pc2, Pgr_003685 (mRNA) Phagocata gracilis

Overview
Namepc2
Unique NamePgr_003685
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length4418
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of pc2 vs. RefSeq Human
Match: gi|320118926|ref|NP_001188457.1| (neuroendocrine convertase 2 isoform 3 [Homo sapiens])

HSP 1 Score: 704.901 bits (1818), Expect = 0
Identity = 364/599 (60.77%), Postives = 434/599 (72.45%), Query Frame = 1
Query: 2338 IHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 4134
+ TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 10 VFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 580

HSP 2 Score: 704.901 bits (1818), Expect = 0
Identity = 364/599 (60.77%), Postives = 434/599 (72.45%), Query Frame = -1
Query:  285 IHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 2081
+ TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 10 VFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 580
BLAST of pc2 vs. RefSeq Human
Match: gi|20336244|ref|NP_002585.2| (neuroendocrine convertase 2 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 704.516 bits (1817), Expect = 0
Identity = 366/612 (59.80%), Postives = 441/612 (72.06%), Query Frame = 1
Query: 2299 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 4134
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 599

HSP 2 Score: 704.516 bits (1817), Expect = 0
Identity = 366/612 (59.80%), Postives = 441/612 (72.06%), Query Frame = -1
Query:  285 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 2120
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. RefSeq Human
Match: gi|320118928|ref|NP_001188458.1| (neuroendocrine convertase 2 isoform 2 preproprotein [Homo sapiens])

HSP 1 Score: 682.559 bits (1760), Expect = 0
Identity = 359/612 (58.66%), Postives = 430/612 (70.26%), Query Frame = 1
Query: 2299 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 4134
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 564

HSP 2 Score: 682.559 bits (1760), Expect = 0
Identity = 359/612 (58.66%), Postives = 430/612 (70.26%), Query Frame = -1
Query:  285 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 2120
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 564
BLAST of pc2 vs. RefSeq Human
Match: gi|20336242|ref|NP_000430.3| (neuroendocrine convertase 1 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 422.55 bits (1085), Expect = 2.02682e-128
Identity = 257/633 (40.60%), Postives = 368/633 (58.14%), Query Frame = 1
Query: 2251 RRRNLLENMKFYLTIWICLI--AASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVA--KQWVNVPERFHCIAGTID-KRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPP 4131
RR L+ F L C + A +KR + N+W + G A +A E G+ LL N ++F HK P S ++ L V A Q R KR +++ + L DP++ ++WY+++T + LDL+V+ W +GITGKGV ++DDG+++ H D+ NY+ E+SYDF+ ND PFPRY N HGTRCAGEI+ + +N CGVG+AY+SKV G+RMLD +TD IE++++ + + IYSASWGP DDG+TV+GP KA GV +GR GKG+I+VWASG+GG D+C+CDGY S++TISI+SA+ G + Y E CSSTLA+++S+G D + + DL+ CT H+GTSA+AP AA +FALALEAN N+ WRDMQHL V TS+ + L + W NGAGL N FG+G+L+A +V +A + W +VPE+ C+ D + + +++EI T AC+ E + + LEHVQ T++ SRRGD+ + LTS GT++++L+ RE+D P+ GF W FM+ HTWGENP G W L + + ++G W L+LHGT + P
Sbjct: 3 RRAWSLQCTAFVLFCAWCALNSAKAKRQF----VNEWAAEI-PGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRS-----------------------ALRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNP---GWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQE-NAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPN-GFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 598

HSP 2 Score: 422.55 bits (1085), Expect = 2.02682e-128
Identity = 257/633 (40.60%), Postives = 368/633 (58.14%), Query Frame = -1
Query:  288 RRRNLLENMKFYLTIWICLI--AASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVA--KQWVNVPERFHCIAGTID-KRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPP 2168
RR L+ F L C + A +KR + N+W + G A +A E G+ LL N ++F HK P S ++ L V A Q R KR +++ + L DP++ ++WY+++T + LDL+V+ W +GITGKGV ++DDG+++ H D+ NY+ E+SYDF+ ND PFPRY N HGTRCAGEI+ + +N CGVG+AY+SKV G+RMLD +TD IE++++ + + IYSASWGP DDG+TV+GP KA GV +GR GKG+I+VWASG+GG D+C+CDGY S++TISI+SA+ G + Y E CSSTLA+++S+G D + + DL+ CT H+GTSA+AP AA +FALALEAN N+ WRDMQHL V TS+ + L + W NGAGL N FG+G+L+A +V +A + W +VPE+ C+ D + + +++EI T AC+ E + + LEHVQ T++ SRRGD+ + LTS GT++++L+ RE+D P+ GF W FM+ HTWGENP G W L + + ++G W L+LHGT + P
Sbjct: 3 RRAWSLQCTAFVLFCAWCALNSAKAKRQF----VNEWAAEI-PGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRS-----------------------ALRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNP---GWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQE-NAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPN-GFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 598
BLAST of pc2 vs. RefSeq Human
Match: gi|4505579|ref|NP_002560.1| (furin preproprotein [Homo sapiens])

HSP 1 Score: 422.55 bits (1085), Expect = 5.38493e-128
Identity = 263/632 (41.61%), Postives = 369/632 (58.39%), Query Frame = 1
Query: 2299 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVA-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGT--QTPPYDKLSASLETIIPKLAAV 4185
+ L+AA + + TN W V + G +A VA + GF L F + + F H+ + + S P H L P V+ +L ++ + KRD V E PTDP F ++WY+ GV DLNV +AWAQG TG G+ +I+DDGI+ HPDL+ NY+ +S+D + DP P PRYT N HGTRCAGE++A +NGVCGVG+AY++++ G+RMLD +TD +E+ ++ + + IHIYSASWGP DDG+TVDGP +A GV++GR G G+I+VWASG+GG D CNCDGY S++T+SI+SAT G Y E+CSSTLA+T+S+G + + T DL +CT H+GTSA+AP AA + AL LEAN N+ WRDMQHL V TSK HL+ D W NG G + +H +GYG+LDAG MV +A+ W V + CI + + ++ K L + AC L E + + LEH QA +T+ +RRGD+ + L SPMGT S +L+ R D + GF W FMTTH+W E+P G+W L + +T +A + G +++ LVL+GT + P S+ +T+ A V
Sbjct: 17 LVLLAADAQG-QKVFTNTWAVRI-PGGPAVANSVARKHGFLNLGQIFG--DYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQ-------WLEQQVAKRRTKRD-----------------VYQE----PTDPKFPQQWYL------SGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNAND----WATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPK--DIGKRLEVRKTVTAC-LGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYS-ADGFNDWAFMTTHSWDEDPSGEWVLEIE-NTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACV 597

