laminin, Pgr_008586 (mRNA) Phagocata gracilis

Overview
Namelaminin
Unique NamePgr_008586
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length3716
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of laminin vs. RefSeq Human
Match: gi|767903961|ref|XP_011539621.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X6 [Homo sapiens])

HSP 1 Score: 159.073 bits (401), Expect = 4.4747e-38
Identity = 132/497 (26.56%), Postives = 210/497 (42.25%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSCDNGTL-IPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APD--FSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY-------ITNPDL---VESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKII--ISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C+N CI CDG+ DC D SDE D C PN C N C ++ W+CDG DC + DE +CP K ++ G + + C + + IP ++ CD +SDC DE GC PPQV+ P + S + T+T C G P P I WR NWG++P VT TL I ++ D G YTCE + R ++ PD + + C +F + CL C+C +T C S + PD V + + T +P+ + D+S+ + + ++ F + FLG ++ YG L Y + ++ + + P VV+ G ++ + + N R + + ++ W HE +PV R +++L+ + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPC---GNG----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTS-----EGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLV----HDSFWALPEQFLGNK-------VDSYGGSLRYNVRYELARGMLEPVQRPDVVLMG--------AGYRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 762
BLAST of laminin vs. RefSeq Human
Match: gi|578798997|ref|XP_006710658.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X4 [Homo sapiens])

HSP 1 Score: 158.688 bits (400), Expect = 5.92438e-38
Identity = 132/497 (26.56%), Postives = 210/497 (42.25%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSCDNGTL-IPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APD--FSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY-------ITNPDL---VESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKII--ISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C+N CI CDG+ DC D SDE D C PN C N C ++ W+CDG DC + DE +CP K ++ G + + C + + IP ++ CD +SDC DE GC PPQV+ P + S + T+T C G P P I WR NWG++P VT TL I ++ D G YTCE + R ++ PD + + C +F + CL C+C +T C S + PD V + + T +P+ + D+S+ + + ++ F + FLG ++ YG L Y + ++ + + P VV+ G ++ + + N R + + ++ W HE +PV R +++L+ + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPC---GNG----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTS-----EGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLV----HDSFWALPEQFLGNK-------VDSYGGSLRYNVRYELARGMLEPVQRPDVVLMG--------AGYRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 745
BLAST of laminin vs. RefSeq Human
Match: gi|767903954|ref|XP_011539619.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X1 [Homo sapiens])

HSP 1 Score: 158.688 bits (400), Expect = 5.92837e-38
Identity = 132/497 (26.56%), Postives = 210/497 (42.25%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSCDNGTL-IPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APD--FSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY-------ITNPDL---VESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKII--ISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C+N CI CDG+ DC D SDE D C PN C N C ++ W+CDG DC + DE +CP K ++ G + + C + + IP ++ CD +SDC DE GC PPQV+ P + S + T+T C G P P I WR NWG++P VT TL I ++ D G YTCE + R ++ PD + + C +F + CL C+C +T C S + PD V + + T +P+ + D+S+ + + ++ F + FLG ++ YG L Y + ++ + + P VV+ G ++ + + N R + + ++ W HE +PV R +++L+ + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPC---GNG----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTS-----EGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLV----HDSFWALPEQFLGNK-------VDSYGGSLRYNVRYELARGMLEPVQRPDVVLMG--------AGYRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 762
BLAST of laminin vs. RefSeq Human
Match: gi|767903963|ref|XP_011539622.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X7 [Homo sapiens])

HSP 1 Score: 158.303 bits (399), Expect = 6.48329e-38
Identity = 132/497 (26.56%), Postives = 210/497 (42.25%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSCDNGTL-IPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APD--FSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY-------ITNPD---LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKII--ISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C+N CI CDG+ DC D SDE D C PN C N C ++ W+CDG DC + DE +CP K ++ G + + C + + IP ++ CD +SDC DE GC PPQV+ P + S + T+T C G P P I WR NWG++P VT TL I ++ D G YTCE + R ++ PD + + C +F + CL C+C +T C S + PD V + + T +P+ + D+S+ + + ++ F + FLG ++ YG L Y + ++ + + P VV+ G ++ + + N R + + ++ W HE +PV R +++L+ + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPC---GNG----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTS-----EGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLV----HDSFWALPEQFLGNK-------VDSYGGSLRYNVRYELARGMLEPVQRPDVVLMG--------AGYRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 762
BLAST of laminin vs. RefSeq Human
Match: gi|767903957|ref|XP_011539620.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X3 [Homo sapiens])

HSP 1 Score: 158.303 bits (399), Expect = 6.56143e-38
Identity = 132/497 (26.56%), Postives = 210/497 (42.25%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSCDNGTL-IPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APD--FSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY-------ITNPDL---VESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKII--ISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C+N CI CDG+ DC D SDE D C PN C N C ++ W+CDG DC + DE +CP K ++ G + + C + + IP ++ CD +SDC DE GC PPQV+ P + S + T+T C G P P I WR NWG++P VT TL I ++ D G YTCE + R ++ PD + + C +F + CL C+C +T C S + PD V + + T +P+ + D+S+ + + ++ F + FLG ++ YG L Y + ++ + + P VV+ G ++ + + N R + + ++ W HE +PV R +++L+ + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPC---GNG----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTS-----EGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLV----HDSFWALPEQFLGNK-------VDSYGGSLRYNVRYELARGMLEPVQRPDVVLMG--------AGYRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 762
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003325 (SmedAsxldir_c101543_g1_i1|m.51138|m.8906)

HSP 1 Score: 1298.11 bits (3358), Expect = 0
Identity = 625/1159 (53.93%), Postives = 847/1159 (73.08%), Query Frame = 1
Query:  145 IVKLVVLGFLVDENTAVFNLTRNVSIQVEPLKYGEVNIYFVCPNIRSNEDKVMYYK-VEKGIKGLIQKRKPHGIILKIKTKSDLGEYQCSIISKDSSTRNATLNIIDSKEMESPVKFVYDYSKTKYVIEKSGSVELDSEASTNDMVTWYRPPQFHIFTGRKLKIDNLNEFDFGTYYFAIGMTSKSVLQVTKVILLPQRPTKREKTIDEDVMYLENIIPKAKEIRYRPGNVAGISETVTWEQPPGTILLEHGRDAYFYSYTASKSDLPLYYRINKNGDFTVNKVGKVFISEWKNREVEMSVEGRAAYGAEMKVNCIP-SPDLGNKTEVIWRLDDKIIHRGNTYFIKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYYNFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNINRFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIELSPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPESIVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTGILIVKTKQMLTVNPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNSLLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIMAPDFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPDLVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCETKTE* 3615
++ L + FL+ + T F TRNVS+ ++ K+ I+FVCP IR + D + YYK VE + + ++ GI++K+K DLG+Y+CS++SKD + RN+TLNI D +ESP FVY + YV + +G+VELD + + V W+RPPQ+HI++G K KID ++ + +GTYY + G +K ++V K+IL+ +EK IDE+V Y+E + +K+IRYR NV + V+WE PPGTILL++ RD FY + ++ +YYRIN+ GD ++NK+GK+ IS ++ ++ M V YG+EMK++C+ + G +VIW+ DD +IH GNT I +F+K+ +GKYSCEI R + R +NL P+ E+KIEMTPDPG YY +H KELHCEI+R D +W + DIIWTFNGRKIDV + + + RLDT SVSILV+K+M E+N+G YKC+Q F++ L++E+S V+IE++PP + N NH+AE HCRIDT NSS I WKF+ NS E DLP E+ VE+P S+TSFV I+N LKKHEG YVC+VL +V G ++V+TK +L V+PK +TV PGG ARF+C+L + GKV WRR DKKS + KE R SLLE+K+ TK DDGT+YEC FN LT+ VTL+VK+EC LNQRKC+NETCIDE KFCDGKNDCGDNSDED K+C EC+PNSIHCDFL +++P KRC+++HWQCDGIDDCGNNFDEL+CP KNKDKC+G+HY C+N LIPR+YWCDG+ DC SMEDEE CS PQ+IEP K + +S+ NSTLT+ C++SGRP+PTI+WRYNW +LP+ +D+N+T V+NC++ITS+LT+ NI+ + SGIY+CEGI +RRI+APDFSV+VTKG +C+RP++NNDAW + C+RCYCSN+TD+C+SA GY TNP L+ES ++ SDAAI+N++T EY++PAR ++F + + Y IN T Y+K V + D + GG+FNM GSW+ RYGYPLTYK+I+SGE+ ++PGP+VVI+G + I++CS KYR+P YASNE ENN+RI LWEQD WFTDH CT P R FI +L++VR + F++KY+ Q++F+MS I+MQEAI+T Y W +LEKC CP+GYSGLSCE K E*
Sbjct: 6 VIPLFIFQFLISQ-TFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYYRD--FYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYK----RKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKG-ESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCENKVE* 1156
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003584 (SmedAsxldir_c102345_g1_i1|m.54199|m.2277)

HSP 1 Score: 269.24 bits (687), Expect = 1.52097e-75
Identity = 192/615 (31.22%), Postives = 288/615 (46.83%), Query Frame = 1
Query: 1057 YGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYFIKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKA------GTESKIEMTPDPGLYYNFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNINRFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIELSPPRLTVLHNANHVAEFHCRIDT-PGYNSSFIEWKFMKFNSTIEYDLPPES-IVEKPHQTSATSFVTIKNSLKKHEGFYVC-KVLGRQVTGILIV---KTKQMLTVNPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKE---------NRLGGSTNSLLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKR-RIMAPDFSVTV 2835
YG + C P N + W D+ I IK+F+K+ G Y C + + S ++L ++ ESKIE+T PG H + KELHCEI G R K+ W NG+K G+I RLD + VS+LV+ D+ + N+G Y+C G LI+ E +IE SPP L V EFHCR++ P + ++W F + ++P + TSF+ + + G+Y+C + G+ LIV K K LT+ P+EI V G C G+ + + SF NK + +G + L ++ +D+ C+ ++V D C R CQN C++ KFCD N C D SDEDP CREC P S C+ N P K + HW CDG +DCGN +DE +C + + C G ++C + IPR Y CD + DC EDE GC+ PQ+ + + + + ++ +TL C+ +G+P+P + WR+NWG + ++ + T+C +TS+LTI + D GIY CE + R R + DF V +
Sbjct: 236 YGERFSLRCEVEPFYQN-IKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVA---SLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVFVHRGEKKELHCEIETSSGN---RGKEAEWYINGKKF-------KNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKV--KEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGN--PEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSA-TKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 831
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001730 (Asxlregen_comp65513_c0_seq1|m.19286|m.12982)

