opsin-like, Gsp_022660 (mRNA) Girardia sp.

Overview
Nameopsin-like
Unique NameGsp_022660
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1377
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of opsin-like vs. RefSeq Human
Match: gi|15150803|ref|NP_150598.1| (melanopsin isoform 1 [Homo sapiens])

HSP 1 Score: 206.453 bits (524), Expect = 3.40503e-59
Identity = 120/302 (39.74%), Postives = 182/302 (60.26%), Query Frame = 1
Query:  154 VPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1050
VP+ HY +G I +VG+ G+LGNL V+Y F ++SLRTP NMFI++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDRY VI +P T + +RA +L+ VWLY+L WS PPFFG+ YVPEG TSC++DY++ + + + + F +P+ II+CY I +A+R E + Q A + +++ + AKI ++++ L+++SW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 361
BLAST of opsin-like vs. RefSeq Human
Match: gi|71999143|ref|NP_001025186.1| (melanopsin isoform 2 [Homo sapiens])

HSP 1 Score: 199.134 bits (505), Expect = 1.69496e-56
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 1
Query:  154 VPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1050
VP+ HY +G I +VG+ G+LGNL V+Y F A +SLRTP NMFI++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDRY VI +P T + +RA +L+ VWLY+L WS PPFFG+ YVPEG TSC++DY++ + + + + F +P+ II+CY I +A+R E + Q A + +++ + AKI ++++ L+++SW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372
BLAST of opsin-like vs. RefSeq Human
Match: gi|38678524|ref|NP_859528.1| (opsin-5 [Homo sapiens])

HSP 1 Score: 159.073 bits (401), Expect = 6.053e-43
Identity = 104/290 (35.86%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  175 LVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1038
+ G Y++I+GI GN VLY+ + K P + ++LA+ DL S V G P IS F HRW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYA++++ + GR D + + +P L AK++AMYNP IY + KF
Sbjct: 35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313
BLAST of opsin-like vs. RefSeq Human
Match: gi|767939382|ref|XP_011512650.1| (PREDICTED: opsin-5 isoform X2 [Homo sapiens])

HSP 1 Score: 156.377 bits (394), Expect = 8.00412e-42
Identity = 114/365 (31.23%), Postives = 174/365 (47.67%), Query Frame = 1
Query:  205 IAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR-IQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQATETSKVQATSGHT--NDAYENEQK*LNKN 1284
I GN VLY+ + K P + ++LA+ DL S V G P IS F HRW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYA++++ + GR D + + +P L AK++AMYNP IY + KF Q TT S+ ++ +K QL ++ + T +S+ T H+ + E E + + N
Sbjct: 7 ILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEDKGRLWHQLSCGENSEMTASSETLGTKAHSPLQETREGENEAVGGN 360
BLAST of opsin-like vs. RefSeq Human
Match: gi|767939384|ref|XP_011512651.1| (PREDICTED: opsin-5 isoform X2 [Homo sapiens])

HSP 1 Score: 156.377 bits (394), Expect = 8.00412e-42
Identity = 114/365 (31.23%), Postives = 174/365 (47.67%), Query Frame = 1
Query:  205 IAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR-IQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQATETSKVQATSGHT--NDAYENEQK*LNKN 1284
I GN VLY+ + K P + ++LA+ DL S V G P IS F HRW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYA++++ + GR D + + +P L AK++AMYNP IY + KF Q TT S+ ++ +K QL ++ + T +S+ T H+ + E E + + N
Sbjct: 7 ILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEDKGRLWHQLSCGENSEMTASSETLGTKAHSPLQETREGENEAVGGN 360
BLAST of opsin-like vs. uniprot
Match: gi|129211|sp|P09241|OPSD_ENTDO (RecName: Full=Rhodopsin [Enteroctopus dofleini])

