ifb, Gsp_021856 (mRNA) Girardia sp.

Overview
Nameifb
Unique NameGsp_021856
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1951
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of ifb vs. RefSeq Human
Match: gi|768004479|ref|XP_011526680.1| (PREDICTED: lamin-B2 isoform X1 [Homo sapiens])

HSP 1 Score: 147.132 bits (370), Expect = 1.24417e-36
Identity = 165/587 (28.11%), Postives = 278/587 (47.36%), Query Frame = 1
Query:  163 GVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQE--------------AQMELNDATQL-HSADKETIDKMSSTLAD---YEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIF-----ESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRK-------ELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDL-------MDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAEC---SESNWGYGAQIVTTLQNSKGEEKATHT 1803
G ATP + + + R +EK EL+ELNDR A+YID+VR+LE EN RL ++++ ++ +E + IKALY+S+++ RR LD+ +A+L+++I L + E AQ + D L H ++ E +++ L+D E ++ LR +L+ K D + KK L+KETL + N QSL ++++F K +F E+ R LV DSS +++ +MAQAL +++S++D+++ ++E Y K+ + + + + REE L + R RL L + S L++ I E E+ RK E+ + ++ L E Q LLD KL+L++EI AYRK+LEGEE R+ + SS + ++A + + R + ++ S + + + G + Q +A G+V+I+E +GKF+ L+N +D+ + + + R G I + +PK IL + +WA G S + +S+WG G T L N+ GEE A T
Sbjct: 30 GGPATPLSPTRL----------SRLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVE----LAAALSDKRGLESDVAELRAQLA-----KAEDGHAVA---------KKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEY-DFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREE-------LKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIA-YKFTPKYILRA---GQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRT 576
BLAST of ifb vs. RefSeq Human
Match: gi|388240801|ref|NP_116126.3| (lamin-B2 [Homo sapiens])

HSP 1 Score: 146.747 bits (369), Expect = 2.11121e-36
Identity = 165/587 (28.11%), Postives = 278/587 (47.36%), Query Frame = 1
Query:  163 GVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQE--------------AQMELNDATQL-HSADKETIDKMSSTLAD---YEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIF-----ESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRK-------ELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDL-------MDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAEC---SESNWGYGAQIVTTLQNSKGEEKATHT 1803
G ATP + + + R +EK EL+ELNDR A+YID+VR+LE EN RL ++++ ++ +E + IKALY+S+++ RR LD+ +A+L+++I L + E AQ + D L H ++ E +++ L+D E ++ LR +L+ K D + KK L+KETL + N QSL ++++F K +F E+ R LV DSS +++ +MAQAL +++S++D+++ ++E Y K+ + + + + REE L + R RL L + S L++ I E E+ RK E+ + ++ L E Q LLD KL+L++EI AYRK+LEGEE R+ + SS + ++A + + R + ++ S + + + G + Q +A G+V+I+E +GKF+ L+N +D+ + + + R G I + +PK IL + +WA G S + +S+WG G T L N+ GEE A T
Sbjct: 30 GGPATPLSPTRL----------SRLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVE----LAAALSDKRGLESDVAELRAQLA-----KAEDGHAVA---------KKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEY-DFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREE-------LKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIA-YKFTPKYILR---AGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRT 576
BLAST of ifb vs. RefSeq Human
Match: gi|5031875|ref|NP_005563.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 143.28 bits (360), Expect = 2.33148e-35
Identity = 155/577 (26.86%), Postives = 280/577 (48.53%), Query Frame = 1
Query:  166 VSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQE--------------AQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIREL-----AALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR---------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAK--GNVTIQECSADGKFIILENTGSQDEDISGYILNR-NTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAEC---SESNWGYGAQIVTTLQNSKGEEKA 1794
S+TP + + I R +EK +LQELNDR A YID+VRSLE EN L + + ++ +E + IKA Y++++ R++LD +A+L+++++ + + +E AQ L D L ++ + + S E E+ +LR +++ LE L + KK L E L + A N +Q++ ++++F K I+ E+RE LV D+ + ++F + +A AL++++++++ ++E ++E Y+ K+ R + E ++ ++R ++ L QL+ ++ +L EA+ +LE L R E + E A +R + + L E Q LLD KL+L++EI AYRK+LEGEE R+ + +S S +A + SS +Q + + K ++ S +++SF + A+ G V ++E +GKF+ L N ++D+ + + + R N D+ ++ + PK L+ + IWA G S + +++ WG G + T L NS GEE A
Sbjct: 16 ASSTPLSPTRIT----------RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS--LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQ-------LDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRAS---------SHSSQTQGGGSVTKKRKLEST-----ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063466|ref|NP_001269554.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 143.28 bits (360), Expect = 2.33148e-35
Identity = 155/577 (26.86%), Postives = 280/577 (48.53%), Query Frame = 1
Query:  166 VSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQE--------------AQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIREL-----AALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR---------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAK--GNVTIQECSADGKFIILENTGSQDEDISGYILNR-NTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAEC---SESNWGYGAQIVTTLQNSKGEEKA 1794
S+TP + + I R +EK +LQELNDR A YID+VRSLE EN L + + ++ +E + IKA Y++++ R++LD +A+L+++++ + + +E AQ L D L ++ + + S E E+ +LR +++ LE L + KK L E L + A N +Q++ ++++F K I+ E+RE LV D+ + ++F + +A AL++++++++ ++E ++E Y+ K+ R + E ++ ++R ++ L QL+ ++ +L EA+ +LE L R E + E A +R + + L E Q LLD KL+L++EI AYRK+LEGEE R+ + +S S +A + SS +Q + + K ++ S +++SF + A+ G V ++E +GKF+ L N ++D+ + + + R N D+ ++ + PK L+ + IWA G S + +++ WG G + T L NS GEE A
Sbjct: 16 ASSTPLSPTRIT----------RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS--LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQ-------LDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRAS---------SHSSQTQGGGSVTKKRKLEST-----ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063468|ref|NP_001269555.1| (lamin isoform A-delta50 [Homo sapiens])