HSP 1 Score: 270.011 bits (689), Expect = 2.57795e-75
Identity = 194/609 (31.86%), Postives = 295/609 (48.44%), Query Frame = 1
Query: 1069 MKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYFIKNFQKEVYGKYSCEIHRNGVMIQSRIIN------LTPKAGTESKIEMTPDPGLYYNFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNINRFGRLDTRSVSILVLKDMGEDNQGVYKC-FQGPLTFASILIMEQSEVIIELSPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPESIVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTG--ILIVKTKQMLTVNPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNSLLE----------IKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGT-LIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSH-LSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIE-KRRIMAPDFSV 2829
+++NC +P L + T I+ +D++I + + + I K G Y C + R + +IN + + + SKIE++ PG +ELHCEI G + K+ IW F G++I+ + A NI RL VSI+VL+++ + N+G Y+C +G A I++M +S+ E+SP + T EFHCR++ + + W F+ + ++ TSF+ + + K G Y+C + T LIV++ + V P I + G TA F C + R D F + R + + +E + VT D+GT + C T V + V C+ R C+N CI+ KFCDGK DC D SDED + CR+C P S C+ N +PI HW CDG DDCGN +DE C N +C G Y C++GT IPRA+ CD D+DC + +DE C+ P +I+ + S+ ++ T+TL CQ++G P+P I WR+NWG L + V E NC STLTI+ P D GIY CE + +R + D+ +
Sbjct: 317 LELNCEVTPPLRDVTYEIY-FNDRLISQSSRHTIPRLDKTNMGVYQC-VSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTG---LQGKNAIWYFKGQEINSND--YARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNT-EVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAG-----RSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG-NVLECGGLKYQCNDGTKSIPRAFVCDKDTDCVNGDDESRCTQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQL 908
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001643 (Asxlregen_comp65113_c0_seq2|m.18193|m.7115)

HSP 1 Score: 268.085 bits (684), Expect = 1.09643e-74
Identity = 191/599 (31.89%), Postives = 293/599 (48.91%), Query Frame = 1
Query: 1066 EMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYFIKNFQKEVYGKYSCEI-------HRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYYNFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNINRFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIELSPPRLTVLHNANHVAEFHCRID-TPGYNSSFIEWKFMKFNSTIEYD-LPPESI--VEKPHQTSATSFVTIKNSLKKHEGFYVCKVL-GRQVTGILIVKTKQ---MLTVNPKEITVSPGGTARFLC-QLTAMNGKVTWRRKDKKSF--ILNKENRLG----GSTNSLLEIKEVTKADDGTI-YECNFNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGI 2793
E K+ C P + N IW+ D+ ++ T I +FQ++ G YSCEI +G I S +N+ + + +KIE+ G+ + KE+HCEI R D+ W FN ++D + R D VSI+ L ++ N+G+Y C + LI+ Q E + ++P R ++ N EFHCR + P + ++ ++W F + T+ L E+ + +T TSF++I +SL K GFY+C G + T L++K ++ +LT+ P+ + V G C ++ G+ K + L+ + RL G + L IK+ + D + EC+ + T++++++C N R+C N C GKFCDG +C D SDE+P C +C P C+ N P+K + HW+CDG +DCGNNFDE C ++N KC ++C NG +IPRAY CD +SDC + EDE GC PQV + + L C+ G P P I WRYNWG L D++ + + C + S L ITN P D GIY CE +
Sbjct: 329 EFKLKCEIFPPIPN-ANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQI-SENVNVKFQYSSNNKIELD-KFGVQMISRVGEKKEMHCEISTSSPN---RGSDVEWFFNKERLD-----ETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPER--IIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRRGGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETL 913
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15035123 (SmedSxlregen_c88126_g1_i1|m.36302|m.5005)

HSP 1 Score: 256.144 bits (653), Expect = 1.25513e-70
Identity = 195/643 (30.33%), Postives = 301/643 (46.81%), Query Frame = 1
Query:  988 VGKVFISEWKNREVEMSV---EGRAAYGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYFIKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTE------SKIEMTPDPGLYYNFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNINRFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIELSPPRLTVLHNANHVAEFHCRID-TPGYNSSFIEWKFMKFNSTIEYDLPPES-IVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTG---ILIVKTKQM--LTVNPKEITVSPGGTARFLCQLTAMNGKVTWRRK----------DKKSFILNKENRLGGSTNSLLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGI-EKRRIMAPDFSVTV 2835
+ K+F + ++ ++S+ + + + C P L N W + + G T F K + +Y C G I LT ++ + +KIE+T +PG + KELHCEI DG ++I W FNG+ I EN L R R++ R VSILVL + DN+G Y+C G + + ++++ +I +P ++ V+ + EFHCRID ++ + W+F N I Y L + + TSF+ + + G+ C + G +T +++V+ K +TV P + V F C + G K + K F++ +G S + V D+ + C+ N V + V++ C NQR+CQN C+ GKFCDG DC D SDEDP C C P C + +P ++ + ++W CDG +DCGNN+DE++C DK+ KC G ++C N IPR CDG+SDC EDE C P +I +K SH+ S + L C+ + P+PTI WR+NWG LP+ ++ V NC + STLTI D IY CE + R ++ DF V++
Sbjct: 299 IAKIFTEISQGKKYDISIVQYPQKTRLNERLSLRCQVLPSLTN-VRYEWFRNGQYYQTGQTLIFPKFSKLLVDRYECRAI--GTTENQVEIFLTVESDQKLTYLSYNKIELTENPGPNIALKLNEKKELHCEIEDIDG---LSGENIEWFFNGKMI--ENSLIKS---YRLDRVNKRLVSILVLMNSQLDNEGRYECRYGIVRKEATVMLDIDSGMIVTNPSKIKVIEGS--PVEFHCRIDDVYNIDNRNLSWRFYNNNFQINYSLENSKWRLTESKIADHTSFINLDRATMADSGYIEC-ISGNGLTAQSQLIVVEDKHKFNITVTPNHLRVRKNQLFEFECFGQSDEGIPYGEPKFEFPGGKPVENDKRFLVTT---VGPSRIRITAPHGVNIKDELKLI-CSVNKQVSAVYIQVQETCPPNQRQCQNRQCLPVGKFCDGIADCVDGSDEDPTVCNSCEPAFTTCQDVYGFAPTRKTINKNWICDGENDCGNNYDEINCEDKST-KCNGLFFTCKNNMTIPRGQVCDGNSDCLLDEDEADCLKPVIISTSK-SHVKANIGSKVKLQCEATAHPLPTIIWRFNWGCLPNENRVTISTVKKNCRKVISTLTIDEFQAGDDAIYNCEALSSSNRALSQDFHVSI 921
BLAST of laminin vs. uniprot
Match: gi|317373536|sp|P98160|PGBM_HUMAN (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; AltName: Full=Perlecan; Short=PLC; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 157.147 bits (396), Expect = 4.34588e-37
Identity = 133/496 (26.81%), Postives = 211/496 (42.54%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSCDNGTL-IPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APDFSVT-VTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY-------ITNPD---LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKII--ISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C+N CI CDG+ DC D SDE D C PN C N C ++ W+CDG DC + DE +CP K ++ G + + C + + IP ++ CD +SDC DE GC PPQV+ P + S + T+T C G P P I WR NWG++P VT TL I ++ D G YTCE + R ++ PD + V + C +F + CL C+C +T C S + PD V + + T +P+ + D+S+ + + ++ F + FLG ++ YG L Y + ++ + + P VV+ G ++ + + N R + + ++ W HE +PV R +++L+ + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPC---GNG----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTS-----EGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLV----HDSFWALPEQFLGNK-------VDSYGGSLRYNVRYELARGMLEPVQRPDVVLMG--------AGYRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 744
BLAST of laminin vs. uniprot
Match: gi|1172451|sp|Q05793|PGBM_MOUSE (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 154.066 bits (388), Expect = 3.70474e-36
Identity = 135/499 (27.05%), Postives = 204/499 (40.88%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE----DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG-SHYSC-DNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKRRIM--APDFSVT-VTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPDL----------VESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHEN--NIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
C + C + CI CDG+ DC D SDE P C PN C+ C ++ W+CDG DC + DE +C K + G +H+ C IP ++ CD +SDC DE GC PPQV+ P + S + T+T C +G P P I WR NWG++P V TL I ++ D G YTCE + R ++ PD + V + C +F + D CL C+C VT+ C S+ + L V + S T +PA + D+S+ + + ++ F FLG + G ++ Y + Y++ P I+V G YR+ + H N R + ++ W HE +PV R ++ L + + + Y K + +S I M + + +E+C CP GYSGLSCE+
Sbjct: 285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCASPP---PCEPNEFACEN-------GHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQS-IQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAH-----PRVTMTSEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLE--DSASCLPCFCFGVTNVCQSSLRFRDQIRLSFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLV----HDAFWALPKQFLGNKVDSYGGFLR---YKVRYELARGMLEPVQKPDVILVGAG------------YRLHSRGHTPTHPGTLNQRQVQLSEEHWV--HESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGRAHSVEECRCPIGYSGLSCES 744
BLAST of laminin vs. uniprot
Match: gi|30179887|sp|Q06561|UNC52_CAEEL (RecName: Full=Basement membrane proteoglycan; AltName: Full=Perlecan homolog; AltName: Full=Uncoordinated protein 52; Short=Protein unc-52; Flags: Precursor)

HSP 1 Score: 127.487 bits (319), Expect = 4.13666e-28
Identity = 151/530 (28.49%), Postives = 212/530 (40.00%), Query Frame = 1
Query: 1906 MLTVNPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGS-------TNSLLEIKEVTKADDGT---IYECNFNSLTEIVTLWV--------------KDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDED--PKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDK-NKDKCLGSHYSC-DNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIE-KRRIMA-PDFSVTV----------------------TKGSV-----------------------CKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPDLV----ESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEG 3258
+TV P E V G F C+ R D + + R+GG + L I V +D GT + + N N++ TL V +C +++ C N C+ CDG+ DC D SDE P R C PN C+ NN +CV + W CDG DDCG+N DEL+C K + C + + C D +P ++ CDG +DC DE GC P V++P + ++L V +T +L C+ P P I WR NWG + + + TLTI + P D G YTCE I K R++A PD V V T+G+V CK F+ E CL+C+C V++DC S+ Y T L+ V SD N F SF T+ T K+ FLG + YG + ++I SG S H P+VV++G
Sbjct: 46 QITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NN-----KCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEP-----PRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPF------SFFKTGYLTFDGTTDGVAKYWRLPQRFLGDK-------VTAYGGKMEFEIEFSG-SGHHSSEPMVVLKG 539
BLAST of laminin vs. uniprot
Match: gi|160409939|sp|A2ARV4|LRP2_MOUSE (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 92.0485 bits (227), Expect = 2.56503e-17
Identity = 51/131 (38.93%), Postives = 68/131 (51.91%), Query Frame = 1
Query: 2164 DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKR---CRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPP 2547
+ C+ NQ C N CI CDG NDCGD SDED + + C+ C +N+ P +RC+ +HW CDG DC + DEL + C +SC NG I +++ CD +DC DE GCS P
Sbjct: 2906 NSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTC--INSRPPNRRCIPQHWVCDGDADCADALDELQ--NCTMRACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP 3032