HSP 2 Score: 422.55 bits (1085), Expect = 5.38493e-128
Identity = 263/632 (41.61%), Postives = 369/632 (58.39%), Query Frame = -1
Query:  234 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVA-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGT--QTPPYDKLSASLETIIPKLAAV 2120
+ L+AA + + TN W V + G +A VA + GF L F + + F H+ + + S P H L P V+ +L ++ + KRD V E PTDP F ++WY+ GV DLNV +AWAQG TG G+ +I+DDGI+ HPDL+ NY+ +S+D + DP P PRYT N HGTRCAGE++A +NGVCGVG+AY++++ G+RMLD +TD +E+ ++ + + IHIYSASWGP DDG+TVDGP +A GV++GR G G+I+VWASG+GG D CNCDGY S++T+SI+SAT G Y E+CSSTLA+T+S+G + + T DL +CT H+GTSA+AP AA + AL LEAN N+ WRDMQHL V TSK HL+ D W NG G + +H +GYG+LDAG MV +A+ W V + CI + + ++ K L + AC L E + + LEH QA +T+ +RRGD+ + L SPMGT S +L+ R D + GF W FMTTH+W E+P G+W L + +T +A + G +++ LVL+GT + P S+ +T+ A V
Sbjct: 17 LVLLAADAQG-QKVFTNTWAVRI-PGGPAVANSVARKHGFLNLGQIFG--DYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQ-------WLEQQVAKRRTKRD-----------------VYQE----PTDPKFPQQWYL------SGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNAND----WATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPK--DIGKRLEVRKTVTAC-LGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYS-ADGFNDWAFMTTHSWDEDPSGEWVLEIE-NTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACV 597
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15019018 (SmedSxldir_c108536_g2_i2|m.79117|m.1373)

HSP 1 Score: 1097.8 bits (2838), Expect = 0
Identity = 538/646 (83.28%), Postives = 583/646 (90.25%), Query Frame = 1
Query: 2296 WICLIAASKRSWAGIHTNQWHVHLHEPG-ENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRD-RIPLPSINKKGIPDREKVKN--ENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ* 4221
WI L I TNQWHVHLH+P + A KVA ETGFS+LR+H SPNEF+F HK +P VS+VPSWS H L+AH +VK A Q EG+LR+KRGYKP+K+ R+PLP+INKKGIP + N ++KLPTDPLF+KEWYIRNTGQA+GVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNG+CGVG+AYDSK+ GLRMLDQPYMTDLIE+AAMS+DRD+I IYSASWGPTDDGRTVDGPRNETM+AIV+GVNKGR GKG+IYVWASGDGG ADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAW+SLDAGVGTVDLYGQCTLHHSGTSAAAPEAA VFALALEAN+NIGWRDMQHL+VLTSKRNHLHDRD+RHNWTINGAGLEFNHLFGYGVLDAGDMVRVAK+WVNVPERFHCIAG IDKR FNV+KAL+LEIDTDACK D H VNYLEHVQAFV+VK+SRRGDITMFLTSPMGTTSMILS R KDDD +RGFTKWPFMTTHTWGENPRGKW+LTVMFDT+D LSQG+FSEW+LVLHGTQ+ PYDKLS+SLE IIPKL VKRQHAS F Q*
Sbjct: 5 WILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ* 650

HSP 2 Score: 1097.8 bits (2838), Expect = 0
Identity = 538/646 (83.28%), Postives = 583/646 (90.25%), Query Frame = -1
Query:  198 WICLIAASKRSWAGIHTNQWHVHLHEPG-ENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRD-RIPLPSINKKGIPDREKVKN--ENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ* 2123
WI L I TNQWHVHLH+P + A KVA ETGFS+LR+H SPNEF+F HK +P VS+VPSWS H L+AH +VK A Q EG+LR+KRGYKP+K+ R+PLP+INKKGIP + N ++KLPTDPLF+KEWYIRNTGQA+GVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNG+CGVG+AYDSK+ GLRMLDQPYMTDLIE+AAMS+DRD+I IYSASWGPTDDGRTVDGPRNETM+AIV+GVNKGR GKG+IYVWASGDGG ADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAW+SLDAGVGTVDLYGQCTLHHSGTSAAAPEAA VFALALEAN+NIGWRDMQHL+VLTSKRNHLHDRD+RHNWTINGAGLEFNHLFGYGVLDAGDMVRVAK+WVNVPERFHCIAG IDKR FNV+KAL+LEIDTDACK D H VNYLEHVQAFV+VK+SRRGDITMFLTSPMGTTSMILS R KDDD +RGFTKWPFMTTHTWGENPRGKW+LTVMFDT+D LSQG+FSEW+LVLHGTQ+ PYDKLS+SLE IIPKL VKRQHAS F Q*
Sbjct: 5 WILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ* 650
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15036165 (SmedSxlregen_c89995_g1_i1|m.42695|m.12874)

HSP 1 Score: 395.201 bits (1014), Expect = 1.21132e-120
Identity = 247/632 (39.08%), Postives = 358/632 (56.65%), Query Frame = 1
Query: 2275 MKFYLTIW---ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRY-----TDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVA-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDA-GVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHC--IAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVM-FDTEDALSQGLFSEWILVLHGTQTPP 4131
MK ++ ++ C A S+ G +T+ W V ++ ++ A+ +AA GF L P+ + F H+ + + S PS + NL P V Q +R KR + DP + K WY+ K+ +N++SAW +G G+ V +I+DDGI+ HPDL +NY+ +SYD SND P PRY T N HGTRCAG+++A +N +CGVG+AY + + G+RMLD ++D +ES ++ I IYSASWGP DDG+TVDGP A DG+ KGR+G G+I+VWASG+GG D+CNCDGY S++T+ +N+ + G+ Y E CSSTLA T+S+G S+D + T D+ +CT HSGTSA+AP AA + ALAL AN + WRDMQHL V+T+++ +L D W+ N AG E++H FG+G++DAG MV +A W VPE+ C +A + VL I TDAC + V YLEHVQA +++++++RG++ ++L SP +TS +L++R ++D S GF WPFM+ H WGE G W+LT+ +D E L W L+L+GT T P
Sbjct: 1 MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDD-ARILAATYGFVFLNEIM--PSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKR-------------------------------HIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGE-VSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSG----SMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVD----WSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKR-RNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN-----WSLILYGTDTLP 578

HSP 2 Score: 395.201 bits (1014), Expect = 1.21132e-120
Identity = 247/632 (39.08%), Postives = 358/632 (56.65%), Query Frame = -1
Query:  288 MKFYLTIW---ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRY-----TDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVA-DDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDA-GVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHC--IAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVM-FDTEDALSQGLFSEWILVLHGTQTPP 2144
MK ++ ++ C A S+ G +T+ W V ++ ++ A+ +AA GF L P+ + F H+ + + S PS + NL P V Q +R KR + DP + K WY+ K+ +N++SAW +G G+ V +I+DDGI+ HPDL +NY+ +SYD SND P PRY T N HGTRCAG+++A +N +CGVG+AY + + G+RMLD ++D +ES ++ I IYSASWGP DDG+TVDGP A DG+ KGR+G G+I+VWASG+GG D+CNCDGY S++T+ +N+ + G+ Y E CSSTLA T+S+G S+D + T D+ +CT HSGTSA+AP AA + ALAL AN + WRDMQHL V+T+++ +L D W+ N AG E++H FG+G++DAG MV +A W VPE+ C +A + VL I TDAC + V YLEHVQA +++++++RG++ ++L SP +TS +L++R ++D S GF WPFM+ H WGE G W+LT+ +D E L W L+L+GT T P
Sbjct: 1 MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDD-ARILAATYGFVFLNEIM--PSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKR-------------------------------HIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGE-VSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSG----SMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVD----WSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKR-RNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN-----WSLILYGTDTLP 578
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15033125 (SmedSxlregen_c82367_g1_i3|m.22377|m.8734)

