTGATGGATCGGTTGGAAAAATTGGCGCTCCAGGTCCTGATGGTGAT
CGAGGAGACAGTGGACCAATCGGAGCTAGAGGAGTAACTGGCCAAGTAGG
TATTCTAGGAGTACCAGGATCATATGGTCCAAACGGTGCCTCAGGTCCCG
ATGGAATTCTCGGTAAACCTGGTCCTTCAGGAAAACCTGGTGAAGATGGG
GCCCCTGGTATCCCGGGTTCGCCTGGTCCAAAAGGTCCTCCTGGAGAAGG
TGGTGATCCTGGAAATCCAGGTATGCCTCGTATTAGTAAGCCTCAGCCTC
GGGGGGCTGGACCTGCTGGTCCCAAAGGAGAAGCAGGAAAACCTGGTCTT
GATGGCATTCCTGGAGAGATTGGACCCAGTGGTAAACCCGGTGCTCCAGG
CCCTGATGGAGATCCAGGAGATCCAGGAGAGACTGGAGCACCGGGGCAAG
ATGGGGAGGAAGGTAAAGAAGGAGCTCCTGGAGCCCCTGGGAAACCTGGT
CTTTTAGGTCCACAAGGGTTAGAAGGAAATATAGGATCTCCTGGTCCCTC
TGGAGAAGCGGGAGACCCAGGGGCAACAGGTGCCCCTGGTCCCGTTGGAG
CACCAGGTCGAGATGGTAGCCTAGGTTTACCTGGAAGACAGGGAAAACCA
GGTGAGCCAGGTAAAGAAGGCGCCGTAGGAAAAGTAGGTAGTCCTGGAGT
CATCGGTGCTCCAGGAAATAATGGAGCTGATGGGCGAAAAGGACCTTTAG
GTCCAAGGGGGCCACCTGGTGACAAAGGCAAGCCAGGAGGACCAGGTACT
GAAGGAAAACCGGGATCTGATGGTTCACCCGGAGACCCTGGATTTATGGG
TTCGCCAGGTCCATCTGGACCACAAGGAAGCCTTGGTAAACCTGGGAAAC
CTGGTCCAGCTGGTAGCGATGGCTTACCAGGAGATTATGGAGAAATGGGA
GTTCCGGGTCCAGCAGGACCAGATGGAGCACCTGGAAATTCTGGAACAGC
AGGAGCACGAGGGCCGTCTGGTTTACCGGGAGGCAAAGGAAAACCAGGAC
CTGCTGGGAAGGCTGGAAAGCCAGGAAATGGAGGTTTTGCTGGCATTCCT
GGTGCTAGGGGTGCGAGTGGAACTCCGGGACCAGCTGGAGATGCTGGTCC
TTTGGGTGCTCCAGGGTCTAATGGTGCTATTGGAGAAACTGGTCTGGCTG
GTGATAAAGGTGTATCAGGAGCAAATGGAAAACCAGGACAAGCTGGACGA
CCAGGTCCAAGGGGCCCTGCAGGCACAAAAGGACCCAAAGGAAGTCCTGG
TTTTGATGGACCAACTGGAGCTGATGGTGACAGGGGTGCTATTGGCTATC
CTGGCCCAAATGGTCCCCCAGGTCCAAGTGGTCCAGCAGGACTCACTGGT
CCTACTGGAGTGATTGGACCACGAGGTGATCCTGGTGTTCTAGGACCTGT
TGGAGTCGCTGGTTTACCTGGAAGACAGGGTGAAAGTGGACCCATAGGAC
AAAGAGGTCCGATTGGCCCACCAGGCCCTCCTGGACCCCCAGGTGGAGTT
ATGGCAATGCAGATGAGATCACCAACAAAGGGAATTATGTACGGTGATGA
TTCGAAGACCGCTAAATTACTTGGTGGTAATGCCATAAAAAATCCCCAAG
GAACGAAGGATATTCCGGCGAAAACATGCAAGCATTTGAGCGTCAGTTAT
CCCAATAAACCCGACGGAGAGTACTGGATCGATCCTAACAGTGGTCGTAT
TGACGATGCCGTGAAGGTTTTCTGCAAAATATCCGCCCAGCAGACGTGCA
TAAGACCAATCAATGGTGAAACTCCTCTTAAGACCTGGCCCAGTAGTAGT
GTAAACGGTCATTCGTGGATTCAGGCACTAACAATGAATAATGAGGTCCA
ATATTCCATACCCAACAGTCAATTGTCCTTCCTGAAGGCGTACAGTGACA
GTGCCATTCAACGTGTGACATTCTCTTGTGATAATCATCCGATAATTGGA
ATTAATGGCAAAATTAATAAAGTGACGTCGCCACGACTTCTAGCAGACGA