HSP 2 Score: 81.2629 bits (199), Expect = 5.72098e-14
Identity = 46/117 (39.32%), Postives = 60/117 (51.28%), Query Frame = 1
Query: 2188 KCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
+C N CI CDG +DCGDNSDE+ RECT + C ++C+ W CD +DCG+N DE C K C H+ C +G +P+A CDG +DC DE C
Sbjct: 3728 RCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 3 Score: 80.8777 bits (198), Expect = 7.87937e-14
Identity = 60/181 (33.15%), Postives = 81/181 (44.75%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCREC---TPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDEL--HCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPA-KLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHN 2694
C +C+N CI CDG+NDC D SDE+ C +P CD NS RC+ H C+G+DDCG+ DE HC C + Y C NG + + Y CD DC + DE GC+ + A K+ + + S +C S RP G+ P T+D N
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCD---NS----RCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTCAEKICEQNCTQLSNGGFIC--SCRP----------GFKPSTLDKN 4005

HSP 4 Score: 80.1073 bits (196), Expect = 1.21079e-13
Identity = 48/124 (38.71%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 2170 CALNQRKCQN-ETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEE 2532
C + KCQ C+ CDG NDCGD SDE+P C C N C SP RC+ +W CDG DC ++ DE + + C + + CDNG I ++ CDGD+DC M DE+
Sbjct: 2823 CQPDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSP-HRCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDED 2940

HSP 5 Score: 79.337 bits (194), Expect = 1.84493e-13
Identity = 45/124 (36.29%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDE--LHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDE 2529
C L Q +C++ C C+ + DC D SDED C C N C KRC+ +WQCD +DDC +N DE HC + C + C+NG IP+++ CD D+DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRT---CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 6 Score: 78.5666 bits (192), Expect = 3.32698e-13
Identity = 52/136 (38.24%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDE-LHCPDKNKDKCLGSHYSCDNGT---------LIPRAYWCDGDSDCKSMEDEEGC 2538
C N+ +C N+ CI E CD +DC DNSDEDP C R C P C NN RC+ + W+CD +DCG+ DE +H +C+ + Y+CDN T IP+ C+G DC+ DE+GC
Sbjct: 3595 RCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKC---NNG----RCIPQSWKCDVDNDCGDYSDEPIH-------ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716

HSP 7 Score: 71.633 bits (174), Expect = 4.58876e-11
Identity = 46/124 (37.10%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 2179 NQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQ 2550
+Q C N C + + CD K DC D+SDE CT +F S C++R + CD +DC +N DE +C N D C G ++C NG I + + CDGD DC+ DE+GC Q
Sbjct: 148 DQLTCANGACYNTSQKCDHKVDCRDSSDE-----ANCTTLCSQKEFQCGSG---ECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 8 Score: 70.8626 bits (172), Expect = 6.93242e-11
Identity = 49/143 (34.27%), Postives = 65/143 (45.45%), Query Frame = 1
Query: 2110 IYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDK--NKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEE 2532
I +C NS E V EC ++ +C ++ CI CD +NDCGDNSDE + C P C CV + CDG DC + DE CP + N C + + C N I + CDG++DC DEE
Sbjct: 3744 IDDCGDNSDEESC---VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEE 3876

HSP 9 Score: 69.707 bits (169), Expect = 1.72115e-10
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIK--------RCVVRHWQCDGIDDCGNNFDELHCPDKN-KDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKL 2571
+C + C N C+ CDG +DC DNSDE C LNN+ +C+ W+CD +DC + DE +CP ++ C + ++CDN IP+ + CD D+DC DE+ C P +
Sbjct: 1024 QCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDEH------------QCGALNNTCSSSAFTCVHGGQCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQF 1155

HSP 10 Score: 69.3218 bits (168), Expect = 2.12439e-10
Identity = 49/128 (38.28%), Postives = 63/128 (49.22%), Query Frame = 1
Query: 2170 CALNQRKCQN-ETCIDEGKFCDGKNDCGDNSDEDPKRCRE---CTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELH-CPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
C +Q KC + +CI+ CDG DC DNSDE R C P+ C C+ W+CDG DC DE + C K C SH+ CDNG I ++ CDGD+DC+ M DE+ C
Sbjct: 1188 CTSSQFKCADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGT------CIPNTWECDGHPDCIQGSDEHNGCVPKT---CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDC 1306

HSP 11 Score: 69.3218 bits (168), Expect = 2.53527e-10
Identity = 49/134 (36.57%), Postives = 67/134 (50.00%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSME--DEEGCSPPQVIEP 2562
C Q C N CI + CD NDCGD SDE P C T S N RCV H++CD +DCG+N DE C ++ + + ++C NG IP +Y C+G ++C + DE+ C PP +P
Sbjct: 2700 RCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCANG-----RCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNC-PPITCQP 2825

HSP 12 Score: 68.5514 bits (166), Expect = 4.49437e-10
Identity = 46/133 (34.59%), Postives = 61/133 (45.86%), Query Frame = 1
Query: 2167 ECALNQRKCQNET---------CIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
EC C N T CI + C+G +DC DNSDE C P+ DF + C+ W+CDGIDDCG+N DE C + +C S + C + IP + CD ++DC DE C
Sbjct: 3672 ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DFRCGN---HHCIPLRWKCDGIDDCGDNSDEESCVPR---ECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795

HSP 13 Score: 67.3958 bits (163), Expect = 9.75122e-10
Identity = 45/135 (33.33%), Postives = 60/135 (44.44%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCD-NGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKL 2571
C Q +C + CI CDG DC D SDE CT + C + SS C+ ++CDG+ DC +N DE CP + C + C +GT IP + CDG DC DE P+ P+
Sbjct: 1150 CHPTQFRCPDHRCISPLYVCDGDKDCVDGSDE-AGCVLNCTSSQFKC--ADGSS----CINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKTCSPSHF 1277

HSP 14 Score: 58.5362 bits (140), Expect = 4.43371e-07
Identity = 43/128 (33.59%), Postives = 51/128 (39.84%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELH-CPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPP 2547
EC +C N CI CDG DC D++DE C P S F + C+ W CD DC + DE CP C +C NG +P Y CD SDC DE C P
Sbjct: 27 ECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDE-----IGCPPRSCGSGFFLCPAE-GTCIPSSWVCDQDKDCSDGADEQQNCPGTT---CSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145

HSP 15 Score: 58.151 bits (139), Expect = 6.52982e-07
Identity = 41/115 (35.65%), Postives = 51/115 (44.35%), Query Frame = 1
Query: 2206 CIDEGKFCDGKNDCGDNSDED--PKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
CI CD +NDC D SDE P R C P S CD C+ + W CD +DC + DE +C + C + + C + I Y CDGD DC DE GC
Sbjct: 1079 CIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDN-------HMCIPKEWVCDTDNDCSDGSDEKNC--QASGTCHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGC 1184

HSP 16 Score: 57.3806 bits (137), Expect = 9.78007e-07
Identity = 39/124 (31.45%), Postives = 54/124 (43.55%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDEL-HCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
C+ + C N CI + CD +NDCGD SDE C + C +C+ + + CD +DCG+ DE H + C + CDNG I C+ DC DE+GC
Sbjct: 2995 CSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYPPCRDDQFTCQN-------GQCITKLYVCDEDNDCGDGSDEQEHLCHTPEPTCPPHQFRCDNGHCIEMGTVCNHVDDCSDNSDEKGC 3111
BLAST of laminin vs. uniprot
Match: gi|1708867|sp|P98158|LRP2_RAT (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 86.2705 bits (212), Expect = 1.7783e-15
Identity = 48/129 (37.21%), Postives = 67/129 (51.94%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKR---CRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPP 2547
C +Q +C N CI CDG NDCGD SDED + + C+ C +N+ P +RC+ ++W CDG DC + DEL + C +SC NG + +++ CD +DC DE GCS P
Sbjct: 2908 CRASQFQCDNGRCISGNWVCDGDNDCGDMSDEDQRHHCELQNCSSTQFTC--VNSRPPNRRCIPQYWVCDGDADCSDALDELQ--NCTMRTCSAGEFSCANGRCVRQSFRCDRRNDCGDYSDERGCSYP 3032

HSP 2 Score: 81.2629 bits (199), Expect = 4.95765e-14
Identity = 49/124 (39.52%), Postives = 62/124 (50.00%), Query Frame = 1
Query: 2170 CALNQRKCQN-ETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEE 2532
C + KCQ C+ CDG NDCGD SDE+P C C N C SP +RC+ +W CDG DC + DE + + C S + CDNG I + CDGD+DC M DE+
Sbjct: 2823 CPPDFTKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----LSP-QRCIPSYWFCDGEADCADGSDEPDTCGHSVNTCRASQFQCDNGRCISGNWVCDGDNDCGDMSDED 2940

HSP 3 Score: 80.4925 bits (197), Expect = 8.79125e-14
Identity = 50/129 (38.76%), Postives = 63/129 (48.84%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCREC---TPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDEL--HCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCS 2541
C +C+N CI CDG+NDC D SDE+ C +P CD NS RCV H C+G+DDCG+ DE HC C + Y C NG I + Y CD +DC + DE GC+
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPQRFRCD---NS----RCVYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLSDETGCN 3965

HSP 4 Score: 79.7221 bits (195), Expect = 1.50724e-13
Identity = 45/117 (38.46%), Postives = 60/117 (51.28%), Query Frame = 1
Query: 2188 KCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
+C N CI CDG +DCGDNSDE+ REC+ + C ++C+ W CD +DCG+N DE C K C H+ C +G +P+A CDG +DC DE C
Sbjct: 3728 RCANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 5 Score: 76.2554 bits (186), Expect = 1.69052e-12
Identity = 44/124 (35.48%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDE--LHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDE 2529
C L Q +C++ C C+ + DC D SDED C C N C KRC+ + WQCD ++DC +N DE HC + C + C+NG IP+++ CD D+DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCESNEWQC-------ANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRT---CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 6 Score: 75.8702 bits (185), Expect = 2.53273e-12
Identity = 51/135 (37.78%), Postives = 67/135 (49.63%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGT---------LIPRAYWCDGDSDCKSMEDEEGC 2538
C N+ +C N+ CI + CD NDC DNSDED C R C P C NN RC+ + W+CD +DCG+ DE D+C + Y+CDN T IP+ C+G DC+ DE+GC
Sbjct: 3595 RCESNEWQCANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRTCRPGQFKC---NNG----RCIPQSWKCDVDNDCGDYSDE------PIDECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716