HSP 1 Score: 143.28 bits (360), Expect = 2.75149e-35
Identity = 155/577 (26.86%), Postives = 280/577 (48.53%), Query Frame = 1
Query:  166 VSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQE--------------AQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIREL-----AALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR---------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAK--GNVTIQECSADGKFIILENTGSQDEDISGYILNR-NTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAEC---SESNWGYGAQIVTTLQNSKGEEKA 1794
S+TP + + I R +EK +LQELNDR A YID+VRSLE EN L + + ++ +E + IKA Y++++ R++LD +A+L+++++ + + +E AQ L D L ++ + + S E E+ +LR +++ LE L + KK L E L + A N +Q++ ++++F K I+ E+RE LV D+ + ++F + +A AL++++++++ ++E ++E Y+ K+ R + E ++ ++R ++ L QL+ ++ +L EA+ +LE L R E + E A +R + + L E Q LLD KL+L++EI AYRK+LEGEE R+ + +S S +A + SS +Q + + K ++ S +++SF + A+ G V ++E +GKF+ L N ++D+ + + + R N D+ ++ + PK L+ + IWA G S + +++ WG G + T L NS GEE A
Sbjct: 16 ASSTPLSPTRIT----------RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS--LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQ-------LDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRAS---------SHSSQTQGGGSVTKKRKLEST-----ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. uniprot
Match: gi|266617|sp|Q01241|NF70_DORPE (RecName: Full=70 kDa neurofilament protein; Short=NF70 [Doryteuthis pealeii])

HSP 1 Score: 379.022 bits (972), Expect = 1.15105e-120
Identity = 248/599 (41.40%), Postives = 390/599 (65.11%), Query Frame = 1
Query:   40 ANIQP-ISGYRNVVITRTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSS-ESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVT-SIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECSESN--WGYGAQIVTTLQNSKGEEKATHTQRTVYQ 1821
A I P SGY N + P S+ G+ NA+ R+ + SYG +A PG +NI +GVN++ RE+EK ++++LN+RFANYI+KVR LE +NK+L EL +LK +WGKET+ IK +Y++++ + R+ +D K L++++ L D ++ Q +L ++ H D+E I + + LAD E EI LR+ + SLE+EK+R + + ++ +E+ +++ DL+ ET+ H+ A N Q+L +++EF K + E++ELAAL Y+D++ E+++FWRNE+AQA+RDIQ EYD K + + D+EA Y LK+QE RT +K+N+E + +EENT+LK + ++RNRL +LEARN++LER + L R++EEK+R+ ++E ++E+ + E+ESIL ELQ L+D KLSLELEI AYRK+LEGEE RV K + V L +TRS + S Q++ +++GE++AKT++QRT+KG+V+I+E + G FI LE ++E+++G+ + R D+ ++ + P +L+ TG KIW++ ++ Q D S N WG G+ +VT LQN KGE+KA +TQ TVYQ
Sbjct: 33 AKIHPRTSGYINR--SSQSPFRSSMGS-NAAYTRSYDF--SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEV-LSTILTRSEGGYEATGDS---QISMKMMRGELAAKTTYQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVDDNKVYTYEI--PNLVLK-TGT--VVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNTVYQ 615
BLAST of ifb vs. uniprot
Match: gi|124235|sp|P23731|IFEB_ASCSU (RecName: Full=Intermediate filament protein B; Short=IF-B [Ascaris suum])