HSP 1 Score: 344.739 bits (883), Expect = 6.56306e-98
Identity = 231/611 (37.81%), Postives = 349/611 (57.12%), Query Frame = 1
Query: 2341 HTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEF-IFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRG---FTKWPFMTTHTWGENPRGKWRLTV-MFDTEDALSQGLFSEWILVLHGTQTPPYDKLSA 4149
H N++ + G + AK VA + GF +L+ + ++F +F ++ ++ S H L V A Q R KR + +K+ + +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVGIAY+S++ +RMLD +TD +E+ A+S + I IYS SWGP D+G+ V+GP A G+ GR+G GNIYVWASG+GG +D C CDGYA+S++TISI+S + + Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AA + AL +EAN+N+ WRD+Q++ VLTS + D N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K++ + L + TD C + VNY+EHV ++ + +RGD+ + L SP GT S IL R D +RG F WP M+ WGE G+W + + + T+ + S G++S + L ++GT+ P +SA
Sbjct: 27 HINEYVIQC-PGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYRY---DNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQIKF------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFID----GNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591

HSP 2 Score: 344.739 bits (883), Expect = 6.56306e-98
Identity = 231/611 (37.81%), Postives = 349/611 (57.12%), Query Frame = -1
Query:  270 HTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEF-IFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRG---FTKWPFMTTHTWGENPRGKWRLTV-MFDTEDALSQGLFSEWILVLHGTQTPPYDKLSA 2078
H N++ + G + AK VA + GF +L+ + ++F +F ++ ++ S H L V A Q R KR + +K+ + +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVGIAY+S++ +RMLD +TD +E+ A+S + I IYS SWGP D+G+ V+GP A G+ GR+G GNIYVWASG+GG +D C CDGYA+S++TISI+S + + Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AA + AL +EAN+N+ WRD+Q++ VLTS + D N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K++ + L + TD C + VNY+EHV ++ + +RGD+ + L SP GT S IL R D +RG F WP M+ WGE G+W + + + T+ + S G++S + L ++GT+ P +SA
Sbjct: 27 HINEYVIQC-PGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYRY---DNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQIKF------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFID----GNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15002657 (Asxlregen_comp67843_c0_seq3|m.34885|m.51170)

HSP 1 Score: 344.354 bits (882), Expect = 9.80308e-98
Identity = 231/611 (37.81%), Postives = 349/611 (57.12%), Query Frame = 1
Query: 2341 HTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEF-IFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRG---FTKWPFMTTHTWGENPRGKWRLTV-MFDTEDALSQGLFSEWILVLHGTQTPPYDKLSA 4149
H N++ + G + AK VA + GF +L+ + ++F +F ++ ++ S H L V A Q R KR + +K+ + +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVGIAY+S++ +RMLD +TD +E+ A+S + I IYS SWGP D+G+ V+GP A G+ GR+G GNIYVWASG+GG +D C CDGYA+S++TISI+S + + Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AA + AL +EAN+N+ WRD+Q++ VLTS + D N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K++ + L + TD C + VNY+EHV ++ + +RGD+ + L SP GT S IL R D +RG F WP M+ WGE G+W + + + T+ + S G++S + L ++GT+ P +SA
Sbjct: 27 HINEYVIQC-PGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYRY---DNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQIKF------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFID----GNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591

HSP 2 Score: 344.354 bits (882), Expect = 9.80308e-98
Identity = 231/611 (37.81%), Postives = 349/611 (57.12%), Query Frame = -1
Query:  270 HTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEF-IFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRG---FTKWPFMTTHTWGENPRGKWRLTV-MFDTEDALSQGLFSEWILVLHGTQTPPYDKLSA 2078
H N++ + G + AK VA + GF +L+ + ++F +F ++ ++ S H L V A Q R KR + +K+ + +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVGIAY+S++ +RMLD +TD +E+ A+S + I IYS SWGP D+G+ V+GP A G+ GR+G GNIYVWASG+GG +D C CDGYA+S++TISI+S + + Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AA + AL +EAN+N+ WRD+Q++ VLTS + D N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K++ + L + TD C + VNY+EHV ++ + +RGD+ + L SP GT S IL R D +RG F WP M+ WGE G+W + + + T+ + S G++S + L ++GT+ P +SA
Sbjct: 27 HINEYVIQC-PGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYRY---DNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQIKF------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFID----GNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15000885 (Asxlregen_comp60502_c0_seq1|m.9253|m.45850)

HSP 1 Score: 330.102 bits (845), Expect = 1.0855e-97
Identity = 234/646 (36.22%), Postives = 343/646 (53.10%), Query Frame = 1
Query: 2212 QDHSFIEYFSAHSRRRNLLENMKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSW-SHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGV-ADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFS-NGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTV---MFDTEDALSQGLFSEWILVLHGTQTPP 4131
+ H F+ + RNLL L +++ L A + W +W V + E GE AK++A + GF L N F F ++ S S NL H + R+KR K D + +I K+ + R KV +++ DP + EWY+ ++ K D+ V W ITG+GV AI+DDG+++ HPDL NY+ SS D + ND P P T N HGTRCA EI+ +N +CGVGIAY+ K+ G+RMLD P + +IE+ ++ + + I IYS+SWGP DDG+T++ P + + G GR+GKGNI+VWASG+GG+ D C+CDGY +S++ IS+NS T+D + + E C ST+ +T+S + ++ YSL A D+ G+CT HSGTSA+AP A+ +FAL LE N N+ WRD++HL TS+ N + + W N AG N FG+G+L+A MV+ A+ W NVP C + I N A ++ + CK V ++E + + + RG + + L SP G + +L+ R D G WPF + H WGENP GKW + V + D ED G ++ L +GT+T P
Sbjct: 7 KKHWFLNKMNDVQVFRNLL-----ILCVFLVLTQAEYQ-W------EWAVKI-EDGETAAKEIADDFGFEYLGIIGNLDNMFHFRKESSKNGRFKRSVKSATRNLSKHSKISLVIHQRILHRQKRDSKIT--DHMIHHNIIKR-LQHRRKV----LEMFNDPKWPDEWYLFDSRFNSDQKSYDMRVTPVWYMNITGRGVKVAILDDGLEHTHPDLIDNYDPFSSTDLNDNDDDPSPDLTPGTSNEHGTRCASEIAMSANNKICGVGIAYNCKIGGIRMLDGP-VNGIIEAKSLGFNNNHIDIYSSSWGPLDDGKTMEQPSKLVQEVLRRGALSGRNGKGNIFVWASGNGGLYQDSCSCDGYVSSLYVISVNSITDDNKFPYFAEKCPSTMCATYSASSESKYSLIAA----DVKGKCTKKHSGTSASAPYASGIFALVLEMNPNLTWRDIKHLIAWTSEYNWIKN---NLGWKKNAAGFWVNEKFGFGLLNAYKMVKKAQNWKNVPPMTTCRVKVKSSKKISNKLPATIIAYG-NHCK----EKVAFIESIIILMNITYEVRGALLIKLQSPYGMNTTLLTTRNLDKSKD-GIINWPFHSVHNWGENPTGKWVVYVEDKINDDED--RSGEVTDCTLEFYGTKTTP 616