HSP 7 Score: 71.2478 bits (173), Expect = 6.81665e-11
Identity = 49/136 (36.03%), Postives = 67/136 (49.26%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRC--RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSME--DEEGCSPPQVIEP 2562
C Q C N CI++ CD NDCGD SDE P C C + C RCV H++CD +DCG+N DE C +N + + ++C NG IP +Y C+G ++C + DE+ C PP P
Sbjct: 2700 RCNQLQFTCLNGHCINQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCGN-------GRCVPYHYRCDYYNDCGDNSDEAGCLFRNCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNC-PPHTCPP 2825

HSP 8 Score: 71.2478 bits (173), Expect = 6.87429e-11
Identity = 44/127 (34.65%), Postives = 60/127 (47.24%), Query Frame = 1
Query: 2158 VKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDK--NKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEE 2532
V EC+ ++ +C ++ CI CD +NDCGDNSDE + C P C CV + CDG DC + DE CP + N C + + C N I + CDG++DC DEE
Sbjct: 3757 VPRECSESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEE 3876

HSP 9 Score: 70.8626 bits (172), Expect = 7.23051e-11
Identity = 46/124 (37.10%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 2179 NQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQ 2550
+Q C N C + + CD K DC D+SDE CT +F S C++R + CD +DC +N DE +C N D C G ++C NG I + + CDGD DC+ DE+GC Q
Sbjct: 148 DQLTCANGACYNTSQRCDQKVDCRDSSDE-----ANCTTLCSQKEFECGSG---ECILRAYVCDHDNDCEDNSDERNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 10 Score: 69.707 bits (169), Expect = 1.82564e-10
Identity = 49/128 (38.28%), Postives = 63/128 (49.22%), Query Frame = 1
Query: 2170 CALNQRKCQN-ETCIDEGKFCDGKNDCGDNSDEDPKRCRE---CTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDE-LHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
C Q KC + +CI+ CDG DC DNSDE R C P+ C C+ W+CDG DC + DE C K C +H+ CDNG I +A+ CDGD+DC+ M DE+ C
Sbjct: 1188 CTSAQFKCADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQCQGDGT------CIPNTWECDGHPDCIHGSDEHTGCVPKT---CSPTHFLCDNGNCIYKAWICDGDNDCRDMSDEKDC 1306

HSP 11 Score: 69.3218 bits (168), Expect = 2.33055e-10
Identity = 43/140 (30.71%), Postives = 64/140 (45.71%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRC----RECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCP-DKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKL 2571
+C C N C+ CDG +DC DNSDE +C C+P++ C +C+ W CD +DC + DE +CP C + ++CDN IP+ + CD D+DC DE+ C +P +
Sbjct: 1024 QCGSLSFPCNNGKCVPSFFRCDGVDDCHDNSDE--HQCGVFNNTCSPSAFAC------VRGGQCIPGQWHCDRQNDCLDGSDEQNCPTHATSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSDEKNCQASGTCQPTQF 1155

HSP 12 Score: 67.0106 bits (162), Expect = 1.15395e-09
Identity = 43/135 (31.85%), Postives = 56/135 (41.48%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCD-NGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKL 2571
C Q +C + CI CDG DC D SDE C N F + C+ ++CDG+ DC +N DE CP + C + C +GT IP + CDG DC DE P+ P
Sbjct: 1150 CQPTQFRCPDHRCISPLYVCDGDKDCADGSDE-----AGCVLNCTSAQF--KCADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIHGSDEHTGCVPKTCSPTHF 1277

HSP 13 Score: 65.4698 bits (158), Expect = 3.01295e-09
Identity = 51/133 (38.35%), Postives = 61/133 (45.86%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSS--PIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGS-HYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIE 2559
C Q KC N CI + CD NDCGD SDE ECT + +CD S RC+ + C+G DDC +N DE C C S + C N IP + CDG DC DEE C P + E
Sbjct: 3637 CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDEPID---ECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESV---PCHPSGDFRCANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSE 3763

HSP 14 Score: 60.8474 bits (146), Expect = 8.66249e-08
Identity = 41/125 (32.80%), Postives = 54/125 (43.20%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDEL-HCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCS 2541
C+ + C N C+ + CD +NDCGD SDE C N C RC+ R + CD +DCG+ DE H + C + CDNG I C+ DC DE+GC
Sbjct: 2995 CSAGEFSCANGRCVRQSFRCDRRNDCGDYSDERGCSYPPCHANQFTCQN-------GRCIPRFFVCDEDNDCGDGSDEQEHLCHTPEPTCPLHQFRCDNGHCIEMGRVCNHVDDCSDNSDEKGCG 3112

HSP 15 Score: 57.7658 bits (138), Expect = 8.05893e-07
Identity = 41/127 (32.28%), Postives = 48/127 (37.80%), Query Frame = 1
Query: 2167 ECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPP 2547
EC +C N CI CDG DC D++DE R C C C+ W CD DC + DE + C +C NG IP Y CD SDC DE C P
Sbjct: 27 ECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEIGCPPRSCESGLFLCPAEGT------CIPSSWVCDEDKDCSDGADEQQ--NCAGTTCSAQQMTCSNGQCIPSEYRCDHVSDCPDGSDERNCHYP 145
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389351|ref|NP_001245496.2| (terribly reduced optic lobes, isoform AI [Drosophila melanogaster])

HSP 1 Score: 176.792 bits (447), Expect = 4.12112e-44
Identity = 154/505 (30.50%), Postives = 226/505 (44.75%), Query Frame = 1
Query: 2125 FNSLTEIVTLWVKDECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCR---ECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHC-PDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKR--RIMAPDFSVTV--TKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSAN--GYITNPDLVESKVRSSD-AAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQS-DFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
F L V + C Q C N CID+ CDG DC D SDE + C +C PN C +NS +CV R W+CDG +DCG+N DE C P+ + C + + C +G IP+++ CD DC DE GC P I P S +S++E L L C +G P PTI WR NWG++PD + T TL ++ P+DSG Y+CE I R + PD VTV + VC+ +FN A E C++C+C V C SAN Y +P ++ +V S + + + NE +++ + V TN F + +L + G+ + YG L Y++ G S + GP V+I G F +++ R + +NN I + W + R + +L +V I R+ Y + + + I + A +EKC CP GY G SCE+
Sbjct: 731 FFGLDNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC---SNS----KCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESK-------SYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGV----QFRATNVH-FSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR----FTLTYRVRT------QPGQNNRVSIPFVPGGWQKPD--GRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1200

HSP 2 Score: 72.4034 bits (176), Expect = 2.99754e-12
Identity = 58/219 (26.48%), Postives = 93/219 (42.47%), Query Frame = 1
Query: 2164 DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCS-------PPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG--YLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGI 2793
+EC N+ +C N CID K C+ +DC + DE+ + CR C N C NN CV C+G +C ++ DEL+C +CL + + C++G + + C+G +DC+ DE+ C+ P Q+ + E+ + C+ G + W G P D N + N + ED+G Y CE +
Sbjct: 490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EECR-CYANQFRC---NNGD----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRV------------EDAGTYVCEAV 685

HSP 3 Score: 60.8474 bits (146), Expect = 1.01438e-08
Identity = 77/297 (25.93%), Postives = 121/297 (40.74%), Query Frame = 1
Query: 2770 GIYTCEGIE---KRRIMAPDFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--------ITNPDLVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKT-YSINTTNYEKFVTSDDLFLGGSFNMRGSWINR----YGYPLTYKIIISGESVGHIP-GPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWF-TDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKY-DYLWVPRLEKCNCPSGYSGLSCET 3603
GIY C G E KR ++ + C+ + A +Q+ C CYCS + C SA Y I N L+ T+E + + D+S+ Y+ T+Y L +++RGS + YG L+Y +I+ ES G+ G +V+ G K I + P N+ E N+R L E ++W D E +P R F+ +L D++ I R + + ++ A+ T+ +E C CPSGY G SCE+
Sbjct: 1668 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLI---------------TDESGAVQDTENLIPDISRNMYTYTHTSY----------LPKYWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIGNGLKLI------WSRPDGNENQ-EEYNVR--LHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1921

HSP 4 Score: 53.9138 bits (128), Expect = 1.1507e-06
Identity = 60/262 (22.90%), Postives = 103/262 (39.31%), Query Frame = 1
Query: 2824 SVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--ITNPDLVESKVRSSDAAIMNY-QTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCE 3600
SV + CK F+ +++ C+ C+CS V DC S+ Y S+V + NY Q P M + + +S S + + + + FLG N S+ + Y L+Y + +G + +V+ G + + I Y K ++ +N Y + ++ W E R + L D+ I+ + Y + + +T+ A T +E+C CP GY GLSCE
Sbjct: 1322 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLG---NKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHY--RKSQVVPSVANTYS------VEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1570
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389377|ref|NP_001027033.3| (terribly reduced optic lobes, isoform AW [Drosophila melanogaster])

HSP 1 Score: 176.792 bits (447), Expect = 5.13179e-44
Identity = 167/567 (29.45%), Postives = 242/567 (42.68%), Query Frame = 1
Query: 1987 GKVTWRRKDKKSFILNKENRLGGSTNSLLEIKEVTKADDGTI------YECNFNSLTEIVTLWVK----------DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCR---ECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHC-PDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKR--RIMAPDFSVTV--TKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSAN--GYITNPDLVESKVRSSD-AAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQS-DFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
KV W R + +R N LEI + D GT Y V L V+ C Q C N CID+ CDG DC D SDE + C +C PN C +NS +CV R W+CDG +DCG+N DE C P+ + C + + C +G IP+++ CD DC DE GC P I P S +S++E L L C +G P PTI WR NWG++PD + T TL ++ P+DSG Y+CE I R + PD VTV + VC+ +FN A E C++C+C V C SAN Y +P ++ +V S + + + NE +++ + V TN F + +L + G+ + YG L Y++ G S + GP V+I G F +++ R + +NN I + W + R + +L +V I R+ Y + + + I + A +EKC CP GY G SCE+
Sbjct: 923 AKVKWSRPGGRPLPPGFTDR-----NGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC---SNS----KCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESK-------SYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGV----QFRATNVH-FSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG----NRFTLTYRVRT------QPGQNNRVSIPFVPGGWQKPD--GRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1449