HSP 1 Score: 316.235 bits (809), Expect = 5.75788e-97
Identity = 216/600 (36.00%), Postives = 354/600 (59.00%), Query Frame = 1
Query:   40 ANIQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRS-SISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTG-SQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGS--NDAEC----SESNWGYGAQIVTTLQNSKGEEKATHTQRTV 1815
+ IQP + R +R A ST G + R ++M G ++ G + + + + + +KEK E+Q LNDR NYID+V+ LE++N++L +L++L+ +WGK+T+ IK Y + R+ +D KA++++K+ L D + E + D +D+E I++ + D + E+ LR R L EE+ R N + R+ EEL + + DLD+ETL I N+VQ+L++++EFL+++ E E++EL AL+ + +++++F++NE+A A+RDI+ EYD + DME+ Y LK+ E++ + ++ N+E+ REE R++D + D+R +L +LEA+N+ LE+ ++ L ++ + R+++ + L + E ++++ ELQ LLD K L+ EI YRKMLEGEE RV + +++ V ++ S+ QQ+ ST+ V+GE+S KT+FQR+AKGNVTI EC +GKFI LENT S+DE++ + L R DN R IV + I P T+L+ R KI+AR QG N + E+ WG GA +VT+L N G+E+ATHTQ+T+
Sbjct: 17 STIQPRTAVRTQ--SRQSGAYST-GAVSGGGGRVLKMVTEMGSASIGGISPALSANAAKSFLEATDKEKKEMQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGRWGKDTSEIKIQYSDSLRDARKEIDDGARRKAEIDVKVARLRDDLAELRNRYEDVQHRRESDREKINQWQHAIEDAQSELEMLRARWRQLTEEEKRLNGDNARIWEELQKARNDLDEETLGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDYIAKQGKQDMESWYKLKVSEVQGSANRANMESSYQREEVKRMRDNIGDLRGKLGDLEAKNALLEKEVQNLNYQLNDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEESRVGLRQ----------------MVEQVVKTHSLQQQEDTDSTRN-----VRGEVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRSKDENLGEHRLKRKLDNRREIV-YTIPPNTVLKA---GRTMKIYAR---DQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|46576384|sp|Q19289|IFB1_CAEEL (RecName: Full=Intermediate filament protein ifb-1; AltName: Full=Cel IF B1; AltName: Full=Intermediate filament protein B1; Short=IF-B1)

HSP 1 Score: 303.523 bits (776), Expect = 3.91463e-92
Identity = 211/601 (35.11%), Postives = 349/601 (58.07%), Query Frame = 1
Query:   64 YRNVVITRTGPAVSTTGNQNASSV----------RTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTG-SQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGS--NDAEC----SESNWGYGAQIVTTLQNSKGEEKATHTQRTV 1815
YR+ + RT AV + Q+ + V R ++M G + G + + + + + +KEK LQ LNDR NYID+V+ LE++N++L +L++L+ +WGK+T+ IK Y +S R+ +D A KA++++K+ D + E + D Q +D+E I + ++ +AD + E+ LR R L +E+ R + R+ EEL + + DLD ET+ I N+VQ+L++++EFL+++ E E++EL AL+ + +++++F++NE+A A+RDI+ EYD + DME+ Y LK+ E++ + ++ N+E+ R+E R++D + D+R +L +LE +NS LE+ ++ L ++ + R+++ + L + E ++++ ELQ LLD K L+ EI YRKMLEGEE RV + + V S+ QQ+ ST++ V+GE+S KT+FQR+AKGNVTI EC +GKFI LEN+ ++DE++ + + R D R IV + I +++P GKN I+AR QG N E E+ WG GA +VT+L N GEE+ATHTQ+T+
Sbjct: 14 YRSTIQPRT--AVRSQSRQSGNYVSGGNGAGSGGRVLKMVTEMGSATVGGISPALSANAAKSFLEATDKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEMLRARFKQLTDEEKRVTADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRVGLTQMVEQA---------------VKTHSLQQQENTDSTRS-----VRGEVSTKTTFQRSAKGNVTISECDPNGKFIKLENSHRNKDENVGEHKIRRKLDGRREIV-YSIPANVVIKP-GKN--LTIYAR---DQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|266616|sp|Q01240|NF60_DORPE (RecName: Full=60 kDa neurofilament protein; Short=NF60 [Doryteuthis pealeii])