HSP 2 Score: 330.102 bits (845), Expect = 1.0855e-97
Identity = 234/646 (36.22%), Postives = 343/646 (53.10%), Query Frame = -1
Query:  288 QDHSFIEYFSAHSRRRNLLENMKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSW-SHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGV-ADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFS-NGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTV---MFDTEDALSQGLFSEWILVLHGTQTPP 2207
+ H F+ + RNLL L +++ L A + W +W V + E GE AK++A + GF L N F F ++ S S NL H + R+KR K D + +I K+ + R KV +++ DP + EWY+ ++ K D+ V W ITG+GV AI+DDG+++ HPDL NY+ SS D + ND P P T N HGTRCA EI+ +N +CGVGIAY+ K+ G+RMLD P + +IE+ ++ + + I IYS+SWGP DDG+T++ P + + G GR+GKGNI+VWASG+GG+ D C+CDGY +S++ IS+NS T+D + + E C ST+ +T+S + ++ YSL A D+ G+CT HSGTSA+AP A+ +FAL LE N N+ WRD++HL TS+ N + + W N AG N FG+G+L+A MV+ A+ W NVP C + I N A ++ + CK V ++E + + + RG + + L SP G + +L+ R D G WPF + H WGENP GKW + V + D ED G ++ L +GT+T P
Sbjct: 7 KKHWFLNKMNDVQVFRNLL-----ILCVFLVLTQAEYQ-W------EWAVKI-EDGETAAKEIADDFGFEYLGIIGNLDNMFHFRKESSKNGRFKRSVKSATRNLSKHSKISLVIHQRILHRQKRDSKIT--DHMIHHNIIKR-LQHRRKV----LEMFNDPKWPDEWYLFDSRFNSDQKSYDMRVTPVWYMNITGRGVKVAILDDGLEHTHPDLIDNYDPFSSTDLNDNDDDPSPDLTPGTSNEHGTRCASEIAMSANNKICGVGIAYNCKIGGIRMLDGP-VNGIIEAKSLGFNNNHIDIYSSSWGPLDDGKTMEQPSKLVQEVLRRGALSGRNGKGNIFVWASGNGGLYQDSCSCDGYVSSLYVISVNSITDDNKFPYFAEKCPSTMCATYSASSESKYSLIAA----DVKGKCTKKHSGTSASAPYASGIFALVLEMNPNLTWRDIKHLIAWTSEYNWIKN---NLGWKKNAAGFWVNEKFGFGLLNAYKMVKKAQNWKNVPPMTTCRVKVKSSKKISNKLPATIIAYG-NHCK----EKVAFIESIIILMNITYEVRGALLIKLQSPYGMNTTLLTTRNLDKSKD-GIINWPFHSVHNWGENPTGKWVVYVEDKINDDED--RSGEVTDCTLEFYGTKTTP 616
BLAST of pc2 vs. uniprot
Match: gi|13124785|sp|P16519|NEC2_HUMAN (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 704.516 bits (1817), Expect = 0
Identity = 366/612 (59.80%), Postives = 441/612 (72.06%), Query Frame = 1
Query: 2299 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 4134
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 599

HSP 2 Score: 704.516 bits (1817), Expect = 0
Identity = 366/612 (59.80%), Postives = 441/612 (72.06%), Query Frame = -1
Query:  285 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 2120
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. uniprot
Match: gi|75061998|sp|Q5REC2|NEC2_PONAB (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 704.131 bits (1816), Expect = 0
Identity = 366/612 (59.80%), Postives = 441/612 (72.06%), Query Frame = 1
Query: 2299 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 4134
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 599

HSP 2 Score: 704.131 bits (1816), Expect = 0
Identity = 366/612 (59.80%), Postives = 441/612 (72.06%), Query Frame = -1
Query:  285 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 2120
+ + A+++R + TN + V LH+ GE+ A++VAAE GF + + F + + F H + + S H L P VK A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G+ EW L+LHGTQ+ PY
Sbjct: 19 VMVFASAERP---VFTNHFLVELHKGGEDEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. uniprot
Match: gi|128004|sp|P28841|NEC2_RAT (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 704.131 bits (1816), Expect = 0
Identity = 369/636 (58.02%), Postives = 449/636 (70.60%), Query Frame = 1
Query: 2287 LTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQ 4194
L + + A+++R + TN + V LH+ GE A++VAAE GF + + F + + F H + + S H L P +K A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN ++ WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + T+AC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +GL EW L+LHGTQ+ PY + + KLA K+Q
Sbjct: 14 LLFCVMVFASAERP---VFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQ 616

HSP 2 Score: 704.131 bits (1816), Expect = 0
Identity = 369/636 (58.02%), Postives = 449/636 (70.60%), Query Frame = -1
Query:  225 LTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQ 2132
L + + A+++R + TN + V LH+ GE A++VAAE GF + + F + + F H + + S H L P +K A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN ++ WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + T+AC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +GL EW L+LHGTQ+ PY + + KLA K+Q
Sbjct: 14 LLFCVMVFASAERP---VFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQ 616
BLAST of pc2 vs. uniprot
Match: gi|128003|sp|P21661|NEC2_MOUSE (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 703.36 bits (1814), Expect = 0
Identity = 369/632 (58.39%), Postives = 448/632 (70.89%), Query Frame = 1
Query: 2299 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQ 4194
+ + A+++R + TN + V LH+ GE A++VAAE GF + + F + + F H + + S H L P +K A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN ++ WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + T+AC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +GL EW L+LHGTQ+ PY + + KLA K+Q
Sbjct: 18 VMVFASAERP---VFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQ 616

HSP 2 Score: 703.36 bits (1814), Expect = 0
Identity = 369/632 (58.39%), Postives = 448/632 (70.89%), Query Frame = -1
Query:  225 ICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQ 2120
+ + A+++R + TN + V LH+ GE A++VAAE GF + + F + + F H + + S H L P +K A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N +CGVG+AY+SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN ++ WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + T+AC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +GL EW L+LHGTQ+ PY + + KLA K+Q
Sbjct: 18 VMVFASAERP---VFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQ 616
BLAST of pc2 vs. uniprot
Match: gi|417351|sp|Q03333|NEC2_PIG (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 702.59 bits (1812), Expect = 0
Identity = 366/616 (59.42%), Postives = 440/616 (71.43%), Query Frame = 1
Query: 2287 LTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 4134
L + + A+++R + TN + V LH+ GE A++VAAE GF + + F + + F H + + S H L P VK+A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G EW L+LHG+Q+ PY
Sbjct: 15 LLFCVTVFASAERP---VFTNHFLVELHKGGEEEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGAVKEWTLMLHGSQSAPY 599

HSP 2 Score: 702.59 bits (1812), Expect = 0
Identity = 366/616 (59.42%), Postives = 440/616 (71.43%), Query Frame = -1
Query:  285 LTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPY 2132
L + + A+++R + TN + V LH+ GE A++VAAE GF + + F + + F H + + S H L P VK+A Q EG+ RKKRGY+ + I + DPLF K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N +CGVG+AY SKV G+RMLDQP+MTD+IE++++SH I IYSASWGPTD+G+TVDGPR T++A+ DGVNKGR GKG+IYVWASGDGG DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAA VFALALEAN + WRDMQHL+VLTSKRN LH D+ H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G++ + LVL + TDAC+ E + V YLEHVQA +TV A+RRGD+ + +TSPMGT S++LSRR +DDD GF KWPFMTTHTWGE+ RG W L + F A +G EW L+LHG+Q+ PY
Sbjct: 15 LLFCVTVFASAERP---VFTNHFLVELHKGGEEEARQVAAEHGFGVRKLPF-AEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYRDINEIDINM----------------------NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLH--DEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGF-VGSAPQKGAVKEWTLMLHGSQSAPY 599
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|17136192|ref|NP_477318.1| (amontillado [Drosophila melanogaster])

HSP 1 Score: 712.22 bits (1837), Expect = 0
Identity = 372/609 (61.08%), Postives = 442/609 (72.58%), Query Frame = 1
Query: 2383 NMAKKVAAETGFSLLRSHFKSP-NEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASK 4206
+ A VA + GF L + +E+ F H+ +P + S +H L +HP V A Q G+ R KRG +P +P+I+ + N + PTDP F +WY++NTGQ G LDLNV +AWAQGITGK VTTAIMDDG+DY+HPDL NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNG+CGVG+AYDSK+ G+RMLDQPYMTDLIE+ +M H+ IHIYSASWGPTDDG+TVDGPRN TM+AIV GVN+GR+G GNIYVWASGDGG DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG + GV T DLYG+CT HSGTSAAAPEAA VFALALEAN + WRD+QHL+VLTSKRN L D R +WT+NG GLEFNHLFG+GVLDAG MV ++KQW +VP R+HC AG + + + ++L EI TDACK + VNYLEHVQA ++ ASRRGD+ +FLTSPMGT SMILSRR DDD GFTKWPFMTTH+WGE P+G W+L F++ G EW LVLHGT+ PY L S + KLA VK+ H K
Sbjct: 55 SFAHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA------VPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGTDTE-VNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQT-RHGNLLEWSLVLHGTKEAPYRTLHPS--SPHSKLAIVKKAHEDK 651

HSP 2 Score: 712.22 bits (1837), Expect = 0
Identity = 372/609 (61.08%), Postives = 442/609 (72.58%), Query Frame = -1
Query:  213 NMAKKVAAETGFSLLRSHFKSP-NEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASK 2036
+ A VA + GF L + +E+ F H+ +P + S +H L +HP V A Q G+ R KRG +P +P+I+ + N + PTDP F +WY++NTGQ G LDLNV +AWAQGITGK VTTAIMDDG+DY+HPDL NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNG+CGVG+AYDSK+ G+RMLDQPYMTDLIE+ +M H+ IHIYSASWGPTDDG+TVDGPRN TM+AIV GVN+GR+G GNIYVWASGDGG DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG + GV T DLYG+CT HSGTSAAAPEAA VFALALEAN + WRD+QHL+VLTSKRN L D R +WT+NG GLEFNHLFG+GVLDAG MV ++KQW +VP R+HC AG + + + ++L EI TDACK + VNYLEHVQA ++ ASRRGD+ +FLTSPMGT SMILSRR DDD GFTKWPFMTTH+WGE P+G W+L F++ G EW LVLHGT+ PY L S + KLA VK+ H K
Sbjct: 55 SFAHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA------VPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGTDTE-VNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQT-RHGNLLEWSLVLHGTKEAPYRTLHPS--SPHSKLAIVKKAHEDK 651
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|442621104|ref|NP_001262953.1| (furin 1, isoform H [Drosophila melanogaster])

HSP 1 Score: 404.831 bits (1039), Expect = 2.44434e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = 1
Query: 2335 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 4128
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791

HSP 2 Score: 404.831 bits (1039), Expect = 2.44434e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = -1
Query:  291 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 2084
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24650058|ref|NP_733103.1| (furin 1, isoform C [Drosophila melanogaster])

HSP 1 Score: 404.445 bits (1038), Expect = 6.88073e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = 1
Query: 2335 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 4128
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791

HSP 2 Score: 404.445 bits (1038), Expect = 6.88073e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = -1
Query:  291 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 2084
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24650060|ref|NP_733104.1| (furin 1, isoform D [Drosophila melanogaster])

HSP 1 Score: 404.445 bits (1038), Expect = 6.88073e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = 1
Query: 2335 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 4128
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791

HSP 2 Score: 404.445 bits (1038), Expect = 6.88073e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = -1
Query:  291 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 2084
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|45553513|ref|NP_996293.1| (furin 1, isoform F [Drosophila melanogaster])

HSP 1 Score: 404.445 bits (1038), Expect = 6.88073e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = 1
Query: 2335 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXXNTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 4128
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791