TGACAGTGTTATGAGAATTAATCATCAAAAATTAAAGTACACAGTTATCT
CGGATGACTGTCAATACGGAAAAGCCAGTGAGGCCGAAACAATTATTGAG
GTTTCAAATGATGCTAGCCTATTTCCCATCCGTGATGTCGGTGTAACTAT
TATCAGTAAGAGTAACAGCAAATTTGGACTGAAATTCGAGGAAGTCTGTT
TTTCATAA
back to top
Gene Groups
collagen is similar in sequence to the genes of this group: GG1008
Gene NameGene ID
SMU15002271SMU15002271
SMU15040033SMU15040033
Ddo_001537Ddo_001537
collagenDdo_024746
collagenGsp_012135
Gsp_016934Gsp_016934
Pgr_004907Pgr_004907
collagenPgr_010667
Pmo_000089Pmo_000089
collagenPmo_027332

Gene Group Protein Sequences

>SMU15002271

MWNSIFFSLLFVLCVSINARAEEKLNRLKRQATSPNQAKGSQGPRGDPGP
MGKPGPPGDPGALGPIGPPGRDGARGKSGKPGASGIPGKDGTPGSHGVVG
PIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQ
GPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGI
PGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPG
VRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQ
GSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGN
PGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFG
TNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSP
GDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGFPGIAGK
IGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKG
SIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAP
GKLGPVGITGSRGRPGPIGSSGEPGEKGPQGLPEVEKPLAGRSVGGVSGP
RGERGSPGDDGLPGPNGDPGPPGPIGMDGGRGDTGDRGLPGPAGDPGKDG
KPGEPGTPGIDGPPGQVGPEGPRGPSGETGEQGPQGLPGKPGDPGAEGPR
GSSGKQGFQGPTGPIGPTGKQGKQGRAGKSGKNGLTGRKGPAGQRGSIGA
RGKDGQTGENGRAGSAGADGFPGFPGPNGPPGPTGPDGKMGPIGPPGEIG
EHGEMGDPGPTGKEGLVGPQGNVGPPGPIGSPGNPGIAGPPGPQGKRGNR
GNTGFVGPAGPRGKRGPVGPGGEKGIPGSPGLEGQRGQIGVSGARGNNGN
NGKPGRTGRAGPAGTMGQKGVRGVKGFTGPNGLKGPQGPSGYPGEDGSPG
PMGLIGERGPQGITGKRGDRGDPGLLGPLGPPGNDGEFGRPGPQGPMGPP
GPPGPPGSSMPMGLRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPAR
SCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIY
KTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISL
NCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEK
FSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS*
>SMU15040033
MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPD
GDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGE
QGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLG
PPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKK
GEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGD
IGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKG
QKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKP
GATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGR
KGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIG
PPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPP
GSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGD
VGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPG
LAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGM
DGFPGDVGPPGKQGPEGGPGDPGDPGDMGPIGNSGDPGPDGKPGKNGAPG
KQGPEGLPGSEGASGPPGDVGDPGKSGPTGPRGGPGRIGSPGGQGKQGKS
GNQGKLGPSGKPGPVGSPGVTGLDGTIGRKGPLGLRGPSGPKGKSGAPGV
DGKVGTQGVNGYPGYLGPPGPPGPQGPNGKPGKPGPPGNVGQIGDHGEMG
NPGPQGSVGPPGATGPVGPRGDAGEPGRKGPIGPQGKNGTSGGKGYDGQS
GTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGR
PGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDGLQG
PVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGI
MAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKH
PNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHS
ANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIG
NEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIE
VRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS*
>Ddo_001537 Ddo_001537
MHKFTFLFAIGVLCFSVFAENEKLHRLKRQATSPNQAKGSQGPRGDPGPM
GKPGPEGDSGMMGPVGPPGRDGARGKSGKPGLPGIPGKDGTPGSHGVSGP
MGPPGEIGVSGPVGPEGANGKQGNRGPTGDKGDMGLTGLKGSSGEPGLQG
PQGLRGPIGRVGPTGPTGPTGDRGKQGPDGIPGSVGPQGAIGPPGQPGIA
GEIGNKGVRGEAGIKGSKGDHGNPGMGGKLGSIGQPGPPGLPGVDGRPGI
RGEVGVPGLQGPEGKAGQRGQRGAPGNPGSQGPKGSQGEEGSPGIEGKPG
PPGIKGQKGDNGRPGENGDEGPRGERGLNGPSGNKGSQGESGPDGSPGNP
GTDGIPGKDGIAGSPGNEGEAGPKGPPGPMGKPGLNGAPGPRGENGVYGV
NGHPGAKGSVGPKGSIGSPGPRGLPGNNGPMGSMGPGGIRGPLGPVGSPG
EKGGKGRNGIPGASGDAGDIGELGPPGEDGSEGSSGSPGPAGFPGVSGKM
GQIGPIGVDGPPGPPGFEGTPGINGKDGKSGKDGKPGPPGEIGPPGINGS
TGPVGEIGPTGKIGLKGLKGADGIMGPPGTFGINGPPGLSGPMGPVGING