HSP 1 Score: 295.049 bits (754), Expect = 6.87936e-90
Identity = 189/425 (44.47%), Postives = 293/425 (68.94%), Query Frame = 1
Query:   40 ANIQP-ISGYRNVVITRTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSS-ESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRK 1308
A I P SGY N + P S+ G+ NA+ R+ + SYG +A PG +NI +GVN++ RE+EK ++++LN+RFANYI+KVR LE +NK+L EL +LK +WGKET+ IK +Y++++ + R+ +D K L++++ L D ++ Q +L ++ H D+E I + + LAD E EI LR+ + SLE+EK+R + + ++ +E+ +++ DL+ ET+ H+ A N Q+L +++EF K + E++ELAAL Y+D++ E+++FWRNE+AQA+RDIQ EYD K + + D+EA Y LK+QE RT +K+N+E + +EENT+LK + ++RNRL +LEARN++LER + L R++EEK+R+ ++E ++E+ + E+ESIL ELQ L+D KLSLELEI AYRK+LEGEE RV K
Sbjct: 33 AKIHPRTSGYINR--SSQSPFRSSMGS-NAAYTRSYDF--SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMK 452
BLAST of ifb vs. uniprot
Match: gi|46576376|sp|P90901|IFA1_CAEEL (RecName: Full=Intermediate filament protein ifa-1; AltName: Full=Cel IF A1; AltName: Full=Intermediate filament protein A1; Short=IF-A1)

HSP 1 Score: 290.426 bits (742), Expect = 2.71391e-87
Identity = 211/591 (35.70%), Postives = 351/591 (59.39%), Query Frame = 1
Query:   79 ITRTGPAVS------TTGN---QNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSS-ESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRS-SISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTG-SQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAEC--SESNWGYGAQIVTTLQNSKGEEKATHTQR 1809
T T P+ TTGN Q+ EM+ G +P + + + + RE+EK E+ +LNDR A+YI+KVR LE +N++L +L+ L+ +WGK+T I+ +Y+ ++ ++ +D+ + +E ++ ++D + E + +L DAT+ D+ ID + TL++ E EI L++R++ LE+E R +E RL EL + + DLD+ETL I N+VQ+LL++I+FL+++ ++EI+EL L +D++ E+++F++NE++ A+RDI+ EYD+ DME+ Y LK+QEI+T +++N+E +EE RL+ QL+D+R +L +LE+RNS LE+ ++ L ++E+ R ++ + ++ + E +++++ELQ+LLD K +L+ EI YRKMLEGEE R K L++ V ++ +I+Q+ T T+ +VKGE +++ SFQR+AKGNV+I E S DGKFI+L+NT ++DE I + L R D R V + P+ + GK KI+AR D +E ++G G + T L N +GEE+ATH QR
Sbjct: 11 FTSTTPSARAPLGGRTTGNVTSQDRMLKIVTEMRSGAGSGLSPFG-----QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQ----------------LVEQVVKTHAITQE-----TDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENVYTL--PRDFVLRAGKT--LKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|17136290|ref|NP_476616.1| (lamin, isoform A [Drosophila melanogaster])

HSP 1 Score: 142.895 bits (359), Expect = 1.42082e-35
Identity = 165/591 (27.92%), Postives = 293/591 (49.58%), Query Frame = 1
Query:   85 RTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETI---DKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNE----MAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN--RKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSF--QRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECS----ESNWGYGAQIVTTLQNSKGEEKA 1794
R G A GN S+ R +T T++ S ++ + R EK ELQ LNDR A YID+VR+LE EN RLT E+ +D +ET IK ++++++ + RR LD +A+ E+ I L + +E + +L+ T+ + + + + ++ L + ++ RK+L+ E + KE+ RL+++ + +K+L++ETL + N +QSL +++ F +I EI E + + SE +E + Q+L++++++Y+++M+ ++++ Y KIQ ++ +N + +++E +LR R+ A++ N+ + L L + E +E D+ L KEL+ + E+ L E Q L+D K+SL+LEI AY K+L GEE R+N N ++ SF+Q+ RN TR++ S++ + + K + + + E + + +AKGNV I+E +GKF+ L N GS++ I G+ L R + + +EP G +W+ K S++ S W T L NS+GE A
Sbjct: 7 RAGTATPQPGN--TSTPRPPSAGPQPPPPSTHSQTAS---SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIE--ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDL----LEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNS------TRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769141|ref|NP_001245892.1| (lamin, isoform B [Drosophila melanogaster])