HSP 2 Score: 404.445 bits (1038), Expect = 6.88073e-121
Identity = 244/599 (40.73%), Postives = 350/599 (58.43%), Query Frame = -1
Query:  291 GIHTNQWHVHLHEPGENMAKKVAAETGFSLLRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLRKKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRNTGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSKVVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNETMKAIVDGVNKGRHGKGNIYVWASGDGG-VADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGTSXXXXXXXXXXXXXXXANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNVSKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMGTTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDALSQGLFSEWILVLHGTQTP 2084
G +T+ W VH+ MA VA + GF L F + + F H + + S P+ H L V A Q R KR + ++ R + + + + + + K P + WY+ G LD+NV+ AW GITGKGV I+DDG++ HPD+ NY+ ++SYD +S+D P P Y N HGTRCAGE++A +N C VGIAY + V G+RMLD +TD +E+ ++S + I IYSASWGP DDG+TVDGP +A ++G KGR GKG+I++WASG+GG D+CNCDGY S+WT+SI+SAT +G Y E CSSTLA+T+S+G + V T DL+ CT+ H+GTSA+AP AA + AL L++N N+ WRD+QH+ V T+K +L D +W+ NG G +H FGYG++DA +MVRVA+ W VPE+ C + + L++ + C+ VNYLEHVQA +T+ + RRGDI +FL SP T+ +L+ R D+ S GF +WPFM+ HTWGE+P+G W+L + + ++W ++ +GT+TP
Sbjct: 229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFD--DHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRT-----SSRAMSMVDAMSFNDSKWP------QMWYLNRGG------GLDMNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGD-VTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQG---EKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDP----SWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCR-----SVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRS-GFNQWPFMSVHTWGESPQGNWQLEIH---NEGRYMAQITQWDMIFYGTETP 791
The following BLAST results are available for this feature:
BLAST of pc2 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|320118926|ref|NP_001188457.1|0.000000e+060.77neuroendocrine convertase 2 isoform 3 [Homo sapien... [more]
gi|20336244|ref|NP_002585.2|0.000000e+059.80neuroendocrine convertase 2 isoform 1 preproprotei... [more]
gi|320118928|ref|NP_001188458.1|0.000000e+058.66neuroendocrine convertase 2 isoform 2 preproprotei... [more]
gi|20336242|ref|NP_000430.3|2.026820e-12840.60neuroendocrine convertase 1 isoform 1 preproprotei... [more]
gi|4505579|ref|NP_002560.1|5.384930e-12841.61furin preproprotein [Homo sapiens][more]
back to top
BLAST of pc2 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150190180.000000e+083.28SmedSxldir_c108536_g2_i2|m.79117|m.1373[more]
SMU150361651.211320e-12039.08SmedSxlregen_c89995_g1_i1|m.42695|m.12874[more]
SMU150331256.563060e-9837.81SmedSxlregen_c82367_g1_i3|m.22377|m.8734[more]
SMU150026579.803080e-9837.81Asxlregen_comp67843_c0_seq3|m.34885|m.51170[more]
SMU150008851.085500e-9736.22Asxlregen_comp60502_c0_seq1|m.9253|m.45850[more]
back to top
BLAST of pc2 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|13124785|sp|P16519|NEC2_HUMAN0.000000e+059.80RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|75061998|sp|Q5REC2|NEC2_PONAB0.000000e+059.80RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128004|sp|P28841|NEC2_RAT0.000000e+058.02RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128003|sp|P21661|NEC2_MOUSE0.000000e+058.39RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|417351|sp|Q03333|NEC2_PIG0.000000e+059.42RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
back to top
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136192|ref|NP_477318.1|0.000000e+061.08amontillado [Drosophila melanogaster][more]
gi|442621104|ref|NP_001262953.1|2.444340e-12140.73furin 1, isoform H [Drosophila melanogaster][more]
gi|24650058|ref|NP_733103.1|6.880730e-12140.73furin 1, isoform C [Drosophila melanogaster][more]
gi|24650060|ref|NP_733104.1|6.880730e-12140.73furin 1, isoform D [Drosophila melanogaster][more]
gi|45553513|ref|NP_996293.1|6.880730e-12140.73furin 1, isoform F [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_003685 ID=Pgr_003685|Name=pc2|organism=Phagocata gracilis|type=mRNA|length=4418bp
TTTTACGAAGACAGATAATATTTATTACAGACGAATTGATTATCACAAAT
GAGAGGATCATCACAAGTATTACCATCGAGACAAATGTGTACCAGCAATA
CGGACACAGATCTGAGATGGATCACAGCAAGGACAAGTGTTACGATGTCA
CTAATTATTGATGACGATGACGTCACACCATTATGTCATAGGGTCGATCA
TTGGAGGAATGTCTTGGACGCATGTTGTCTCTTTACGGCGGCCAACTTCG