HSP 2 Score: 66.6254 bits (161), Expect = 1.99191e-10
Identity = 41/127 (32.28%), Postives = 54/127 (42.52%), Query Frame = 1
Query: 2164 DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKD--KCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGC 2538
+EC N+ +C N CID K C+ +DC + DE+ + C+ C RC+ QCDG DC + DE HC D +C + C G IP CD DC DE C
Sbjct: 530 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQC------RDGTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNC 650

HSP 3 Score: 61.2326 bits (147), Expect = 8.6602e-09
Identity = 77/297 (25.93%), Postives = 121/297 (40.74%), Query Frame = 1
Query: 2770 GIYTCEGIE---KRRIMAPDFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--------ITNPDLVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKT-YSINTTNYEKFVTSDDLFLGGSFNMRGSWINR----YGYPLTYKIIISGESVGHIP-GPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWF-TDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKY-DYLWVPRLEKCNCPSGYSGLSCET 3603
GIY C G E KR ++ + C+ + A +Q+ C CYCS + C SA Y I N L+ T+E + + D+S+ Y+ T+Y L +++RGS + YG L+Y +I+ ES G+ G +V+ G K I + P N+ E N+R L E ++W D E +P R F+ +L D++ I R + + ++ A+ T+ +E C CPSGY G SCE+
Sbjct: 1917 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLI---------------TDESGAVQDTENLIPDISRNMYTYTHTSY----------LPKYWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIGNGLKLI------WSRPDGNENQ-EEYNVR--LHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 2170

HSP 4 Score: 54.299 bits (129), Expect = 9.49673e-07
Identity = 60/262 (22.90%), Postives = 103/262 (39.31%), Query Frame = 1
Query: 2824 SVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--ITNPDLVESKVRSSDAAIMNY-QTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCE 3600
SV + CK F+ +++ C+ C+CS V DC S+ Y S+V + NY Q P M + + +S S + + + + FLG N S+ + Y L+Y + +G + +V+ G + + I Y K ++ +N Y + ++ W E R + L D+ I+ + Y + + +T+ A T +E+C CP GY GLSCE
Sbjct: 1571 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLG---NKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHY--RKSQVVPSVANTYS------VEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1819
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389369|ref|NP_001284822.1| (terribly reduced optic lobes, isoform AS [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 5.19709e-44
Identity = 167/567 (29.45%), Postives = 242/567 (42.68%), Query Frame = 1
Query: 1987 GKVTWRRKDKKSFILNKENRLGGSTNSLLEIKEVTKADDGTI------YECNFNSLTEIVTLWVK----------DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCR---ECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHC-PDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKR--RIMAPDFSVTV--TKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSAN--GYITNPDLVESKVRSSD-AAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQS-DFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
KV W R + +R N LEI + D GT Y V L V+ C Q C N CID+ CDG DC D SDE + C +C PN C +NS +CV R W+CDG +DCG+N DE C P+ + C + + C +G IP+++ CD DC DE GC P I P S +S++E L L C +G P PTI WR NWG++PD + T TL ++ P+DSG Y+CE I R + PD VTV + VC+ +FN A E C++C+C V C SAN Y +P ++ +V S + + + NE +++ + V TN F + +L + G+ + YG L Y++ G S + GP V+I G F +++ R + +NN I + W + R + +L +V I R+ Y + + + I + A +EKC CP GY G SCE+
Sbjct: 721 AKVKWSRPGGRPLPPGFTDR-----NGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC---SNS----KCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESK-------SYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGV----QFRATNVH-FSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR----FTLTYRVRT------QPGQNNRVSIPFVPGGWQKPD--GRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1247

HSP 2 Score: 70.8626 bits (172), Expect = 9.4064e-12
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query: 2164 DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCS 2541
+EC N+ +C N CID K C+ +DC + DE+ + CR C N C NN CV C+G +C ++ DEL+C +CL + + C++G + + C+G +DC+ DE+ C
Sbjct: 490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EECR-CYANQFRC---NNGD----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCG 604

HSP 3 Score: 60.8474 bits (146), Expect = 9.46762e-09
Identity = 77/297 (25.93%), Postives = 121/297 (40.74%), Query Frame = 1
Query: 2770 GIYTCEGIE---KRRIMAPDFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--------ITNPDLVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKT-YSINTTNYEKFVTSDDLFLGGSFNMRGSWINR----YGYPLTYKIIISGESVGHIP-GPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWF-TDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKY-DYLWVPRLEKCNCPSGYSGLSCET 3603
GIY C G E KR ++ + C+ + A +Q+ C CYCS + C SA Y I N L+ T+E + + D+S+ Y+ T+Y L +++RGS + YG L+Y +I+ ES G+ G +V+ G K I + P N+ E N+R L E ++W D E +P R F+ +L D++ I R + + ++ A+ T+ +E C CPSGY G SCE+
Sbjct: 1715 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLI---------------TDESGAVQDTENLIPDISRNMYTYTHTSY----------LPKYWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIGNGLKLI------WSRPDGNENQ-EEYNVR--LHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1968

HSP 4 Score: 54.299 bits (129), Expect = 9.23217e-07
Identity = 60/262 (22.90%), Postives = 103/262 (39.31%), Query Frame = 1
Query: 2824 SVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--ITNPDLVESKVRSSDAAIMNY-QTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCE 3600
SV + CK F+ +++ C+ C+CS V DC S+ Y S+V + NY Q P M + + +S S + + + + FLG N S+ + Y L+Y + +G + +V+ G + + I Y K ++ +N Y + ++ W E R + L D+ I+ + Y + + +T+ A T +E+C CP GY GLSCE
Sbjct: 1369 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLG---NKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHY--RKSQVVPSVANTYS------VEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1617

HSP 5 Score: 51.2174 bits (121), Expect = 8.7374e-06
Identity = 39/152 (25.66%), Postives = 61/152 (40.13%), Query Frame = 1
Query: 2170 CALNQRKCQNETCIDEGKFCDGKNDCGDNSDE-DPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLG--------------------------SHYSCDNGTLIPRAYWCDGDSDCK-SMEDEEGCS 2541
C NQ +C N C+ C+G ++C D+SDE + +EC PN C+ +CV +C+G DC ++ DE +C ++ + G + + C+NG I C+G DC DE C
Sbjct: 529 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDEADCG 673
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389355|ref|NP_001245492.2| (terribly reduced optic lobes, isoform AL [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 5.25819e-44
Identity = 167/567 (29.45%), Postives = 242/567 (42.68%), Query Frame = 1
Query: 1987 GKVTWRRKDKKSFILNKENRLGGSTNSLLEIKEVTKADDGTI------YECNFNSLTEIVTLWVK----------DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCR---ECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHC-PDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKR--RIMAPDFSVTV--TKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSAN--GYITNPDLVESKVRSSD-AAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQS-DFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
KV W R + +R N LEI + D GT Y V L V+ C Q C N CID+ CDG DC D SDE + C +C PN C +NS +CV R W+CDG +DCG+N DE C P+ + C + + C +G IP+++ CD DC DE GC P I P S +S++E L L C +G P PTI WR NWG++PD + T TL ++ P+DSG Y+CE I R + PD VTV + VC+ +FN A E C++C+C V C SAN Y +P ++ +V S + + + NE +++ + V TN F + +L + G+ + YG L Y++ G S + GP V+I G F +++ R + +NN I + W + R + +L +V I R+ Y + + + I + A +EKC CP GY G SCE+
Sbjct: 644 AKVKWSRPGGRPLPPGFTDR-----NGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC---SNS----KCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESK-------SYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGV----QFRATNVH-FSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR----FTLTYRVRT------QPGQNNRVSIPFVPGGWQKPD--GRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1170

HSP 2 Score: 72.4034 bits (176), Expect = 3.11465e-12
Identity = 58/219 (26.48%), Postives = 93/219 (42.47%), Query Frame = 1
Query: 2164 DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCS-------PPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG--YLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGI 2793
+EC N+ +C N CID K C+ +DC + DE+ + CR C N C NN CV C+G +C ++ DEL+C +CL + + C++G + + C+G +DC+ DE+ C+ P Q+ + E+ + C+ G + W G P D N + N + ED+G Y CE +
Sbjct: 490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EECR-CYANQFRC---NNGD----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRV------------EDAGTYVCEAV 685

HSP 3 Score: 61.2326 bits (147), Expect = 8.47385e-09
Identity = 77/297 (25.93%), Postives = 121/297 (40.74%), Query Frame = 1
Query: 2770 GIYTCEGIE---KRRIMAPDFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--------ITNPDLVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKT-YSINTTNYEKFVTSDDLFLGGSFNMRGSWINR----YGYPLTYKIIISGESVGHIP-GPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWF-TDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKY-DYLWVPRLEKCNCPSGYSGLSCET 3603
GIY C G E KR ++ + C+ + A +Q+ C CYCS + C SA Y I N L+ T+E + + D+S+ Y+ T+Y L +++RGS + YG L+Y +I+ ES G+ G +V+ G K I + P N+ E N+R L E ++W D E +P R F+ +L D++ I R + + ++ A+ T+ +E C CPSGY G SCE+
Sbjct: 1638 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLI---------------TDESGAVQDTENLIPDISRNMYTYTHTSY----------LPKYWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIGNGLKLI------WSRPDGNENQ-EEYNVR--LHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1891

HSP 4 Score: 54.299 bits (129), Expect = 9.86318e-07
Identity = 60/262 (22.90%), Postives = 103/262 (39.31%), Query Frame = 1
Query: 2824 SVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--ITNPDLVESKVRSSDAAIMNY-QTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCE 3600
SV + CK F+ +++ C+ C+CS V DC S+ Y S+V + NY Q P M + + +S S + + + + FLG N S+ + Y L+Y + +G + +V+ G + + I Y K ++ +N Y + ++ W E R + L D+ I+ + Y + + +T+ A T +E+C CP GY GLSCE
Sbjct: 1292 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLG---NKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHY--RKSQVVPSVANTYS------VEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1540
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389375|ref|NP_001284823.1| (terribly reduced optic lobes, isoform AV [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 5.43517e-44
Identity = 167/567 (29.45%), Postives = 242/567 (42.68%), Query Frame = 1
Query: 1987 GKVTWRRKDKKSFILNKENRLGGSTNSLLEIKEVTKADDGTI------YECNFNSLTEIVTLWVK----------DECALNQRKCQNETCIDEGKFCDGKNDCGDNSDEDPKRCR---ECTPNSIHCDFLNNSSPIKRCVVRHWQCDGIDDCGNNFDELHC-PDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKSMEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWGYLPDTMDHNVTEVVXXXXXXXXXXXXXXXXPEDSGIYTCEGIEKR--RIMAPDFSVTV--TKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSAN--GYITNPDLVESKVRSSD-AAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQS-DFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCET 3603
KV W R + +R N LEI + D GT Y V L V+ C Q C N CID+ CDG DC D SDE + C +C PN C +NS +CV R W+CDG +DCG+N DE C P+ + C + + C +G IP+++ CD DC DE GC P I P S +S++E L L C +G P PTI WR NWG++PD + T TL ++ P+DSG Y+CE I R + PD VTV + VC+ +FN A E C++C+C V C SAN Y +P ++ +V S + + + NE +++ + V TN F + +L + G+ + YG L Y++ G S + GP V+I G F +++ R + +NN I + W + R + +L +V I R+ Y + + + I + A +EKC CP GY G SCE+
Sbjct: 827 AKVKWSRPGGRPLPPGFTDR-----NGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC---SNS----KCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESK-------SYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGV----QFRATNVH-FSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR----FTLTYRVRT------QPGQNNRVSIPFVPGGWQKPD--GRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1353