HSP 1 Score: 142.895 bits (359), Expect = 1.42082e-35
Identity = 165/591 (27.92%), Postives = 293/591 (49.58%), Query Frame = 1
Query:   85 RTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETI---DKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNE----MAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN--RKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSF--QRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECS----ESNWGYGAQIVTTLQNSKGEEKA 1794
R G A GN S+ R +T T++ S ++ + R EK ELQ LNDR A YID+VR+LE EN RLT E+ +D +ET IK ++++++ + RR LD +A+ E+ I L + +E + +L+ T+ + + + + ++ L + ++ RK+L+ E + KE+ RL+++ + +K+L++ETL + N +QSL +++ F +I EI E + + SE +E + Q+L++++++Y+++M+ ++++ Y KIQ ++ +N + +++E +LR R+ A++ N+ + L L + E +E D+ L KEL+ + E+ L E Q L+D K+SL+LEI AY K+L GEE R+N N ++ SF+Q+ RN TR++ S++ + + K + + + E + + +AKGNV I+E +GKF+ L N GS++ I G+ L R + + +EP G +W+ K S++ S W T L NS+GE A
Sbjct: 7 RAGTATPQPGN--TSTPRPPSAGPQPPPPSTHSQTAS---SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIE--ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDL----LEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNS------TRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769143|ref|NP_001245893.1| (lamin, isoform C [Drosophila melanogaster])

HSP 1 Score: 142.895 bits (359), Expect = 1.42082e-35
Identity = 165/591 (27.92%), Postives = 293/591 (49.58%), Query Frame = 1
Query:   85 RTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETI---DKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNE----MAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN--RKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSF--QRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECS----ESNWGYGAQIVTTLQNSKGEEKA 1794
R G A GN S+ R +T T++ S ++ + R EK ELQ LNDR A YID+VR+LE EN RLT E+ +D +ET IK ++++++ + RR LD +A+ E+ I L + +E + +L+ T+ + + + + ++ L + ++ RK+L+ E + KE+ RL+++ + +K+L++ETL + N +QSL +++ F +I EI E + + SE +E + Q+L++++++Y+++M+ ++++ Y KIQ ++ +N + +++E +LR R+ A++ N+ + L L + E +E D+ L KEL+ + E+ L E Q L+D K+SL+LEI AY K+L GEE R+N N ++ SF+Q+ RN TR++ S++ + + K + + + E + + +AKGNV I+E +GKF+ L N GS++ I G+ L R + + +EP G +W+ K S++ S W T L NS+GE A
Sbjct: 7 RAGTATPQPGN--TSTPRPPSAGPQPPPPSTHSQTAS---SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIE--ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDL----LEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNS------TRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|665404412|ref|NP_001285629.1| (lamin, isoform D [Drosophila melanogaster])

HSP 1 Score: 142.895 bits (359), Expect = 1.42082e-35
Identity = 165/591 (27.92%), Postives = 293/591 (49.58%), Query Frame = 1
Query:   85 RTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETI---DKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNE----MAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIR------TNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN--RKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSF--QRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECS----ESNWGYGAQIVTTLQNSKGEEKA 1794
R G A GN S+ R +T T++ S ++ + R EK ELQ LNDR A YID+VR+LE EN RLT E+ +D +ET IK ++++++ + RR LD +A+ E+ I L + +E + +L+ T+ + + + + ++ L + ++ RK+L+ E + KE+ RL+++ + +K+L++ETL + N +QSL +++ F +I EI E + + SE +E + Q+L++++++Y+++M+ ++++ Y KIQ ++ +N + +++E +LR R+ A++ N+ + L L + E +E D+ L KEL+ + E+ L E Q L+D K+SL+LEI AY K+L GEE R+N N ++ SF+Q+ RN TR++ S++ + + K + + + E + + +AKGNV I+E +GKF+ L N GS++ I G+ L R + + +EP G +W+ K S++ S W T L NS+GE A
Sbjct: 7 RAGTATPQPGN--TSTPRPPSAGPQPPPPSTHSQTAS---SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIE--ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDL----LEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNS------TRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTK--ASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|24653664|ref|NP_523742.2| (lamin C, isoform A [Drosophila melanogaster])