KRGPPGTPGKEGVPGAIGPQGIPGKRGSKGGDGVDKPLAGRSGGGPPGPK
GERGPQGEDGLSGPNGNPGPVGPPGIDGGRGDTGDRGLPGPIGDVGKDGK
PGEPGTPGQDGPPGPVGPEGPRGPPGETGDQGPQGLPGRPGESGLEGPRG
SPGKQGSQGSSGPVGAVGKPGKPGKPGKPGKDGMIGRKGPVGQRGPTGPR
GKDGPAGENGKPGSPGPDGFSGFPGSSGPPGPIGPDGKGGPPGPPGETGE
VGEMGDIGPLGKEGPQGPQGNDGPPGPIGSPGVPGNAGPPGPPGKRGNRG
NTGFVGGVGPRGKRGPVGADGEKGIPGQPGANGAKGQIGIPGPRGKLGNN
GKPGKIGRVGPPGTTGQKGTRGVKGFTGPNGLRGPQGLSGYPGEDGPPGP
IGLIGERGPQGVTGKRGDRGDPGAAGPNGPQGNDGEYGRPGPQGPVGPPG
PPGPPGSSMPMGLRSPTKGLTLADDPSVALSFGNNAIHTPRGTKDVPARS
CKLLSEINPTLPDGEYWIDPNGGRIDDAVKVYCKMSLAQTCIKPISKSFK
AKQWIRKYSKDHIWFQTTHEAGEFQYDIENYQLTYLKVHSDTATQQISLS
CINQAIVLDKNGKLSNASTSLLGDDDTILSLRHPKRRFKVVKDDCQYEKS
SEAETILEIRGKASRLPIRDVGLLVDDNPERKIGIELSEVCYS*
>Ddo_024746 collagen
MLKISILSGCVFLILLFIGNSYGQFRTLNEAVGPAGIRGNPGKPGKPGPD
GDPGPTGPPGPTGKDGLRGQPGAPGPNGNAGPDGKPGSTGVTGPPGARGE
QGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIGPPGRAGPIG
PPGQSGPTGPQGNVGERGPVGPDGMIGPPGPEGKIGSPGSPGRPGEVGKK
GEGGDEGIKGGKGEAGKTGLDGKSGKPGTRGPIGPVGINGRPGKKGELGD
IGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKG
QKGDRGRPGELGEAGPLGPIGPIGPDGVKGSRGESGPNGAPGDPGLNGKP
GAIGPPGIPGTPGDAGPGGQTGPMGRPGPNGAPGPRGEVGPNGPDGKSGN
KGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG
PPGSRGKVGSAGKVGPPGKPGVNGSEGPVGNMGNPGFPGSSGDPGAPGPK
GPVGLIGPVGYAGSQGVNGKNGDPGNVGKPGKVGPPGAPGKPGIPGPDGD
RGSLGPPGPTGLKGSPGIIGVPGNYGPNGPPGSLGVIGKQGLEGELGPPG
TPGSPGGTGPRGPPGPAGTPGNAGGEGVDKQKPRSVGSAGIRGPIGKPGA
DGIPGDVGPVGKQGSEGPPGDPGDPGDMGSVGAIGDSGKDGNPGKPGAAG
KPGPSGVDGPEGPAGLPGDIGEPGKSGPSGPRGDPGRVGSAGGPGKQGKS
GNQGKQGPSGKPGPTGPPGLAGLDAANGRKGPLGLRGPPGPKGKSGGPGI
DGKVGTPGTDGFPGYLGPPGQPGPQGIAGKPGKPGPTGGIGLQGDHGEMG
KPGPQGPLGVPGLTGPVGPRGDPGPPGSKGAAGKPGKDGTSGGKGYDGQT
GTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGTPGREGK
PGPRGAKGTKGPKGVPGYPGRPGIEGDPGPPGYSGPDGPTGPKGPDGLQG
PVGIFGPRGDPGIPGAIGPTGPPGKPGGTGPAGQRGPLGPPGPPGPPGGV
MAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVN
PQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPI
LNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIG
NEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIE
VKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS*
>Gsp_012135 collagen
MLKISIISGAILLVLIYIECVHGQFRTLNEATGPMGIRGNPGKRGKPGPD
GDPGAQGPTGPPGNDGQRGAPGLQGPPGSVGPEGKSGAGGVSGPPGSRGE
QGPPGPIGKEGLTGPVGYPGPSGEKGDSGGTGEQGDTGDIGPPGPPGPIG
QPGQNGPTGPQGPVGERGTHGPDGIVGPPGPEGRIGSPGLPGRPGEIGKK
GEGGDEGAKGGKGESGKTGINGKSGKPGLRGRTGPDGNNGKQGRKGEIGD
VGLLGPQGLTGPRGLRGSSGNPGDSGPKGSQGDQGPIGLEGKSGPFGPKG
QKGDRGRPGPQGEAGLIGPTGPIGPDGVKGSRGESGPNGSPGSPGPNGKP
GADGPPGNPGHPGNSGPGGSTGALGRPGPNGAPGPRGEIGPPGPDGKSGN
KGALGPIGPSGLRGPPGNPGKDGMIGPLGLPGLRGPPGNVGAPGNKGNIG
EPGPKGKTGNSGKPGPAGKNGADGSEGLSGNIGSPGFPGPNGDPGASGPP
GPAGAIGIPGYPGNQGISGKNGAPGTEGNPGKSGPVGPVGKAGVPGPIGD
SGNPGPPGPNGLKGAPGIVGIPGNYGPNGPPGALGPLGKQGPEGPVGAPG
LLGSPGPDGPRGPPGDNGSPGSAGGEGVEKHKPRSVGAAGIRGPVGKPGM
DGLPGDLGPPGKQGPEGNPGDPGDPGDMGPIGASGDSGPDGKPGKPGAPG
KQGPEGLSGPEGASGPPGDVGDPGKSGPGGPRGGPGRQGSPGGPGKQGKS
GIQGKPGPAGKPGPLGPQGVTGLDGSGGRKGPLGLRGPVGPKGKPGAPGT
DGKVGTSGPDGYPGYLGPPGPSGPQGITGKPGKKGPPGNRGPIGDNGEMG
KPGPVGVVGDPGITGPVGPRGDPGPPGSKGAAGSPGKDGTSGGKGYDGQG
GTSGKSGKLGTPGDKGADGKPGPGGVLGDVGLRGAKGKKGKDGVPGREGR
PGPRGAKGVKGPKGVPGYPGLIGIEGDPGPPGFPGPDGPVGPKGPDGIQG
PVGITGPRGDPGIPGAIGPTGLSGKKGSNGPLGQLGPLGPPGPPGPPGGI
MAMQLRSPTKGVVYGDDPAAAELLGNNAIKNPQGTKEVPARTCKQLSSEN
PNIPDGEYWIDPNGGRTSDAVKVFCKISEEKTCIKPLNQEISIRSWNSPI
TKGHTWLKSLLNSDEIQYSIPNGQLAFLKIYSDTATQRITFACENHPIIG
SEEKLNKVMAPRLLADDDTIIKMTQSKLKYTVIKDECQYSKSSEAESIIE
LKHLASLLPIRDIGINIINNRKSKFGLTIEEVCFS*
>Gsp_016934 Gsp_016934
MYNLIRLFIAILCVLSVPVIVNGEAKLNRIKRQATSPRQAKGSQGPRGDP
GPMGKPGPQGDPGPLGPVGPPGRDGARGKSGRPGASGVPGKDGTPGSHGV
IGPIGPRGEPGIAGSIGPEGASGPQGNRGYPGDKGDIGLNGLKGSNGEPG
LQGPQGIRGTSGRVGPTGPQGPPGERGKQGPDGIPGSPGPQGTIGPPGQS
GITGEMGNKGIRGEGGIKGSKGDVGNPGLSGKVGPAGPTGPPGFPGVDGR
PGVRGESGVVGQQGPVGKVGQQGQRGKTGNIGPPGPKGAQGDEGPMGIEG
KQGPPGPKGQKGDPGRPGETGDEGPRGERGIVGPSGNKGARGETGQDGSP
GNPGTDGIPGKDGLHGSPGSEGEVGSVGPPGEVGKPGLNGAPGIRGENGA
FGVNGKPGAKGSVGPKGNIGSPGPRGLSGNNGAMGVMGPGGIRGPIGPVG
SPGEKGGKGRVGIPGVSGDAGDIGEQGPPGEDGAEGSSGNPGPIGFPGIA
GKIGQAGPLGVDGPPGPPGFEGLPGVNGKDGKAGKDGKPGPPGEVGPPGV
KGSIGQFGETGPMGKIGIRGPKGMDGIMGPPGVFGMNGPPGPSGEAGPEG
APGKLGPVGIAGRPGRPGAIGPQGIAGEKGPKGLPEVDKPLAGRSSGGPP
GPKGERGPPGDDGLPGPNGNQGPPGPVGMDGGRGDTGDRGLPGPVGDPGK