HSP 1 Score: 323.553 bits (828), Expect = 9.90989e-104
Identity = 158/325 (48.62%), Postives = 237/325 (72.92%), Query Frame = 1
Query:   67 DNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1041
++ +L W ++P + +HP+W FD +P+ +Y VG++I +VGI G+LGN +V+Y+F+ KSL+TP NMFI++LA+ DL+FSA+NGFPL TIS+F +W +GK+ C++YG +GG+FGF+SINTMA+IS+DRY VI +P K ++ +RA +M++FVW++S++WS P F +G YVPEG TSC+FDYL+ F + MY F++P+ I FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++I+ +++SW+PYAIIAL+A G + + PY AELPVLFAK SA++NP +Y+++HPKFR
Sbjct: 3 ESTTLVNQTWWYNPTVD--IHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISMVIITQFMLSWSPYAIIALLAQFGPAEWVTPYAAELPVLFAKASAIHNPIVYSVSHPKFR 324
BLAST of opsin-like vs. uniprot
Match: gi|129209|sp|P24603|OPSD_LOLFO (RecName: Full=Rhodopsin [Loligo forbesii])

HSP 1 Score: 302.368 bits (773), Expect = 1.12298e-95
Identity = 168/381 (44.09%), Postives = 250/381 (65.62%), Query Frame = 1
Query:   34 LGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQ---SKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSEKESS 1167
+G+ I +N T W ++P + +HP+W+ FD VP +Y +G++I+I GI G +GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFPL+TIS F W +G C++YG IGG+FG +SI TM +IS+DRY VI +P K ++ ++A IM++FVW++S IW+ P FG+G Y EG +C+FDY+T+ ++ NI + MYI F+ P+ I FCY+ IV +V HE EM MA+++NA + GA A+++ AKISI+IV +L+SW+PYA++AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR ++ FP ++ CC KE + A A P+ QS E++
Sbjct: 1 MGRDIPDNET----------WWYNPYMD--IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNI---LCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-NAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQSGGETA 365
BLAST of opsin-like vs. uniprot
Match: gi|3024254|sp|O15973|OPSD1_MIZYE (RecName: Full=Rhodopsin, GQ-coupled; AltName: Full=GQ-rhodopsin [Mizuhopecten yessoensis])

HSP 1 Score: 303.523 bits (776), Expect = 1.82872e-95
Identity = 148/317 (46.69%), Postives = 230/317 (72.56%), Query Frame = 1
Query:  100 WDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1050
W+ ++ VH +W F V E +HY++GVYI+IVG+ G++GN V+YIF++ KSLR+P N+F+++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+ IS+DRY VI +P Q +++T ++ +M+V VW+ S++ S PPFFG+G Y+PEGFQTSCTFDYLT++ + + +Y+ F+IP+ I CY I++ VR H+ +ML + + M + A +++++ +KI++ + L++ISW+PYAIIAL+A G + P +ELP++ AK+S+M+NP +YA++HPKFR L
Sbjct: 28 WEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRA-RSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITPLVSELPMMLAKSSSMHNPVVYALSHPKFRKAL 343
BLAST of opsin-like vs. uniprot
Match: gi|2499376|sp|Q17094|OPSD_ALLSU (RecName: Full=Rhodopsin, partial [Alloteuthis subulata])

HSP 1 Score: 296.204 bits (757), Expect = 1.98962e-93
Identity = 163/357 (45.66%), Postives = 234/357 (65.55%), Query Frame = 1
Query:   94 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSEKES 1164
W ++P + +H +W+ FD VP +Y +G++I+I GI G GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFP++TIS F W +G+ C++YG IGG+FG SI TM +IS+DRY VI +P K ++ ++A IM+VFVW++S IW+ P FG+G Y EG +C+FDY+T+ + MYI F+ P+ I FCY+ IV +V HE EM MA+++NA + GA A+++ AKISI+IV L+SW+PYAI+AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + FP ++ CC KE + A A P+ QS ES
Sbjct: 4 WWYNPYMD--IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGES 357
BLAST of opsin-like vs. uniprot
Match: gi|3024292|sp|O16005|OPSD_SEPOF (RecName: Full=Rhodopsin [Sepia officinalis])

HSP 1 Score: 285.804 bits (730), Expect = 5.14723e-89
Identity = 171/378 (45.24%), Postives = 247/378 (65.34%), Query Frame = 1
Query:   34 LGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSEKESS 1167
+G+ I +N T W ++P E VHP+W+ F+ VP+ +Y +G++I I GI G GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFPL+TIS F +W +G C++YGFIGG+FG +SI TM++IS+DRY VI +P K ++ +RA +M++FVW++S +WS P FG+G YV EG +C+FDY+T+ + MYI F P+ I FCY+ IV AV HE EM MA+++NA + GA A+++ AKISI+IV +L+SW+PYA++AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + + FP +I CC KE + A P+ QS ES+
Sbjct: 1 MGRDIPDNET----------WWYNPTME--VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQSGGESA 365
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17137098|ref|NP_477096.1| (rhodopsin 5, isoform A [Drosophila melanogaster])