HSP 1 Score: 134.806 bits (338), Expect = 7.00074e-33
Identity = 157/536 (29.29%), Postives = 260/536 (48.51%), Query Frame = 1
Query:  139 TIEMKKSYGVSATP-GATSNIVHSGVNNLMN----GREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTL----EDL-------IQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSE-----SKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEK-------ANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVN--------RKNNISSSNSFNQAGRNVDLMDHVTRSSISQQ-QAAPSTKTQVTSIVKGEMSAKT----------------SFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNR 1587
T+ + S ++TP G S G + + R++EK ELQ LNDR A YID++R+LE+EN RLT ELN +D +ET+ +KA+Y+ +++ R+ LD+ KA+LE+ I L +DL +EA + N+A + E K + +LAD RK+ +E +N+ RL+ +L+ L+K L+ ETL + N+ QSL +++ F ++ E+ E + + SE S+ + ++ Q+L++++ +Y+ +M ++E Y +IQ ++ ++ + L E RL MR ++ L A+ LE L I E D E+ A+L EL + E+ L E Q L+D K+SL+LEI AY K+L GEE R+N + ISS+ S H+T S+ S+ + PS + T + G + K S AKG++ I E +G+FI L N G+++ +++G+ L R
Sbjct: 7 TLNTRVSRASTSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD--------RKKFEDQAKELALENE---RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQY-EAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRA-AQGSALATEEVRL------MRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGS------------HLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTR 511
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15011956 (SmedAsxldir_c69509_g1_i1|m.14946|m.134)

HSP 1 Score: 974.541 bits (2518), Expect = 0
Identity = 510/594 (85.86%), Postives = 556/594 (93.60%), Query Frame = 1
Query:   46 IQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATHTQRTVYQL* 1827
IQPISGYRNVVITRTGP VST G Q S++RTIEM KSYG+S+TPGATSNIVH+GVNNLMNGREKEKNELQ+LNDRFANYIDKVR+LEDENKRL+DEL DLKDQWGKETARIK YD+DM QLRRSLDQAE +KAQ+EMKINTLEDLI EAQ ELNDATQLH ADKETIDKM+STL+DYEHEI NLRKRL LEEEK+RDNKEI+RLKEELN LK+DL+KETLEHITAHNE+QSL+DQIEFLKKIFESE+RELA+LVYKDS+E+KDFWRNEMAQALRDIQ+EYD+K++ LHYDMEAQYTLKIQEIRT QS+ENVETVQLREENTR+KDQLA+MRNRLPELEARN+ELERLLELLRREIEEKNREFD+EK NLRKEL+NR++ELE ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRK+N + NQ GR+VD MDHVTR+SISQQ AAPSTKTQVTS++KGEMSAKTSFQRTAKGNVTIQECS DGKFIILENTGSQ+EDISGYIL RNTDNGRI++KHVI KTILEPTGKNRYYKIWARGN+PQGS D ECSESNWG+GAQIVT LQNSKGEEKATHTQRTVYQL*
Sbjct: 22 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSN----QNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL* 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15038947 (dd_smedV4_3871_0_1|m.24747|m.30510)