DGKPGEQGVPGTDGPQGPLGPEGPRGPSGETGEQGPRGLPGKPGEPGGEG
PRGSPGKQGLQGPTGPVGPTGKQGKQGKPGKSGKNGVTGQKGPVGSRGPL
GPRGKDGPLGESGKPGSPGADGFSGFPGPIGPPGAIGPDGKQGPVGQPGE
PGEHGEMGDAGPNGNEGPLGPQGNVGPPGPTGPPGNPGNIGTPGPQGKRG
NRGNTGFVGAAGQRGKRGPLGPPGDKGIPGSPGMAGLKGQTGVQGPRGKN
GNNGKPGRIGRSGPPGSMGQKGVRGVKGFTGPNGLKGPQGSSGYPGEDGP
PGPIGLIGERGPQGITGKRGDRGDPGLLGPPGPLGNDGEYGRPGPQGPMG
PPGPPGPPGSSMPMGLRSPTKGLTMADDPTAAISFGNNAIITPRGTKDVP
ARSCKHLSEHNPDLPDGEYWIDPNGGRIDDAIPVFCRIELQQTCIKPISK
IFKPVQWIRKYARGHIWFQTVNEIGEFEYDIESHQLNFLKALSETATQQI
TFTCINQAIILDKTGKLSNASTKLLGDDDTFLTFHHPKRRYKVVKDECQY
EKFSEAETVLQIQGKASRLPIKDVGLITDSNTSRKVGIELSEVCYS*
>Pgr_004907 Pgr_004907
MLRLVCFFLISSVCLTTVLSKEELINRIKRQATSPNQAIGPQGPRGDPGP
RGKIGQIGDTGAIGPPGPPGRDGAAGKSGKPGPPGLPGKDGRPGTPGNSG
ARGTRGEPGVAGPLGPEGGTGKQGSKGAPGDKGDIGPNGLKGSNGEAGLQ
GIRGPRGSPGPVGPNGPPGSAGDRGKRGPDGRMGGAGPQGPIGPPGIPGL
LGDMGDKGERGDGGPKGVKGEAGNAGVSGKPGPTGPKGPQGSPGVDGRPG
IRGELGNIGPLGPPGVAGPRGQTGAPGNSGKLGPKGAQGEQGPVGLEGKI
GLIGDKGQKGDQGRPGDIGDPGVRGERGVEGIGGNKGPRGEMGPDGSPGN
GGTDGIPGRDGEQGQPGSIGPVGPRGPQGPQGKTGLNGSPGGRGENGPFG
LNGMPGGKGEPGVRGPPGLPGSRGSAGNNGLQGVMGPVGMRGPAGQVGEG
GDKGSPGTAGIAGMPGEAGDVGLQGPPGEEGVEGPSGSPGPAGFSGAVGK
IGQVGPIGINGPPGPPGYEGAPGVNGKDGKSGKDGKPGTPGDTGPVGPKG
ASGPLGERGPLGPLGIKGIKGFEGVMGIPGSFGTNGPPGLSGNIGAEGPV
GKPGTAGLPGLAGAPGQRGPIGDSGEPGSSGAQGVEKPPAGRSSGPPGPK
GNRGPPGDNGTPGAVGTQGPPGPPGIDGDRGDPGDRGLPGPIGEPGKDGK
LGKVGGSGKNGPPGQDGPEGPRGAPGDVGEPGRQGPEGKPGPDGPEGPRG
IPGLQGKRGPSGPIGPIGPPGKQGKTGSPGSDGVIGRKGPPGARGPQGPR
GKDGVAGENGKSGTPGPDGFAGFPGPSGPQGIIGGVGKPGNPGSPGETGE
QGEFGDIGPPGPPGPDGLNGNPGPPGPSGIPGSIGERGPPGPGGKKGPMG
NTGFIGMPGPRGGRGKPGLIGPMGLVGGVGLQGPKGPPGEPGDRGKDGVD
GKPGGPGRPGPTGSIGIKGARGFKGFTGPTGIRGNPGPSGYPGENGMPGP
MGLIGERGPQGAPGQRGERGDTGPAGMIGPQGNDGEYGRPGPQGPMGPSG
PPGPPGSSTLMNLRAPKKNLIYGDDPSSALILGNSVIKTPRGTKEVPART
CKHLAEHNPKIPDGEYWIDPNGGRIQDAVKVFCKIDNYQTCIESTTKKFK
LQSWIRKYPKGPIWFQTTNNVGDFEYDVSDDQLSYLKALSDKASQQITIK
CFNKAIIRDKNGALLKTSPSLLGDDDTILTLEHPKRQYTIVRDDCQYEKN
SEAETVLEVNGKASRLPIKDIGLVIDSDKKVGIELSEVCYS*
>Pgr_010667 collagen
MLTNTFLIGVFLGILSSTEFVSGQFKSLQEAVGPPGIRGNPGPQGKPGPD
GDDGAAGPTGFMGKDGFRGPPGPVGPAGKPGTDGKAGNAGVTGSPGSRGE
PGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEQGDVGPIGPVGPVGPKG
PIGQPGPTGKQGGTGNRGITGPDGKVGPPGPQGRMGSQGPPGNPGEMGNK
GEKGSEGRKGGKGSVGKPGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGN
IGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEGKPGNKGPNG
QKGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGTPGQNGAP
GKNGPPGTPGNPGGTGPAGQPGSLGRPGPNGTPGPRGEPGPSGNDGTPGA
KGSPGPPGPPGQTGLAGNLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTG
SPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPV
GIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIGAPGPDGD
RGDSGPIGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGEDG
APGIPGSPGPKGPPGEGGDPGNPGMPRISKPQPRGAGPAGPKGEAGKPGL
DGIPGEIGPSGKPGAPGPDGDPGDPGETGAPGQDGEEGKEGAPGAPGKPG
LLGPQGLEGNIGSPGPSGEAGDPGATGAPGPVGAPGRDGSLGLPGRQGKP
GEPGKEGAVGKVGSPGVIGAPGNNGADGRKGPLGPRGPPGDKGKPGGPGT
EGKPGSDGSPGDPGFMGSPGPSGPQGSLGKPGKPGPAGSDGLPGDYGEMG
VPGPAGPDGAPGNSGTAGARGPSGLPGGKGKPGPAGKAGKPGNGGFAGIP
GARGASGTPGPAGDAGPLGAPGSNGAIGETGLAGDKGVSGANGKPGQAGR
PGPRGPAGTKGPKGSPGFDGPTGADGDRGAIGYPGPNGPPGPSGPAGLTG
PTGVIGPRGDPGVLGPVGVAGLPGRQGESGPIGQRGPIGPPGPPGPPGGV
MAMQMRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSY
PNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSS
VNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG
INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIE
VSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS*
>Pmo_000089 Pmo_000089
MLRIVSLILICAIYIIAVMANEELVQRVKRQATSPNQAIGPQGPRGDPGP
RGKAGIPGDTGVLGPPGPPGRDGAAGKSGQSGPSGLPGKDGRPGTPGNVG
SRGPRGEAGVPGPIGPEGGTGKQGSKGPPGEKGDIGPNGLKGSNGESGLQ
GIRGPRGPPGPIGPNGPSGSAGERGKPGPDGRVGGAGPQGPIGPPGVPGL
PGDMGDKGERGDNGPKGVKGEAGNAGLSGKSGPIGPKGPQGSPGVDGRPG
IRGELGNVGPTGPPGSGGPRGQTGAPGNSGHMGPKGAQGEQGPVGLEGKL
GPAGMKGQKGDQGRPGDIGDPGLRGERGVGGIGGNKGPRGEMGPEGSPGN
SGTDGIPGRDGEPGQPGSAGPPGPRGPQGSQGNTGLNGSPGARGENGPFG
SNGIPGNKGEPGVKGPPGLPGSRGSTGNNGVQGIIGPTGIRGPAGQVGEG
GDKGVPGSTGIGGVPGEAGDAGIQGPPGEEGNEGPSGSPGPAGFSGSVGK
IGQTGPVGIDGPPGPPGYEGAPGPNGKDGKSGKDGKPGVPGDTGPSGQKG
TSGPVGERGPSGPSGVKGVKGFDGIMGIPGSFGANGPPGLSGNFGAEGPV
GKSGAPGLPGLPGTQGQRGPIGDSGDPGSSGAQGVEKPPAGRSAGPPGPK