HSP 2 Score: 60.8474 bits (146), Expect = 1.02427e-08
Identity = 77/297 (25.93%), Postives = 121/297 (40.74%), Query Frame = 1
Query: 2770 GIYTCEGIE---KRRIMAPDFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--------ITNPDLVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKT-YSINTTNYEKFVTSDDLFLGGSFNMRGSWINR----YGYPLTYKIIISGESVGHIP-GPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWF-TDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKY-DYLWVPRLEKCNCPSGYSGLSCET 3603
GIY C G E KR ++ + C+ + A +Q+ C CYCS + C SA Y I N L+ T+E + + D+S+ Y+ T+Y L +++RGS + YG L+Y +I+ ES G+ G +V+ G K I + P N+ E N+R L E ++W D E +P R F+ +L D++ I R + + ++ A+ T+ +E C CPSGY G SCE+
Sbjct: 1821 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLI---------------TDESGAVQDTENLIPDISRNMYTYTHTSY----------LPKYWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIGNGLKLI------WSRPDGNENQ-EEYNVR--LHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 2074

HSP 3 Score: 53.9138 bits (128), Expect = 1.15198e-06
Identity = 60/262 (22.90%), Postives = 103/262 (39.31%), Query Frame = 1
Query: 2824 SVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGY--ITNPDLVESKVRSSDAAIMNY-QTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVTSDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNAKKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVFIELLRDVXXXXXXXXXXXXQSDFKMSMITMQEAIKTKYDYLWVPRLEKCNCPSGYSGLSCE 3600
SV + CK F+ +++ C+ C+CS V DC S+ Y S+V + NY Q P M + + +S S + + + + FLG N S+ + Y L+Y + +G + +V+ G + + I Y K ++ +N Y + ++ W E R + L D+ I+ + Y + + +T+ A T +E+C CP GY GLSCE
Sbjct: 1475 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLG---NKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHY--RKSQVVPSVANTYS------VEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1723
The following BLAST results are available for this feature:
BLAST of laminin vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767903961|ref|XP_011539621.1|4.474700e-3826.56PREDICTED: basement membrane-specific heparan sulf... [more]
gi|578798997|ref|XP_006710658.1|5.924380e-3826.56PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903954|ref|XP_011539619.1|5.928370e-3826.56PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903963|ref|XP_011539622.1|6.483290e-3826.56PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903957|ref|XP_011539620.1|6.561430e-3826.56PREDICTED: basement membrane-specific heparan sulf... [more]
back to top
BLAST of laminin vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150033250.000000e+053.93SmedAsxldir_c101543_g1_i1|m.51138|m.8906[more]
SMU150035841.520970e-7531.22SmedAsxldir_c102345_g1_i1|m.54199|m.2277[more]
SMU150017302.577950e-7531.86Asxlregen_comp65513_c0_seq1|m.19286|m.12982[more]
SMU150016431.096430e-7431.89Asxlregen_comp65113_c0_seq2|m.18193|m.7115[more]
SMU150351231.255130e-7030.33SmedSxlregen_c88126_g1_i1|m.36302|m.5005[more]
back to top
BLAST of laminin vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|317373536|sp|P98160|PGBM_HUMAN4.345880e-3726.81RecName: Full=Basement membrane-specific heparan s... [more]
gi|1172451|sp|Q05793|PGBM_MOUSE3.704740e-3627.05RecName: Full=Basement membrane-specific heparan s... [more]
gi|30179887|sp|Q06561|UNC52_CAEEL4.136660e-2828.49RecName: Full=Basement membrane proteoglycan; AltN... [more]
gi|160409939|sp|A2ARV4|LRP2_MOUSE2.565030e-1738.93RecName: Full=Low-density lipoprotein receptor-rel... [more]
gi|1708867|sp|P98158|LRP2_RAT1.778300e-1537.21RecName: Full=Low-density lipoprotein receptor-rel... [more]
back to top
BLAST of laminin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|665389351|ref|NP_001245496.2|4.121120e-4430.50terribly reduced optic lobes, isoform AI [Drosophi... [more]
gi|665389377|ref|NP_001027033.3|5.131790e-4429.45terribly reduced optic lobes, isoform AW [Drosophi... [more]
gi|665389369|ref|NP_001284822.1|5.197090e-4429.45terribly reduced optic lobes, isoform AS [Drosophi... [more]
gi|665389355|ref|NP_001245492.2|5.258190e-4429.45terribly reduced optic lobes, isoform AL [Drosophi... [more]
gi|665389375|ref|NP_001284823.1|5.435170e-4429.45terribly reduced optic lobes, isoform AV [Drosophi... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_008586 ID=Pgr_008586|Name=laminin|organism=Phagocata gracilis|type=mRNA|length=3716bp
CACGCTTCGATAAGTTCCAGTGTGCTAGCAATCAGCTTCATTTCTAGAAA
TACGATATAAATAAAATCATTTGATTTCTCTCAATTGGTTTAGTTCAGTA
AATTGTATTTATTGATTATGATATCCATTGCTAAGAGTTTATTCATTGTC
AAACTCGTTGTACTGGGGTTTTTGGTCGATGAAAACACAGCTGTATTTAA
TTTAACCCGCAATGTGTCCATCCAAGTCGAACCGCTGAAGTATGGGGAAG
TTAATATCTACTTCGTGTGCCCCAATATCAGGTCAAATGAGGATAAGGTC
ATGTATTATAAAGTGGAGAAAGGAATCAAAGGGCTAATACAGAAACGGAA
GCCTCATGGTATTATTTTAAAAATTAAAACAAAGTCCGACCTTGGAGAAT
ATCAGTGTTCAATTATTTCTAAAGATTCATCGACGAGAAACGCTACTCTA
AATATTATCGACAGCAAAGAAATGGAAAGTCCTGTTAAGTTTGTCTACGA
TTATTCAAAGACTAAATACGTCATAGAAAAATCTGGATCCGTTGAATTGG
ATTCAGAGGCTTCAACCAATGACATGGTGACTTGGTACCGGCCACCACAA
TTCCATATATTCACTGGCAGAAAGCTTAAAATTGACAATTTGAATGAATT
TGATTTCGGGACCTATTACTTTGCTATTGGTATGACCTCCAAATCAGTGT
TACAAGTGACAAAAGTAATATTACTTCCTCAAAGACCAACAAAGCGAGAA
AAAACTATCGACGAAGATGTCATGTATCTCGAAAATATAATTCCAAAGGC
CAAAGAGATACGCTACCGACCAGGAAATGTTGCCGGAATTTCTGAGACCG
TAACCTGGGAACAACCACCAGGAACCATTCTTCTAGAACACGGACGAGAT
GCTTATTTCTATTCGTACACCGCCAGTAAATCAGACTTACCTCTTTATTA
TAGAATCAATAAGAACGGAGATTTTACCGTGAACAAAGTCGGTAAAGTGT
TCATTTCTGAGTGGAAAAACAGAGAGGTGGAGATGTCAGTGGAGGGCCGA
GCGGCATACGGAGCTGAGATGAAAGTAAACTGTATTCCATCACCGGACTT
GGGGAATAAAACCGAGGTTATCTGGAGATTAGATGACAAAATAATTCATC
GCGGTAACACATATTTCATCAAAAACTTTCAAAAAGAAGTCTACGGAAAG
TATAGTTGTGAAATCCATCGCAACGGTGTGATGATTCAGTCTCGTATTAT
CAATCTGACACCGAAGGCGGGCACAGAATCTAAAATAGAGATGACTCCGG
ATCCCGGACTTTATTACAATTTTCATCCCGAGAAAACAAAAGAATTACAT
TGTGAGATTGTCAGAGAAGACGGAGAATGGAAATTCAGATCAAAGGATAT
TATCTGGACATTCAATGGAAGAAAGATTGACGTGGAAAATCCATTGTCTG
CTTTTGGTAATATCAATCGATTTGGACGCCTAGACACGAGATCGGTGAGT
ATTTTGGTCCTTAAAGACATGGGCGAAGACAACCAAGGTGTATACAAATG
TTTCCAAGGCCCCCTGACATTTGCGTCGATTCTTATAATGGAACAAAGTG
AGGTTATCATAGAATTGTCTCCTCCTCGTCTAACGGTGTTGCACAATGCC
AATCACGTGGCAGAGTTCCATTGTAGAATAGACACCCCTGGATACAACTC
GAGTTTCATTGAATGGAAGTTTATGAAATTCAATTCCACCATAGAATACG
ATCTACCACCAGAGTCTATTGTCGAGAAGCCTCATCAAACGTCGGCGACG
TCGTTTGTGACTATTAAAAATTCTTTAAAGAAACACGAGGGTTTTTATGT
TTGTAAAGTGTTAGGTCGGCAAGTCACTGGAATATTGATTGTGAAGACAA
AACAAATGCTGACAGTAAATCCGAAAGAAATCACTGTTTCGCCCGGTGGA
ACTGCGAGATTCCTTTGCCAATTGACTGCTATGAATGGAAAAGTAACATG
GCGACGAAAAGACAAAAAGAGTTTTATACTGAATAAAGAAAACAGACTCG
GAGGGAGTACAAATTCCTTATTGGAAATCAAAGAAGTTACCAAAGCCGAT
GATGGAACCATTTATGAATGCAATTTCAATTCATTGACTGAAATTGTCAC
ATTATGGGTCAAAGACGAATGTGCTTTGAATCAAAGAAAATGCCAAAACG
AGACTTGCATAGACGAAGGAAAGTTCTGTGACGGTAAAAATGACTGTGGG
GACAACTCGGATGAAGATCCGAAGCGATGTAGAGAATGCACACCAAACTC
AATACATTGTGATTTCCTGAACAATTCTTCGCCTATTAAACGGTGTGTAG
TGAGACATTGGCAATGCGATGGCATAGATGACTGTGGAAACAATTTCGAT
GAACTCCATTGTCCAGACAAGAACAAAGACAAGTGCCTAGGCTCACACTA
CTCGTGCGACAATGGAACCCTGATCCCTAGAGCGTACTGGTGTGACGGGG
ATTCCGATTGCAAGTCCATGGAAGACGAAGAAGGATGCAGTCCTCCACAG
GTGATAGAGCCGGCCAAGTTAAGTCACTTGTCGGTAATCGAAAACAGCAC
CTTGACCCTTGTGTGCCAAATTTCTGGACGACCTATGCCCACCATCACTT
GGCGATACAATTGGGGCTATCTGCCTGACACTATGGATCACAACGTCACG
GAGGTCGTCACTAACTGTACTCTCATTACGAGCACGCTAACCATTACGAA
CATTTCGCCCGAGGACAGCGGGATTTACACTTGCGAGGGTATTGAGAAAC
GACGTATAATGGCTCCAGATTTCTCGGTAACCGTTACGAAGGGGTCTGTT
TGCAAAAGACCATACTTTAACAATGACGCGTGGGACCAGGAATTCTGTCT
GAGATGTTATTGCTCAAATGTAACTGACGATTGCACTAGTGCCAATGGAT
ATATTACTAATCCTGATCTAGTTGAGAGTAAAGTCAGGTCTTCAGACGCT
GCCATAATGAATTACCAAACAAACGAATACTTCGAACCCGCTAGAATGGT
CAGTTTTGTCGACGATGTATCCAAAACCTATTCAATCAATACAACCAATT
ATGAGAAATTTGTAACTTCCGACGATTTATTTCTAGGAGGAAGTTTCAAT
ATGCGAGGATCATGGATTAATCGATATGGATATCCACTCACCTATAAAAT
TATAATATCTGGAGAGAGTGTTGGTCATATTCCAGGTCCAATAGTTGTAA
TTGAGGGATACAATGCGAAGAAAATATTTTACTGCAGCTTCAAGTATCGT
ATTCCAGCGTACGCATCCAATGAATATCATGAGAACAATATTCGTATTAT
TCTCTGGGAGCAAGACCGCTGGTTTACCGACCATGAATGCACCAAACCCG
TACCGAGACCTGTCTTTATCGAACTGCTACGAGATGTACGATTTATTTTC
TTTCGGATCAAATATTTCCGGAAGCAAAGTGATTTCAAAATGTCGATGAT
AACGATGCAAGAAGCAATAAAGACAAAATACGACTACTTGTGGGTGCCAA
GATTGGAGAAATGCAACTGTCCTAGTGGCTATTCTGGCCTATCTTGCGAG
ACAAAAACTGAGTAGAATATCAATCTCAATGATCAAGATCAAATTAGTAT
TAGACATTTATATGACAATTACTCAATATCGACTGGCTTTAATATTATAT
ATTCTATTGTTTAGAA