HSP 1 Score: 200.29 bits (508), Expect = 2.01455e-58
Identity = 118/343 (34.40%), Postives = 202/343 (58.89%), Query Frame = 1
Query:   37 GQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYIS--IVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-YGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1053
G + N + + S+ + E++ +VH +WR F P YH G YI+ ++ ++ + GN LV++IF+++KSLRTP N+ I++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DRY I+ P L+ + +++++F WL++ +S P F +G Y PEGF T+C+FDYLT + N +F +++ ++VIP+ I+ YY++ VRVHE + + A+KMN S + +++ AK ++II L++++WTPY+++AL+ G + + P+ + LP L K+ + +P++YA +HPK+R++LE
Sbjct: 8 GPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|665407712|ref|NP_001285859.1| (rhodopsin 5, isoform B [Drosophila melanogaster])

HSP 1 Score: 200.29 bits (508), Expect = 2.01455e-58
Identity = 118/343 (34.40%), Postives = 202/343 (58.89%), Query Frame = 1
Query:   37 GQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYIS--IVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-YGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1053
G + N + + S+ + E++ +VH +WR F P YH G YI+ ++ ++ + GN LV++IF+++KSLRTP N+ I++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DRY I+ P L+ + +++++F WL++ +S P F +G Y PEGF T+C+FDYLT + N +F +++ ++VIP+ I+ YY++ VRVHE + + A+KMN S + +++ AK ++II L++++WTPY+++AL+ G + + P+ + LP L K+ + +P++YA +HPK+R++LE
Sbjct: 8 GPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738051|ref|NP_524407.1| (neither inactivation nor afterpotential E [Drosophila melanogaster])

HSP 1 Score: 198.749 bits (504), Expect = 6.80587e-58
Identity = 121/343 (35.28%), Postives = 192/343 (55.98%), Query Frame = 1
Query:  106 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK 1134
P+ ++ PYW F + ++ ++ Y+ ++G+ GN +V+YIFA+ KSLRTP N+ +++LAI D N P++ I+ + W G + C+IY +G FG SI +M +ISLDRY VI + + +TI A+ + ++W S IW P FG+ YVPEG TSC DYL + + I I + IP+ I + Y+ I+ AV HE M + A+KMN S + K A+ + AK++++ + L+ ++WTPY +I M L + + L P FAK++A YNP +Y I+HPK+R+ L++K PC + K D S A+A++
Sbjct: 29 PDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLF-KFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASE 368
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17136434|ref|NP_476701.1| (rhodopsin 4 [Drosophila melanogaster])

HSP 1 Score: 197.978 bits (502), Expect = 1.33386e-57
Identity = 115/336 (34.23%), Postives = 190/336 (56.55%), Query Frame = 1
Query:   52 ENSTADNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGY-GNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1053
E ++ N L W+ P+ + +W T P HY++GV+ + A +GN +V++IF+++KSLRTP NMF+++LA+ DL P+ +SF+ +A G C+I+ IG G + T A I DRY VI +P +++T +A+IM + +WLY W P + +VPEG+ TSC+FDYL+ + +F ++ +FV P I++ Y QIV V HE + + A+KMN S +++ + A+++ AK +I I FL+ +SWTPY +++L+ G + L P +P K A +PF+YAI+HP++R++L+
Sbjct: 15 EARSSGNGDLQFLGWNVPPDQIQYIPEHWLTQLEPPASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKA--PIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMN--RNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQ 346
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738059|ref|NP_524411.1| (rhodopsin 3 [Drosophila melanogaster])