HSP 1 Score: 495.352 bits (1274), Expect = 2.25796e-167
Identity = 274/582 (47.08%), Postives = 415/582 (71.31%), Query Frame = 1
Query:   76 VITRTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDS-SESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATHTQRTVY 1818
+ +RT + T N+++ +V+ EM++SY S P S +HS V++ + GRE+EK E+Q+LN+R ANYI+KVR LE +NKRLT+ELN L+++WGKE RI+ALY+ +M QL++ LD+AEA++++L KIN LE+ + E +++A H D+E I+K++ L++ E EIG LR+R+++LEEE+ R K I RL++E+ + + DLD+ET+ HI + +EVQS D+I+F+K ++E++ELAAL Y+DS +E++DFWR+EM +LR++Q EYD+K+EA+ D+E + +K+QE+R + +E VE++ L+EEN RLK+QL+++R++ PE+EA+N++LER LE LRRE++ + +F+ E+ LR +L Q EL+SI+ E Q ++D KLSLELEI AYRK+LEGEE R +N + + G +++ + + KTQ+++++K E +AK + QRTAKGNV I E SADGKFIILENTG +DEDISG+ + RN DN R I+++ I TIL+P G+ ++ KIW++GN+P GSND ECS +NWG G I T L N EE+ATHTQ+T +
Sbjct: 1 MASRTSARSTVTINKSSPAVKEYEMRQSYNFSGAPMGGSVQIHSNVSSAVEGREREKREMQDLNERLANYIEKVRFLEAQNKRLTNELNTLRERWGKEAERIRALYEIEMDQLKKLLDEAEAARSELLPKINKLEEQLHEYLQGIDEANNQHGMDQEMIEKLNRQLSECEGEIGLLRRRIAALEEERGRSKKTISRLRDEIKRTRMDLDQETMNHIASESEVQSRKDEIDFMKDSHDNEMKELAALAYRDSTAENRDFWRSEMGSSLRELQIEYDRKLEAMRGDLENHHNVKVQELRHSSPREGVESIHLKEENIRLKNQLSNLRSKCPEMEAKNAQLERFLEELRRELDRQINDFESERDKLRSDLQRTQDELDSIMKEFQNVMDMKLSLELEIAAYRKLLEGEESRSGLRNMMEQTIFKTSGGIEGNII------------SKTAGKTQMSNLMKNERNAKVNHQRTAKGNVIIHETSADGKFIILENTGKKDEDISGFKIIRNIDNDRSIIRYEIPNSTILKPEGQQKFLKIWSKGNRPTGSNDLECSSANWGTGTHIFTALLNKSNEERATHTQKTTF 570
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15013238 (SmedAsxldir_c85434_g1_i1|m.24146|m.11304)

HSP 1 Score: 354.755 bits (909), Expect = 1.79775e-112
Identity = 225/585 (38.46%), Postives = 370/585 (63.25%), Query Frame = 1
Query:   46 IQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSS-ESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGRNVD-LMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKA 1794
+ PIS R ++I RT NQ S + I+ +Y P ++ + V N REK+K++++ LN++ A YI++VR LE +NK+ + EL++LKD+WGK+T +K Y+ +M L++ L +AE ++ + E + LE +Q+A+ ELN + + + + I+ L++ E I L+KRL LEE K +D EI++L++E+ L++DL+ +T++++ E+Q LD++EFLK+I ++++ EL+AL Y+D++ ++KDFW+ E++ A++DIQS+YD +++ L +E+QY +++Q+ +T +K +E +++EN R+K++ R+R+P+LE + LER L LR E EE R++++E ++ KEL S + I+L+ LLD KLSL+LEI AYRK+LEGEE R K++ + N+ ++ V + +I Q++ T T T GE+SAK++F RT KGNV+I EC+ DG+ IILEN G E+IS ++NR+ D+GR ++K VI KT ++ N+ KIWA+G KP G+ND E E+NWG G+ I T L N+ GEE+A
Sbjct: 46 VSPISSQRTIIINRTN-------NQVPSQI--IQRSFNYETRVIPSKSA--AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKK-VQETNTSAT----GEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERA 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15006729 (SmedAsxldir_c108652_g1_i5|m.91471|m.38848)

HSP 1 Score: 270.396 bits (690), Expect = 7.45247e-80
Identity = 213/607 (35.09%), Postives = 346/607 (57.00%), Query Frame = 1
Query:   49 QPISGYRNVV--ITRTGPAVS---TTGNQNASSVRTIEMKKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSS-ESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNN----ISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPS-----------TKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATHTQ 1806
+PIS RN + R ++S +GNQ + SV + S + +G+N++ GR +EK +LQELN+RFA+YI+K R LE++NK+L E+ +LK ++T+++K +Y+ +++QLR L+++E S+A LE+++N+LE I + Q L + + + TIDK L +E E+ L++ + + ++ E L++E+ +L+++ +KE L HIT +++QSL + +EF K+I +E++ELA + Y++ + E+ +W++EM +ALRDIQ+EY+ K+ + ++EA Y+L++QEIRT+++++NVET Q +EEN+R+K Q+ MR+R+ +LE +N+E E L +R EE R +++ NL+++L Q EL L ELQ LLDAKL LELEI AY K+LE EE RVN + +S SF + S + S T+ + T S + F+RT KGN++I E G IILEN G++ E + G + R D + IS K L K + A+G + E +++WG G +VTTL +S+G EKA H Q
Sbjct: 111 KPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVAL-----------QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLSGIKQELEASYSLQMQEIRTSKTRDNVETTQYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMSFTSSSGAGGAGGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDY----QSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRIVDGSENKISFTISGKVNLNAGEK---ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 699
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15006727 (SmedAsxldir_c108652_g1_i3|m.91469|m.23241)