Design Primers for laminin

back to top

protein sequence

>Pgr_008586-protein ID=Pgr_008586-protein|Name=laminin|organism=Phagocata gracilis|type=polypeptide|length=1166bp
MISIAKSLFIVKLVVLGFLVDENTAVFNLTRNVSIQVEPLKYGEVNIYFV
CPNIRSNEDKVMYYKVEKGIKGLIQKRKPHGIILKIKTKSDLGEYQCSII
SKDSSTRNATLNIIDSKEMESPVKFVYDYSKTKYVIEKSGSVELDSEAST
NDMVTWYRPPQFHIFTGRKLKIDNLNEFDFGTYYFAIGMTSKSVLQVTKV
ILLPQRPTKREKTIDEDVMYLENIIPKAKEIRYRPGNVAGISETVTWEQP
PGTILLEHGRDAYFYSYTASKSDLPLYYRINKNGDFTVNKVGKVFISEWK
NREVEMSVEGRAAYGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYF
IKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYY
NFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNIN
RFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIEL
SPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPES
IVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTGILIVKTKQMLTV
NPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNS
LLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDE
GKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQC
DGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKS
MEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG
YLPDTMDHNVTEVVTNCTLITSTLTITNISPEDSGIYTCEGIEKRRIMAP
DFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPD
LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVT
SDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNA
KKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVF
IELLRDVRFIFFRIKYFRKQSDFKMSMITMQEAIKTKYDYLWVPRLEKCN
CPSGYSGLSCETKTE*
back to top

coding sequence

>Pgr_008586.118.3615 ID=Pgr_008586.118.3615|Name=Pgr_008586.118.3615|organism=Phagocata gracilis|type=CDS|length=3498bp
ATGATATCCATTGCTAAGAGTTTATTCATTGTCAAACTCGTTGTACTGGG
GTTTTTGGTCGATGAAAACACAGCTGTATTTAATTTAACCCGCAATGTGT
CCATCCAAGTCGAACCGCTGAAGTATGGGGAAGTTAATATCTACTTCGTG
TGCCCCAATATCAGGTCAAATGAGGATAAGGTCATGTATTATAAAGTGGA
GAAAGGAATCAAAGGGCTAATACAGAAACGGAAGCCTCATGGTATTATTT
TAAAAATTAAAACAAAGTCCGACCTTGGAGAATATCAGTGTTCAATTATT
TCTAAAGATTCATCGACGAGAAACGCTACTCTAAATATTATCGACAGCAA
AGAAATGGAAAGTCCTGTTAAGTTTGTCTACGATTATTCAAAGACTAAAT
ACGTCATAGAAAAATCTGGATCCGTTGAATTGGATTCAGAGGCTTCAACC
AATGACATGGTGACTTGGTACCGGCCACCACAATTCCATATATTCACTGG
CAGAAAGCTTAAAATTGACAATTTGAATGAATTTGATTTCGGGACCTATT
ACTTTGCTATTGGTATGACCTCCAAATCAGTGTTACAAGTGACAAAAGTA
ATATTACTTCCTCAAAGACCAACAAAGCGAGAAAAAACTATCGACGAAGA
TGTCATGTATCTCGAAAATATAATTCCAAAGGCCAAAGAGATACGCTACC
GACCAGGAAATGTTGCCGGAATTTCTGAGACCGTAACCTGGGAACAACCA
CCAGGAACCATTCTTCTAGAACACGGACGAGATGCTTATTTCTATTCGTA
CACCGCCAGTAAATCAGACTTACCTCTTTATTATAGAATCAATAAGAACG
GAGATTTTACCGTGAACAAAGTCGGTAAAGTGTTCATTTCTGAGTGGAAA
AACAGAGAGGTGGAGATGTCAGTGGAGGGCCGAGCGGCATACGGAGCTGA
GATGAAAGTAAACTGTATTCCATCACCGGACTTGGGGAATAAAACCGAGG
TTATCTGGAGATTAGATGACAAAATAATTCATCGCGGTAACACATATTTC
ATCAAAAACTTTCAAAAAGAAGTCTACGGAAAGTATAGTTGTGAAATCCA
TCGCAACGGTGTGATGATTCAGTCTCGTATTATCAATCTGACACCGAAGG
CGGGCACAGAATCTAAAATAGAGATGACTCCGGATCCCGGACTTTATTAC
AATTTTCATCCCGAGAAAACAAAAGAATTACATTGTGAGATTGTCAGAGA
AGACGGAGAATGGAAATTCAGATCAAAGGATATTATCTGGACATTCAATG
GAAGAAAGATTGACGTGGAAAATCCATTGTCTGCTTTTGGTAATATCAAT
CGATTTGGACGCCTAGACACGAGATCGGTGAGTATTTTGGTCCTTAAAGA
CATGGGCGAAGACAACCAAGGTGTATACAAATGTTTCCAAGGCCCCCTGA
CATTTGCGTCGATTCTTATAATGGAACAAAGTGAGGTTATCATAGAATTG
TCTCCTCCTCGTCTAACGGTGTTGCACAATGCCAATCACGTGGCAGAGTT
CCATTGTAGAATAGACACCCCTGGATACAACTCGAGTTTCATTGAATGGA
AGTTTATGAAATTCAATTCCACCATAGAATACGATCTACCACCAGAGTCT
ATTGTCGAGAAGCCTCATCAAACGTCGGCGACGTCGTTTGTGACTATTAA
AAATTCTTTAAAGAAACACGAGGGTTTTTATGTTTGTAAAGTGTTAGGTC
GGCAAGTCACTGGAATATTGATTGTGAAGACAAAACAAATGCTGACAGTA
AATCCGAAAGAAATCACTGTTTCGCCCGGTGGAACTGCGAGATTCCTTTG
CCAATTGACTGCTATGAATGGAAAAGTAACATGGCGACGAAAAGACAAAA
AGAGTTTTATACTGAATAAAGAAAACAGACTCGGAGGGAGTACAAATTCC
TTATTGGAAATCAAAGAAGTTACCAAAGCCGATGATGGAACCATTTATGA
ATGCAATTTCAATTCATTGACTGAAATTGTCACATTATGGGTCAAAGACG
AATGTGCTTTGAATCAAAGAAAATGCCAAAACGAGACTTGCATAGACGAA
GGAAAGTTCTGTGACGGTAAAAATGACTGTGGGGACAACTCGGATGAAGA
TCCGAAGCGATGTAGAGAATGCACACCAAACTCAATACATTGTGATTTCC
TGAACAATTCTTCGCCTATTAAACGGTGTGTAGTGAGACATTGGCAATGC
GATGGCATAGATGACTGTGGAAACAATTTCGATGAACTCCATTGTCCAGA
CAAGAACAAAGACAAGTGCCTAGGCTCACACTACTCGTGCGACAATGGAA
CCCTGATCCCTAGAGCGTACTGGTGTGACGGGGATTCCGATTGCAAGTCC
ATGGAAGACGAAGAAGGATGCAGTCCTCCACAGGTGATAGAGCCGGCCAA
GTTAAGTCACTTGTCGGTAATCGAAAACAGCACCTTGACCCTTGTGTGCC
AAATTTCTGGACGACCTATGCCCACCATCACTTGGCGATACAATTGGGGC
TATCTGCCTGACACTATGGATCACAACGTCACGGAGGTCGTCACTAACTG
TACTCTCATTACGAGCACGCTAACCATTACGAACATTTCGCCCGAGGACA
GCGGGATTTACACTTGCGAGGGTATTGAGAAACGACGTATAATGGCTCCA
GATTTCTCGGTAACCGTTACGAAGGGGTCTGTTTGCAAAAGACCATACTT
TAACAATGACGCGTGGGACCAGGAATTCTGTCTGAGATGTTATTGCTCAA
ATGTAACTGACGATTGCACTAGTGCCAATGGATATATTACTAATCCTGAT
CTAGTTGAGAGTAAAGTCAGGTCTTCAGACGCTGCCATAATGAATTACCA
AACAAACGAATACTTCGAACCCGCTAGAATGGTCAGTTTTGTCGACGATG
TATCCAAAACCTATTCAATCAATACAACCAATTATGAGAAATTTGTAACT
TCCGACGATTTATTTCTAGGAGGAAGTTTCAATATGCGAGGATCATGGAT
TAATCGATATGGATATCCACTCACCTATAAAATTATAATATCTGGAGAGA
GTGTTGGTCATATTCCAGGTCCAATAGTTGTAATTGAGGGATACAATGCG
AAGAAAATATTTTACTGCAGCTTCAAGTATCGTATTCCAGCGTACGCATC
CAATGAATATCATGAGAACAATATTCGTATTATTCTCTGGGAGCAAGACC
GCTGGTTTACCGACCATGAATGCACCAAACCCGTACCGAGACCTGTCTTT
ATCGAACTGCTACGAGATGTACGATTTATTTTCTTTCGGATCAAATATTT
CCGGAAGCAAAGTGATTTCAAAATGTCGATGATAACGATGCAAGAAGCAA
TAAAGACAAAATACGACTACTTGTGGGTGCCAAGATTGGAGAAATGCAAC
TGTCCTAGTGGCTATTCTGGCCTATCTTGCGAGACAAAAACTGAGTAG
back to top
Gene Groups
laminin is similar in sequence to the genes of this group: GG2514
Gene NameGene ID
SMU15003325SMU15003325
lamininDdo_003647
lamininGsp_020815
Pgr_001754Pgr_001754
lamininPgr_008586
Pmo_019678Pmo_019678
lamininPmo_031777