GNRGPPGDNGQPGATGVQGPPGPPGIDGDRGDPGDRGLPGPIGEPGKDGK
AGKVGVAGKDGPPGQDGPEGPRGAPGDVGEPGRQGPEGKPGLDGPEGPRG
QSGLQGKRGPSGNVGPIGKPGKQGKTGSPGTDGSLGRKGPAGARGPQGPR
GKDGPVGESGKTGSPGSDGFAGFPGPSGPQGAIGPEGKPGISGSPGEAGE
QGEFGDIGVPGPPGNDGLPGNAGPPGPMGVPGSLGERGPPGPIGKKGPMG
NTGFVGMPGPRGGRGKPGLLGPMGLVGGVGLQGPKGPPGEPGERGKDGVD
GKAGGAGRPGPPGNLGIKGARGLKGFTGPTGMRGNSGPSGYPGEDGMQGP
IGLIGERGPQGIAGARGERGDTGPSGLIGPTGNDGEYGRPGPQGPMGPVG
PPGPPGSATLMNLRTPKKNLIYGDDPSAALILGNSVIKTPRGTKEVPART
CKHLAEHNPKLTDGEYWIDPNGGRIADAVKVFCKIDKYQTCIESSTKKFK
LQTWVRKYPKGPIWFQTTNGIGEFEYDVPDDQLSYLKALSDKASQQITVK
CMAQAIIRDKNGQLLKSTPSLLGDDDTILTLDHPKRQYTIVKDDCQYEKN
SDAETILEMSGKSSRLPIKDIGLVIDSDKKVGIELSEVCFS*
>Pmo_027332 collagen
MGKDGVRGPPGLIGPAGKPGSDGKAGVAGVAGSPGPRGEPGLTGSMGQEG
VAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQ
GITGNRGITGPDGKVGPPGPQGKMGPKGPPGNPGEMGNKGEKGSEGRKGG
KGSSGKPGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMGSQGPSG
QRGSRGIIGNPGEVGPKGSEGDQGPIGLEGKPGNKGPNGLKGDRGRPGQI
GENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNGVLGKNGPPGTSGN
PGGTGPTGQPGPLGRPGPNGTPGPRGEPGPGGNDGMPGAKGSPGPPGPPG
QPGLAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDT
GPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGF
PGELGVHGKNGAPGNNGKPGKPGAPGPVGIIGAPGPDGDRGDNGPIGARG
ITGPSGVLGVPGTYGPNGAPGPEGTLGKQGPIGKSGLDGIPGLPGLPGPK
GPPGESGDPGPPGNPRISKPQPRGAGPAGPKGETGKPGLDGVPGEVGPSG
KPGATGPDGDAGDPGDAGAPGPDGEEGKSGALGAPGKPGLLGPMGLEGSV
GAPGPAGEAGDSGISGAPGPVGLPGRDGNLGLPGKQGKQGDPGKEGPVGK
PGGLGVPGVPGMNGANGRKGPLGLRGPQGDKGKTGAPGTDGKPGPDGTTG
DPGVMGSPGPSGPQGSLGKPGKPGLPGSEGLTGDYGELGVPGPVGMDGPP
GNPGTVGAPGPPGGPGGKGKPGAKGKPGKAGSGGFPGVPGSRGALGKPGP
SGDPGDAGELGPNGALGEAGLVGDKGVSGANGKPGQAGRPGSRGLPGVKG
PKGSPGFDGPTGSDGDRGPTGFSGPDGPPGPSGTEGPTGPTGVIGPRGDP
GVLGPIGVPGLPGRQGESGPIGQRGPIGPPGPPGPPGGVMAMQMRSPTKG
IMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWID
PNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLT
KKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSP
RLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIR
DVGVTIISKNDSQFGLKFEEVCFS*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.