HSP 1 Score: 195.667 bits (496), Expect = 1.40268e-56
Identity = 114/322 (35.40%), Postives = 186/322 (57.76%), Query Frame = 1
Query:   94 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFF-GYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1053
W+ PE + +W T+ PE +YL+G + +LGN LV+++F++AKSLRTP N+ +++LA D F + P+ +SF+ +A G L C+I+G IG G + T A I+ DR+ VI +P + +T +AI M++F+++Y+ W + +G +VPEG+ TSCTFDYLT + +F ++ +FV P I + Y QIV V HE + A+KMN S +++ + A+++ AK +I I FL+ SWTPY +++L+ G + L P +P K A +PF+YAI+HP++R++L+
Sbjct: 33 WNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCD--FMMMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPME--GKMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQ 350
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15026624 (SmedSxldir_c84693_g1_i1|m.24953|m.19106)

HSP 1 Score: 749.969 bits (1935), Expect = 0
Identity = 392/423 (92.67%), Postives = 408/423 (96.45%), Query Frame = 1
Query:    4 LFMNLHSLVGLGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQATETSKVQATSGHTNDAYENEQK* 1272
+FM++ S LG K+LEN+T +N SL+KS WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGI+GVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFN RWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNF+IPVG IIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKIS+IIVFLY++SWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSE+ESSMSQLD EDDKQ ET+K Q TSGHTN+AYE+EQK*
Sbjct: 11 IFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK* 433
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15032968 (SmedSxlregen_c81464_g11_i1|m.21191|m.10162)

HSP 1 Score: 149.058 bits (375), Expect = 5.33727e-40
Identity = 106/346 (30.64%), Postives = 174/346 (50.29%), Query Frame = 1
Query:  157 PEVYHY-LVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK--PSKYQSEKESSMS 1173
PE + Y + GVYI +G+ G + N V+ +F +K L TP N+F+ L D + GFP L +SSF W + C +Y F + G SI + +I+++R+ + P QT+K++T+KR+I ++ W +I S PP G+ YV EG Q SC+FD QSK I+ + IG F++ + II CY +I VR EM + K S + K + + + + +++SW PYA++ ++AL + + +P FAK+ + NP IY +N+P+F+ +L K L K + + T + ++ T+ PS Q+ S
Sbjct: 15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIM----LLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTK---SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQGTS 352
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15028515 (SmedSxldir_c96785_g1_i5|m.39594|m.45818)

HSP 1 Score: 145.976 bits (367), Expect = 1.11671e-38
Identity = 93/300 (31.00%), Postives = 159/300 (53.00%), Query Frame = 1
Query:  157 PEVY-HYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKI---SIIIVFLYLISWTPYAIIALMALTGRRDHLNPY-TAELPVLFAKTSAMYNPFIYAINHP 1032
PE Y +Y + YI ++GI G N+LV+ +F +KS+ TP N+FI LA+ DL + GFP LTIS F W + + C Y F + G SI + +++++R VI++P + +K ++ KR+ ++++ W +++ S PP G+ YV EG SC++D +SK I+F IG+ F++ + IIFCY + L++ + A M S A++ + K+ I +++SW PYA++ ++++ + N P FAK+ +YNP IY ++P
Sbjct: 19 PETYVYYALASYILVIGIIGTAENMLVMLVFIRSKSMWTPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGI----FLVVLLIIIFCYLALF-------LKVQRQATSMRVMIKDSRDLLAERERQRENKLIWMGCNITLAFVLSWGPYALVTILSIFKVLNEKNSLIIVTFPSFFAKSFTIYNPIIYIFSYP 306
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15030838 (SmedSxlregen_c54053_g1_i1|m.6668|m.37854)

HSP 1 Score: 114.775 bits (286), Expect = 2.572e-28
Identity = 77/295 (26.10%), Postives = 156/295 (52.88%), Query Frame = 1
Query:  160 EVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIM-LVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1041
+V++Y + IS I GVL N +++ F ++L++P N+ IM++ I + A+ G P+ +SSF W + + C YGF G S+ M +I++DR+FVIA+P TM + K I + + +YSLI++ PP G+ Y + +TSC+ ++ ++ + I + + ++IP+ ++CY+ I +R +++ + +++ +K + + ++I + + I+WTPYA+I + G + P ++AK++ + PF++ +++ +FR
Sbjct: 10 KVFYYSKAIVISFFLIFGVLLNGTIMFTFFHNRALKSPTNLLIMAIIINNFLL-AIFGIPMDIVSSFYQYWIFSDVGCRFYGFAMFFTGLNSVAIMTVIAIDRFFVIAKP--TMAAHITKNVIYLSICGCLVYSLIFTIPPLIGWNEYKLDKSKTSCSVNFESRDPIFYSYTIVILVFCYIIPIIVNLYCYFYIYMTIR-------HISRNTKVTTDNAVEQN-RKIERKLLTVAIAVFVSFFIAWTPYAVICTWTVFGDPSVIPLIVYTTPSVWAKSTVVVYPFVFVLSNQQFR 293
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15010993 (SmedAsxldir_c46418_g1_i1|m.8227|m.22320)