GGATGATGGTCTCGAGAGAGGCGGACAACTTGTCGTAGGGTGGCGTCTGA
GTTCCGTGCAACACTAGGATCCACTCGGAGAAGAGACCCTGACTCAGGGC
GTCCTCGGTATCGAACATTACTGTCAGTCGCCACTTGCCACGAGGGTTCT
CACCCCAGGTGTGCGTGGTCATGAATGGCCACTTCGTGAACCCGCGACTA
GGGTCGTCGTCCTTCTCGCGGCGACTGAGAATCATCGAGGTCGTGCCCAT
CGGGCTCGTCAGGAACATTGTGATGTCGCCACGGCGACTAGCCTTCACGG
TGACGAAGGCCTGCACATGCTCAAGGTAGTTGACCATGTGTGCCTCGTCC
AACTTACAGGCGTCCGTGTCTATCTCGAGCACCAGTGCCTTGCTGACATT
GAATATCATCCTCTTGTCGATTGTACCCGCAATGCAATGGAATCTCTCTG
GCACATTGACCCACTGCTTAGCCACCCGCACCATATCGCCTGCGTCCAGC
ACTCCGTACCCGAATAAGTGATTGAATTCCAGGCCCGCGCCATTGATCGT
CCAATTATGGCGCTGGTCCCGGTCATGCAGATGGTTTCTCTTGCTTGTCA
GCACTGACAGATGCTGCATGTCTCGCCATCCAATGTTCGTATTCGCTTCG
AGCGCCAAGGCGAACACCGCGGCCGCTTCAGGTGCGGCGGCGGATGTCCC
GGAATGGTGGAGGGTGCATTGTCCATAAAGATCCACGGTACCTACGCCTG
CATCGAGACTGTACCATGCCTTGCCATTGGAGAAGGTGGACGCCAGGGTC
GAGGAGCACGACTCGTCATAACTTGCAGTCTCGCCATCATTGGTGGCGGA
GTTAATGCTAATGGTCCACATACTGGCGGCGTACCCGTCACAGTTGCAGT
CATCGGCCACTCCTCCGTCCCCTGAGGCCCACACATATATATTACCCTTG
CCATGACGACCCTTGTTCACTCCATCCACTATGGCCTTCATGGTCTCGTT
TCGAGGCCCGTCCACGGTTCTCCCGTCATCAGTGGGGCCCCAACTAGCCG
AGTATATATGGATTGAGTCGCGATCGTGACTCATCGCCGCTGATTCGATC
AGATCGGTCATATATGGTTGATCGAGCATCCGTAATCCGACCACCTTGGA
GTCATAAGCGATCCCCACTCCGCAGACGCCATTGTCCCTCTCGGCAGAGA
TCTCCCCAGCACATCTAGTCCCGTGACTATTGAACCAGTCATCAGTGTAC
CGCGGGAATGGGTACGGATCATTACTACTGAAGTCATAGCTACTCTCGGC
ATTGTAGTTCTTAGACAAATCCGGATGCAGATAGTCGATACCGTCGTCCA
TGATAGCTGTGGTCACCCCCTTACCTGTGATGCCTTGTGCCCATGCCGAG
AGAACGTTCAGGTCAAGGTCCTTGACCCCCTCTGCCTGCCCGGTATTCCT
AATGTACCATTCCTTGGCAAATAATGGGTCGGTTGGGAGCTTGATATTCT
CATTCTTGACCTTCTCTCGGTCTGGGATCCCTTTCTTGTTTATACTTGGT
AGTGGGATTCGATCCCTCTTGACTGGCTTGTAGCCCCTCTTCTTACGAAG
ATAACCCTCCGCTTGATTGGCCTGTTTCACCATCGGATGCGCAACAAGAT
TCATGTGGTGGCTCCAACTAGGTACGGCACTCACCTCCGGAATGGCTTTG
TGAGTGAATATGAACTCATTCGGGGACTTGAAGTGACTCCGCAGAAGAGA
GAATCCAGTCTCTGCGGCGACCTTCTTTGCCATGTTCTCGCCTGGTTCAT
GGAGGTGTACGTGCCACTGATTGGTGTGGATTCCAGCCCAGGATCTCTTG
CTGGCCGCTATCAAACAGATCCATATCGTCAAGTAAAATTTCATATTTTC
AAGTAAATTTCTCCTACGTGAATGAGCAGAAAAATATTCGATAAAACTGT
GATCCTGACGTCAGGATCACAGTTTTATCGAATATTTTTCTGCTCATTCA
CGTAGGAGAAATTTACTTGAAAATATGAAATTTTACTTGACGATATGGAT
CTGTTTGATAGCGGCCAGCAAGAGATCCTGGGCTGGAATCCACACCAATC
AGTGGCACGTACACCTCCATGAACCAGGCGAGAACATGGCAAAGAAGGTC
GCCGCAGAGACTGGATTCTCTCTTCTGCGGAGTCACTTCAAGTCCCCGAA
TGAGTTCATATTCACTCACAAAGCCATTCCGGAGGTGAGTGCCGTACCTA
GTTGGAGCCACCACATGAATCTTGTTGCGCATCCGATGGTGAAACAGGCC
AATCAAGCGGAGGGTTATCTTCGTAAGAAGAGGGGCTACAAGCCAGTCAA
GAGGGATCGAATCCCACTACCAAGTATAAACAAGAAAGGGATCCCAGACC
GAGAGAAGGTCAAGAATGAGAATATCAAGCTCCCAACCGACCCATTATTT
GCCAAGGAATGGTACATTAGGAATACCGGGCAGGCAGAGGGGGTCAAGGA
CCTTGACCTGAACGTTCTCTCGGCATGGGCACAAGGCATCACAGGTAAGG
GGGTGACCACAGCTATCATGGACGACGGTATCGACTATCTGCATCCGGAT
TTGTCTAAGAACTACAATGCCGAGAGTAGCTATGACTTCAGTAGTAATGA
TCCGTACCCATTCCCGCGGTACACTGATGACTGGTTCAATAGTCACGGGA
CTAGATGTGCTGGGGAGATCTCTGCCGAGAGGGACAATGGCGTCTGCGGA
GTGGGGATCGCTTATGACTCCAAGGTGGTCGGATTACGGATGCTCGATCA
ACCATATATGACCGATCTGATCGAATCAGCGGCGATGAGTCACGATCGCG
ACTCAATCCATATATACTCGGCTAGTTGGGGCCCCACTGATGACGGGAGA
ACCGTGGACGGGCCTCGAAACGAGACCATGAAGGCCATAGTGGATGGAGT
GAACAAGGGTCGTCATGGCAAGGGTAATATATATGTGTGGGCCTCAGGGG
ACGGAGGAGTGGCCGATGACTGCAACTGTGACGGGTACGCCGCCAGTATG
TGGACCATTAGCATTAACTCCGCCACCAATGATGGCGAGACTGCAAGTTA
TGACGAGTCGTGCTCCTCGACCCTGGCGTCCACCTTCTCCAATGGCAAGG
CATGGTACAGTCTCGATGCAGGCGTAGGTACCGTGGATCTTTATGGACAA
TGCACCCTCCACCATTCCGGGACATCCGCCGCCGCACCTGAAGCGGCCGC
GGTGTTCGCCTTGGCGCTCGAAGCGAATACGAACATTGGATGGCGAGACA
TGCAGCATCTGTCAGTGCTGACAAGCAAGAGAAACCATCTGCATGACCGG
GACCAGCGCCATAATTGGACGATCAATGGCGCGGGCCTGGAATTCAATCA
CTTATTCGGGTACGGAGTGCTGGACGCAGGCGATATGGTGCGGGTGGCTA
AGCAGTGGGTCAATGTGCCAGAGAGATTCCATTGCATTGCGGGTACAATC
GACAAGAGGATGATATTCAATGTCAGCAAGGCACTGGTGCTCGAGATAGA
CACGGACGCCTGTAAGTTGGACGAGGCACACATGGTCAACTACCTTGAGC
ATGTGCAGGCCTTCGTCACCGTGAAGGCTAGTCGCCGTGGCGACATCACA
ATGTTCCTGACGAGCCCGATGGGCACGACCTCGATGATTCTCAGTCGCCG
CGAGAAGGACGACGACCCTAGTCGCGGGTTCACGAAGTGGCCATTCATGA
CCACGCACACCTGGGGTGAGAACCCTCGTGGCAAGTGGCGACTGACAGTA
ATGTTCGATACCGAGGACGCCCTGAGTCAGGGTCTCTTCTCCGAGTGGAT
CCTAGTGTTGCACGGAACTCAGACGCCACCCTACGACAAGTTGTCCGCCT
CTCTCGAGACCATCATCCCGAAGTTGGCCGCCGTAAAGAGACAACATGCG
TCCAAGACATTCCTCCAATGATCGACCCTATGACATAATGGTGTGACGTC
ATCGTCATCAATAATTAGTGACATCGTAACACTTGTCCTTGCTGTGATCC
ATCTCAGATCTGTGTCCGTATTGCTGGTACACATTTGTCTCGATGGTAAT
ACTTGTGATGATCCTCTCATTTGTGATAATCAATTCGTCTGTAATAAATA
TTATCTGTCTTCGTAAAA