Gene Group Protein Sequences

>SMU15003325

MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIR
PDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDK
TIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESV
NWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVK
NMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTI
LLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAM
DVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFK
KDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSG
VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNS
VSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELAD
NVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAAS
STSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKP
GGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATK
DDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKND
CGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNN
FDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN
PQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYN
ITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKG
QICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPS
DAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGA
FNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKY
RLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLV
LFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSC
ENKVE*
>Ddo_003647 laminin
MFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTY
KCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANI
NSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGT
YVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKV
IWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQ
VTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSP
NAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGT
HFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG
STLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTV
HNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSM
CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAR
EVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSY
QLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKI
RVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMS
KISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIKSNER*
>Gsp_020815 laminin
MTTFNNIPLLIFIFTKILQSEGFQPTRNVSVDVDDLKIRNMNLYFVCPYV
RSKTNVIKYFKYVENTSIVLKEKQNAHGIIITLKDASDMGKYGCSVILEN
GMIKNATFNIIDKQLMENPKLFIYKTEETIYVTQKGNVAELSCGNLMNPS
TTWYRPPQYHIYSGSKYIIKDVDRYSYGTYYCTSETTNTNTVSVRKVILV
KEIPKIKEKSIEEEVNYVETLSVQPGTVRYRSSNIAKSNDMIIWENPPGT
ILLDHERDLYIQSIKDDENIFYYRINRYGDSSINNVGKLIISIKKQDKLM
NLQSPVIYGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNK
KTFGKYSCEVLQGNEKQKTRFLNLLPEQKIESKIEMTPEPGNFYLYHSGA
KKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSV
SILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADN
VNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSS
TSFIVINNVLKRHEGTYVCQVLNTKVFGKIIVRTKPVLTVTPKSITIKPG
STARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRD
DHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDC
GDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNF
DELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP
QVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNI
TTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVMAPDFSVSVSKGL
ICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSD
AAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAF
NMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYR
LPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLAL
FKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCE
TKID*
>Pgr_001754 Pgr_001754
MESPTKFTYDLSQTKYVIQNSGSVELDCGAPANEIVTWFRPPQFHIYTGS
KLKIETLTKFDYGTYYCAIGSTAKSTVPVTKVILLPEEPKQKEKKLDEDF
LFMESLVPKSSEVRFKPSDVAGKFDTVTWEQPPGTILLEHGRNLYFQSYS
PETSKTPFYYRIHRNGDHLINKVGKLFIAHWQDKEEQMTVEGAVQYGNDM
TINCFSDPESINETHVVWRLDDKIIHRGNTYTIKNFQKKYFGKYSCEIEK
GGVRIVSRSINLAPEQDLAAKIEMTPDPGNYYNFHSGKNKELHCEIQRED
GNWKFKSKDIIWTLNGRKIDIGNPGSPFANTKRFGRLNTQSVSILVLKEL
GEDNKGTYKCFQGSTVYAATLLMEPSEILIELSPPEQTAADNVNQMAEFH
CRIDTPNYNSSFIRWSFIPEGSDQEEKVPTEAVIDNPIQTSSTSFVSIEN
VLKRHEGQYVCRVLDRKVVGKLIVKSRPVLKVNPKEITVKPGGTARYLCQ
LTGIEGKVIWRRRDKKSFIENKETRMGGDTNSLLEIKQTTTADDGTVYEC
NFNKLTEYVTLWVKDDCALNQRKCQNSTCIDENKFCDGKNDCGDNSDEDP
KRCNECTPNSIHCDFLNNSIPNKRCVVKHWQCDGVDDCGNNFDELNCPVK
NTEKCLGSHYQCGNETLIPRAYWCDGEVDCKSGEDEEGCTSPQVIEPAKP
SQLTVVENSTMIIECQISGRPVPTVTWRYNWGYLPDKLEHNITDVVTNCS
MVTSTLRINNISPEQSGIYTCEGIAKRRVMAPDISVTVTKETVCKRPFFN
NDAWTQELCLRCYCSNVTDDCTSASGYVINPDLIESQARSSDAAVINYKT
NEYYEPARPVGFANDTLKMYIINKENYKKLIPDDDHFLGGSFNMRGSWIN
RYGFPLTYKLTLAGESVGHISGPIVVMVGHSEKKIFYCTPKYRLPAYASD
DNTENNMRIILWEQDRWFVDDKCSKSVTRSEFIEVLRDVRLVLFRVRYFT
KQTDFKMSKITMQEAIKSKYEHSWIPRIEKCNCPQGYSGLSCENKST*
>Pgr_008586 laminin
MISIAKSLFIVKLVVLGFLVDENTAVFNLTRNVSIQVEPLKYGEVNIYFV
CPNIRSNEDKVMYYKVEKGIKGLIQKRKPHGIILKIKTKSDLGEYQCSII
SKDSSTRNATLNIIDSKEMESPVKFVYDYSKTKYVIEKSGSVELDSEAST
NDMVTWYRPPQFHIFTGRKLKIDNLNEFDFGTYYFAIGMTSKSVLQVTKV
ILLPQRPTKREKTIDEDVMYLENIIPKAKEIRYRPGNVAGISETVTWEQP
PGTILLEHGRDAYFYSYTASKSDLPLYYRINKNGDFTVNKVGKVFISEWK
NREVEMSVEGRAAYGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYF
IKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYY
NFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNIN
RFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIEL
SPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPES
IVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTGILIVKTKQMLTV
NPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNS
LLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDE
GKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQC
DGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKS
MEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG
YLPDTMDHNVTEVVTNCTLITSTLTITNISPEDSGIYTCEGIEKRRIMAP
DFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPD
LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVT
SDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNA
KKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVF
IELLRDVRFIFFRIKYFRKQSDFKMSMITMQEAIKTKYDYLWVPRLEKCN
CPSGYSGLSCETKTE*
>Pmo_019678 Pmo_019678
GVFNNEVVTWYRPPQFHIFTGNKLEIKQLTEFDFGTYYFSVGMTTKSVLL
VTKVILLPSEPEKREKTIDEDVLYLENVIPKAKDIRYRPGNVDGNSDIVT
WEQPPGTILLEHGRDAYFSAYSINQTELPFYYRINRNGDSSVNKVGKVFI
SEWKDREVEMSVEGRAAYGAEMKVNCFPSPDLGNDTEVIWKLDGKEIHRG
NTYIIKTFQKEVYGRYSCEIHSRGILIKSRIINLTPREGIESKIEMTLDP
GLYYNFHPDKTKELHCEIQREDGEWKFKSKDIIWTFNGRKIDVYNPLSAF
GNINRFGRLDTRSVSILVLRNMGEDNQGVYKCFQGPSTYAAILIMEQSEV
LIELSPPKLIVQHNSNHVAEFHCRIDTPGYNSSFIEWKFKEFNSTIEQDI
PPEATVEKPHQTSATSFITIKNSLKKHEGIYVCKVLGQQVSGILIVKTKQ
VLTVNPKEITVSPGGTARFFCQLSGIDGKVVWRRKDRKNFILNKENRKGG
STNSLLEVNHVTTADDGTIYECNFNELTESAILWVKDECALNQRKCKNET
CIDETKFCDGKDDCGDNSDEDPTRCKECIPNSIHCDFLNNSSPIKRCIVR
HWQCDGVDDCGNNFDELNCPVMNKDRCIGSHYLCGNGTLIPRAYWCDGEP
DCRSMEDEEGCSSSQVIEPSKLSHLSIIENSTLTLICQISGRPIPTITWR
YNWGYLPDSLNHNLTEVVTNCSMITSTLTINNIAPENSGIYTCEGIEKRR
IMAPDYAVTVTKGSVCKRPFFNNDAWDQEFCLRCYCSNVTDDCTSASGYI
TNPDLVESKVRSSDAAIMNYKTNDYHEPARSISFVDDNLKMYSINKTNYM
KYVIEDDFFLGGSFNMRGSWINRYGYPLTYKIVISGDSVGHISGPIVVIM
SNNEKKIYYCSWKYRISAYASDEYYENNIRIILWEQDRWFTDNACTTKVQ
RAEFLEILK
>Pmo_031777 laminin
MHIFIPLLVMVGYFTKSYESVFPHTRTVSIDLEKLKKEPFNIYFTCANIR
SKQDRVRYFRVQNGARGLIEKKKRFGIILSIKSESDLGQYECSVTAPDKT
VLNATLNTVDMKKMESPTKFVYDLSKTKYVIQKSGSVELDCGTSGNEVVT
WYKPTQYHIFTGSKLKIDSLTNFDYGTYYCAVGDTNKATLMVTKVILLPE
EPKQKEKKIDEDVMYIESFIPKSKSVRFKPIDVVDKSFAVTWEQPPGTVL
LEHARKLYFQSFSPDQTKIPFFYRITKNGDPSVNKVGKVYISDWTDKEVE
VTLEGAVQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQ
KQFFGKYSCEIQQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMG
KNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRL
DTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQ
TAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKP
VLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGKLIVKSRPVLTVNPKEI
TVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIK
QATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCN
GVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDD
CGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE
GCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDK
LDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVT
VTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESK
VKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHF
LGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYY
CTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEVLR
DVRLVLFRVKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGY
SGLSCEMKEN*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.