HSP 1 Score: 103.219 bits (256), Expect = 5.27857e-24
Identity = 94/313 (30.03%), Postives = 158/313 (50.48%), Query Frame = 1
Query:  175 LVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNG-FPLLTISSFNHRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYG----NYVPEGFQTSCTFDYLT--QSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAVR-----VHELEMLKMAQKMNASHPTSMKTGAKKADVQAAK------ISIIIVFLYLISWTPYAIIALMA---LTGRRDHLNPYTAELP---VLFAKTSAMYNPFIYAINHPKFR 1041
LV YI+++ I G LG+ LV+Y+ +K+LRTP NMFI++LAI DL A + F ++ + SF+ W +G+ C++ G G +S ++ I+LDRY VI P T SL + AI +++ +W+ SLI ++P G N + T CT + K + ++I + +VIP+ + Y +I + ++ +H+ + L+ + + SH + T +K D+Q + +SI IVF ISW P +I ++ L + P + + +L TSA NP +Y + FR
Sbjct: 61 LVLSYIAMIVI-GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKAN-HTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNLHKKD-LESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVF--AISWLPLNLINMIMDLYLMYNESTVGPMSLRIQSICLLMVLTSACTNPILYGWLNDNFR 366
The following BLAST results are available for this feature:
BLAST of opsin-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|15150803|ref|NP_150598.1|3.405030e-5939.74melanopsin isoform 1 [Homo sapiens][more]
gi|71999143|ref|NP_001025186.1|1.694960e-5638.66melanopsin isoform 2 [Homo sapiens][more]
gi|38678524|ref|NP_859528.1|6.053000e-4335.86opsin-5 [Homo sapiens][more]
gi|767939382|ref|XP_011512650.1|8.004120e-4231.23PREDICTED: opsin-5 isoform X2 [Homo sapiens][more]
gi|767939384|ref|XP_011512651.1|8.004120e-4231.23PREDICTED: opsin-5 isoform X2 [Homo sapiens][more]
back to top
BLAST of opsin-like vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|129211|sp|P09241|OPSD_ENTDO9.909890e-10448.62RecName: Full=Rhodopsin [Enteroctopus dofleini][more]
gi|129209|sp|P24603|OPSD_LOLFO1.122980e-9544.09RecName: Full=Rhodopsin [Loligo forbesii][more]
gi|3024254|sp|O15973|OPSD1_MIZYE1.828720e-9546.69RecName: Full=Rhodopsin, GQ-coupled; AltName: Full... [more]
gi|2499376|sp|Q17094|OPSD_ALLSU1.989620e-9345.66RecName: Full=Rhodopsin, partial [Alloteuthis subu... [more]
gi|3024292|sp|O16005|OPSD_SEPOF5.147230e-8945.24RecName: Full=Rhodopsin [Sepia officinalis][more]
back to top
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17137098|ref|NP_477096.1|2.014550e-5834.40rhodopsin 5, isoform A [Drosophila melanogaster][more]