Design Primers for pc2

back to top

protein sequence

>Pgr_003685-protein ID=Pgr_003685-protein|Name=pc2|organism=Phagocata gracilis|type=polypeptide|length=649bp
MKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSL
LRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLR
KKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRN
TGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSK
VVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNE
TMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAAVFALALEANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNV
SKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMG
TTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDAL
SQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ*
back to top

coding sequence

>Pgr_003685.2275.4221 ID=Pgr_003685.2275.4221|Name=Pgr_003685.2275.4221|organism=Phagocata gracilis|type=CDS|length=1947bp
ATGAAATTTTACTTGACGATATGGATCTGTTTGATAGCGGCCAGCAAGAG
ATCCTGGGCTGGAATCCACACCAATCAGTGGCACGTACACCTCCATGAAC
CAGGCGAGAACATGGCAAAGAAGGTCGCCGCAGAGACTGGATTCTCTCTT
CTGCGGAGTCACTTCAAGTCCCCGAATGAGTTCATATTCACTCACAAAGC
CATTCCGGAGGTGAGTGCCGTACCTAGTTGGAGCCACCACATGAATCTTG
TTGCGCATCCGATGGTGAAACAGGCCAATCAAGCGGAGGGTTATCTTCGT
AAGAAGAGGGGCTACAAGCCAGTCAAGAGGGATCGAATCCCACTACCAAG
TATAAACAAGAAAGGGATCCCAGACCGAGAGAAGGTCAAGAATGAGAATA
TCAAGCTCCCAACCGACCCATTATTTGCCAAGGAATGGTACATTAGGAAT
ACCGGGCAGGCAGAGGGGGTCAAGGACCTTGACCTGAACGTTCTCTCGGC
ATGGGCACAAGGCATCACAGGTAAGGGGGTGACCACAGCTATCATGGACG
ACGGTATCGACTATCTGCATCCGGATTTGTCTAAGAACTACAATGCCGAG
AGTAGCTATGACTTCAGTAGTAATGATCCGTACCCATTCCCGCGGTACAC
TGATGACTGGTTCAATAGTCACGGGACTAGATGTGCTGGGGAGATCTCTG
CCGAGAGGGACAATGGCGTCTGCGGAGTGGGGATCGCTTATGACTCCAAG
GTGGTCGGATTACGGATGCTCGATCAACCATATATGACCGATCTGATCGA
ATCAGCGGCGATGAGTCACGATCGCGACTCAATCCATATATACTCGGCTA
GTTGGGGCCCCACTGATGACGGGAGAACCGTGGACGGGCCTCGAAACGAG
ACCATGAAGGCCATAGTGGATGGAGTGAACAAGGGTCGTCATGGCAAGGG
TAATATATATGTGTGGGCCTCAGGGGACGGAGGAGTGGCCGATGACTGCA
ACTGTGACGGGTACGCCGCCAGTATGTGGACCATTAGCATTAACTCCGCC
ACCAATGATGGCGAGACTGCAAGTTATGACGAGTCGTGCTCCTCGACCCT
GGCGTCCACCTTCTCCAATGGCAAGGCATGGTACAGTCTCGATGCAGGCG
TAGGTACCGTGGATCTTTATGGACAATGCACCCTCCACCATTCCGGGACA
TCCGCCGCCGCACCTGAAGCGGCCGCGGTGTTCGCCTTGGCGCTCGAAGC
GAATACGAACATTGGATGGCGAGACATGCAGCATCTGTCAGTGCTGACAA
GCAAGAGAAACCATCTGCATGACCGGGACCAGCGCCATAATTGGACGATC
AATGGCGCGGGCCTGGAATTCAATCACTTATTCGGGTACGGAGTGCTGGA
CGCAGGCGATATGGTGCGGGTGGCTAAGCAGTGGGTCAATGTGCCAGAGA
GATTCCATTGCATTGCGGGTACAATCGACAAGAGGATGATATTCAATGTC
AGCAAGGCACTGGTGCTCGAGATAGACACGGACGCCTGTAAGTTGGACGA
GGCACACATGGTCAACTACCTTGAGCATGTGCAGGCCTTCGTCACCGTGA
AGGCTAGTCGCCGTGGCGACATCACAATGTTCCTGACGAGCCCGATGGGC
ACGACCTCGATGATTCTCAGTCGCCGCGAGAAGGACGACGACCCTAGTCG
CGGGTTCACGAAGTGGCCATTCATGACCACGCACACCTGGGGTGAGAACC
CTCGTGGCAAGTGGCGACTGACAGTAATGTTCGATACCGAGGACGCCCTG
AGTCAGGGTCTCTTCTCCGAGTGGATCCTAGTGTTGCACGGAACTCAGAC
GCCACCCTACGACAAGTTGTCCGCCTCTCTCGAGACCATCATCCCGAAGT
TGGCCGCCGTAAAGAGACAACATGCGTCCAAGACATTCCTCCAATGA
back to top
Gene Groups
pc2 is similar in sequence to the genes of this group: GG3186
Gene NameGene ID
SMU15019018SMU15019018
pc2Ddo_018155
pc2Gsp_010792
pc2Pgr_003685
Pgr_007588Pgr_007588
pc2Pmo_008419
Pmo_028616Pmo_028616

Gene Group Protein Sequences

>SMU15019018

MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLR
NHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRK
RGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFN
VTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP
LSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Ddo_018155 pc2
MMFLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVLR
GHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKK
RGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRN
TGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSK
IAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNE
TMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKRNHLHDRDRRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNV
SRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMG
TTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPL
SQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRFMQ*
>Gsp_010792 pc2
MYRISLLFLIQIYTIYGKIVTNQWHVRLHDPGTHDLANKVAQETGFSLLR
NHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKK
RGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN
VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDP
LSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Pgr_003685 pc2
MKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSL
LRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLR
KKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRN
TGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSK
VVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNE
TMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAAVFALALEANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNV
SKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMG
TTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDAL
SQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ*
>Pgr_007588 Pgr_007588
MHFYLIFWLFVLSGVRESLAKIHSNQWYVRLHESGDDAAKRVASETGFVY
LRNHLQSPHEFIFTHRGIADASAAPSVSHQMNLLAHPMVKQASQMEGFLR
RKRGYKPVKKLPLQLTNINKKGIPDREKNSTDAHSQRRLPRDPLFSKEWY
ILNTGQAEGVKDLDLNVLSAWDQGVTGKGITTAIMDDGIDYLHPDLSKNY
NAENSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNDICGVGIAY
NSKVAGLRMLDQPYMTDLIEASAMSHDRDMIDIYSASWGPTDDGRTVDGP
RNETMRAIVDGVNKGRNGRGSIYVWASGDGGMSDDCNCDGYAASMWTISI
NSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLLH
SGTSAAAPEAAAVFALALEANREIGWRDMQHLSVLTSKRNHLHDRDGRHN
WTINGAGLEFNHLFGYGVLDAGDMVRVAKKWINVPERFHCIAGEISERSR
FNISKALILEINTDACKSSDGHRVNYLEHVQAFVTVRASRRGDVTLFLTS
PMGTTSMILSRRVKDGDSMQGFTKWPFMTTHTWGENPRGKWRLMAMFDTD
DALSQGVLSEWILVLHGTQERPYDKLSSSLEKILPKLAVIKRQHASKNFL
Q*
>Pmo_008419 pc2
MRVAILVSVIVVLLSHRLTATIHSNQWHVHLQQPGEHVAEQVASETGFSL
LRNHLRSPNEFIFTHRALPPASAVASLSHHMNLVAHPLVKQATQMEGFLR
KKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI
RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYN
AESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYN
SQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPR
NETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISIN
SATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHS
GTSAAAPEAAAVFALALEANGEMGWRDMQHLSVLTSKRNHLHDRDGRHNW
TINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRF
NISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSP
MGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTED
ALIQGLLSEWV
>Pmo_028616 Pmo_028616
MDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGE
ISAERDNGVCGVGIAYNSQVVGLRMLDQPYMTDLIESAAMSHERDSIDIY
SASWGPTDDGRTVDGPRNETMKAIVDGVNKGRRGKGNIYVWASGDGGVAD
DCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLD
AGVGTVDLYGQCTLHHSGTSAAAPEAAAVFALALEANTNIGWRDMQHLSV
LTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNV
PERFHCIAGQIDHKARFNVTKALILEIDTDACKSDDGHRVNYLEHVQAFV
TVKASRRGDTTMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWG
ENPRGKWRLTVMFDTEDALSQGMFSEWILLLHGTQIPPYDKLSTSLEKII
PKLAAVKRQHASKKFLE*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.