gi|665407712|ref|NP_001285859.1|2.014550e-5834.40rhodopsin 5, isoform B [Drosophila melanogaster][more]
gi|17738051|ref|NP_524407.1|6.805870e-5835.28neither inactivation nor afterpotential E [Drosoph... [more]
gi|17136434|ref|NP_476701.1|1.333860e-5734.23rhodopsin 4 [Drosophila melanogaster][more]
gi|17738059|ref|NP_524411.1|1.402680e-5635.40rhodopsin 3 [Drosophila melanogaster][more]
back to top
BLAST of opsin-like vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150266240.000000e+092.67SmedSxldir_c84693_g1_i1|m.24953|m.19106[more]
SMU150329685.337270e-4030.64SmedSxlregen_c81464_g11_i1|m.21191|m.10162[more]
SMU150285151.116710e-3831.00SmedSxldir_c96785_g1_i5|m.39594|m.45818[more]
SMU150308382.572000e-2826.10SmedSxlregen_c54053_g1_i1|m.6668|m.37854[more]
SMU150109935.278570e-2430.03SmedAsxldir_c46418_g1_i1|m.8227|m.22320[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_022660 ID=Gsp_022660|Name=opsin-like|organism=Girardia sp.|type=mRNA|length=1377bp
GTCTTATTTATGAATCTTCATTCTTTAGTTGGTTTGGGACAGAAAATCCT
TGAAAATTCAACAGCTGATAATGCCTCACTCAGTAAATCACCATGGCATT
GGGATCCTGAATTTGAATCGATTGTTCATCCATATTGGAGAACTTTTGAT
ATGGTTCCTGAAGTGTATCATTATTTAGTTGGAGTATACATCTCTATAGT
TGGAATAGCGGGTGTTCTAGGAAATCTACTCGTTCTTTATATATTTGCTA
GTGCAAAAAGTTTGAGAACACCACCGAATATGTTTATTATGAGTTTAGCT
ATTGGAGATTTGACATTCTCAGCTGTCAATGGATTCCCATTATTGACAAT
ATCGAGTTTTAATCATCGATGGGCATGGGGAAAATTAACATGTGAAATTT
ATGGATTTATTGGAGGACTTTTTGGTTTTATATCGATTAATACTATGGCT
CTCATTTCTTTGGACAGATATTTTGTAATAGCTCAACCGTTTCAAACCAT
GAAATCTTTGACTATTAAAAGAGCAATTATTATGTTGGTTTTCGTTTGGC
TTTATTCTTTGATCTGGTCAACTCCACCATTTTTTGGTTATGGAAATTAT
GTACCAGAAGGATTTCAAACTTCTTGTACTTTTGACTATTTGACACAATC
CAAAGGAAACATCATTTTTAATATTGGAATGTATATCGGAAATTTTGTGA
TTCCAGTTGGAACAATTATTTTTTGCTATTATCAAATCGTAAAAGCCGTT
AGAGTTCACGAATTAGAAATGTTGAAAATGGCCCAGAAAATGAATGCTTC
ACATCCGACATCAATGAAAACTGGAGCCAAAAAAGCAGATGTTCAAGCTG
CCAAAATTTCCATAATAATAGTGTTTTTATATTTAATTTCATGGACTCCT
TATGCGATAATTGCATTGATGGCTCTCACTGGTAGACGGGATCATTTGAA
TCCATACACTGCTGAATTACCGGTGCTCTTTGCAAAAACATCAGCTATGT
ACAATCCATTTATTTATGCTATCAATCATCCGAAATTTAGAATCCAATTG
GAGAAAAAATTCCCATGCTTAATATGCTGTTGTCCACCTAAACCAAAAGA
GAGAGATACAACGAGTGCTGCATCAGCAACAAAACCAAGTAAATATCAAA
GTGAGAAGGAAAGTTCTATGTCACAATTAGATTCTGAGGACGATAAACAA
GCAACTGAAACAAGTAAAGTACAAGCAACTAGTGGACATACAAATGATGC
TTATGAAAACGAACAAAAATAGTTAAATAAAAATTATTAAATTTTATTGA
CACTAGATATTTTATTTTTATTACACTTTGAGAATGAGCACTGAAATAGG
CGTAAATATGTTTGTTTCAATGTTTTA

Design Primers for opsin-like

back to top

protein sequence

>Gsp_022660-protein ID=Gsp_022660-protein|Name=opsin-like|organism=Girardia sp.|type=polypeptide|length=424bp
VLFMNLHSLVGLGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFD
MVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLA
IGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMA
LISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNY
VPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAV
RVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTP
YAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL
EKKFPCLICCCPPKPKERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQ
ATETSKVQATSGHTNDAYENEQK*
back to top

coding sequence

>Gsp_022660.1.1272 ID=Gsp_022660.1.1272|Name=Gsp_022660.1.1272|organism=Girardia sp.|type=CDS|length=1272bp
GTCTTATTTATGAATCTTCATTCTTTAGTTGGTTTGGGACAGAAAATCCT
TGAAAATTCAACAGCTGATAATGCCTCACTCAGTAAATCACCATGGCATT
GGGATCCTGAATTTGAATCGATTGTTCATCCATATTGGAGAACTTTTGAT
ATGGTTCCTGAAGTGTATCATTATTTAGTTGGAGTATACATCTCTATAGT
TGGAATAGCGGGTGTTCTAGGAAATCTACTCGTTCTTTATATATTTGCTA
GTGCAAAAAGTTTGAGAACACCACCGAATATGTTTATTATGAGTTTAGCT
ATTGGAGATTTGACATTCTCAGCTGTCAATGGATTCCCATTATTGACAAT
ATCGAGTTTTAATCATCGATGGGCATGGGGAAAATTAACATGTGAAATTT
ATGGATTTATTGGAGGACTTTTTGGTTTTATATCGATTAATACTATGGCT
CTCATTTCTTTGGACAGATATTTTGTAATAGCTCAACCGTTTCAAACCAT
GAAATCTTTGACTATTAAAAGAGCAATTATTATGTTGGTTTTCGTTTGGC
TTTATTCTTTGATCTGGTCAACTCCACCATTTTTTGGTTATGGAAATTAT
GTACCAGAAGGATTTCAAACTTCTTGTACTTTTGACTATTTGACACAATC
CAAAGGAAACATCATTTTTAATATTGGAATGTATATCGGAAATTTTGTGA
TTCCAGTTGGAACAATTATTTTTTGCTATTATCAAATCGTAAAAGCCGTT
AGAGTTCACGAATTAGAAATGTTGAAAATGGCCCAGAAAATGAATGCTTC
ACATCCGACATCAATGAAAACTGGAGCCAAAAAAGCAGATGTTCAAGCTG
CCAAAATTTCCATAATAATAGTGTTTTTATATTTAATTTCATGGACTCCT
TATGCGATAATTGCATTGATGGCTCTCACTGGTAGACGGGATCATTTGAA
TCCATACACTGCTGAATTACCGGTGCTCTTTGCAAAAACATCAGCTATGT
ACAATCCATTTATTTATGCTATCAATCATCCGAAATTTAGAATCCAATTG
GAGAAAAAATTCCCATGCTTAATATGCTGTTGTCCACCTAAACCAAAAGA
GAGAGATACAACGAGTGCTGCATCAGCAACAAAACCAAGTAAATATCAAA
GTGAGAAGGAAAGTTCTATGTCACAATTAGATTCTGAGGACGATAAACAA
GCAACTGAAACAAGTAAAGTACAAGCAACTAGTGGACATACAAATGATGC
TTATGAAAACGAACAAAAATAG
back to top
Gene Groups
opsin-like is similar in sequence to the genes of this group: GG7488
Gene NameGene ID
SMU15026624SMU15026624
opsin-likeDdo_008381
opsin-likeGsp_022660
opsin-likePgr_015173
opsin-likePmo_026986

Gene Group Protein Sequences

>SMU15026624

MILYLTLKIFIFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESI
VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTP
PNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLF
GFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWST
PPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIF
CYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIV
FLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI
NHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMS
QLDPEDDKQVVETTKNQTTSGHTNEAYESEQK*
>Ddo_008381 opsin-like
LQMSVQSFLSIGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPE
VYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDL
TFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISL
DRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEG
FQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHE
LEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVI
ALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKF
PCLICCCPPKPKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVET
NKGQAASGHTNEAYESEK*
>Gsp_022660 opsin-like
VLFMNLHSLVGLGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFD
MVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLA
IGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMA
LISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNY
VPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAV
RVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTP
YAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL
EKKFPCLICCCPPKPKERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQ
ATETSKVQATSGHTNDAYENEQK*
>Pgr_015173 opsin-like
LSIAGDMSLQYANTIGPGMFSNSTVNVSATTAPWHWDHEFESIVHPYWRQ
FDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMS
LAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINT
MALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFG
HYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVK
AVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSW
TPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRL
QLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESSMSQLDSDGP
QKQDEGKNAGKTNPAYEDGEK*
>Pmo_026986 opsin-like
MSNCLQYGWTIASNSWSQCHGAMVTVLLTVLFEYIMMYSNSTVNSTVTIA
PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLY
IFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLT
CEIYGFIGGLFGFISINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLV
GVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIC
NFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD
I

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.