HSP 1 Score: 267.314 bits (682), Expect = 2.56749e-79
Identity = 202/552 (36.59%), Postives = 323/552 (58.51%), Query Frame = 1
Query:  199 VHSGVNNLMNGREKEKNELQELNDRFANYIDKVRSLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKAQLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGNLRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSLLDQIEFLKKIFESEIRELAALVYKDSS-ESKDFWRNEMAQALRDIQSEYDKKMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRNRLPXXXXXXXXXXXXXXXXXXXXXXXXXXFDMEKANLRKELMNRXXXXXXXXXXXXXXXDAKLSLELEIIAYRKMLEGEEYRVNRKNN----ISSSNSFNQAGRNVDLMDHVTRSSISQQQAAPS-----------TKTQVTSIVKGEMSAKTSFQRTAKGNVTIQECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEPTGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATHTQ 1806
+ SGV ++ GR +EK LQELN+RFA+YI+K R LE +NK+L +E+ LK ++ ++IK +Y+ +++QLR L +E S+A LE+++++LE I + + L ++S K TIDK ++ +E E+ LR+ + + ++ +E+ L+++L +L++D +KE L H+T +E+QSL + +EF K+I ++E++ELA + Y+D + E+ +W++EM +ALRDIQ+EY+ K+ + ++EA Y L++QEIRT+++++NVET +EEN+R+K Q+ MR+R+ +LE +N+E E L +R EE R +++ NL+++L Q EL L ELQ LLDAKL LELEI AY K+LE EE RVN + +S SF + S + S T+ + T S + F+RT KGN++I E G IILEN G++ E + G + R D + IS K L K + A+G + E +++WG G +VTTL +S+G EKA H Q
Sbjct: 83 LQSGVTSMKKGRAQEKRNLQELNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMSFTSSSGAGGAGGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDY----QSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRIVDGSENKISFTISGKVNLNAGEK---ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 627
The following BLAST results are available for this feature:
BLAST of ifb vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|768004479|ref|XP_011526680.1|1.244170e-3628.11PREDICTED: lamin-B2 isoform X1 [Homo sapiens][more]
gi|388240801|ref|NP_116126.3|2.111210e-3628.11lamin-B2 [Homo sapiens][more]
gi|5031875|ref|NP_005563.1|2.331480e-3526.86lamin isoform C [Homo sapiens][more]
gi|544063466|ref|NP_001269554.1|2.331480e-3526.86lamin isoform C [Homo sapiens][more]
gi|544063468|ref|NP_001269555.1|2.751490e-3526.86lamin isoform A-delta50 [Homo sapiens][more]
back to top
BLAST of ifb vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|266617|sp|Q01241|NF70_DORPE1.151050e-12041.40RecName: Full=70 kDa neurofilament protein; Short=... [more]
gi|124235|sp|P23731|IFEB_ASCSU5.757880e-9736.00RecName: Full=Intermediate filament protein B; Sho... [more]
gi|46576384|sp|Q19289|IFB1_CAEEL3.914630e-9235.11RecName: Full=Intermediate filament protein ifb-1;... [more]
gi|266616|sp|Q01240|NF60_DORPE6.879360e-9044.47RecName: Full=60 kDa neurofilament protein; Short=... [more]
gi|46576376|sp|P90901|IFA1_CAEEL2.713910e-8735.70RecName: Full=Intermediate filament protein ifa-1;... [more]
back to top
BLAST of ifb vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136290|ref|NP_476616.1|1.420820e-3527.92lamin, isoform A [Drosophila melanogaster][more]
gi|386769141|ref|NP_001245892.1|1.420820e-3527.92lamin, isoform B [Drosophila melanogaster][more]
gi|386769143|ref|NP_001245893.1|1.420820e-3527.92lamin, isoform C [Drosophila melanogaster][more]
gi|665404412|ref|NP_001285629.1|1.420820e-3527.92lamin, isoform D [Drosophila melanogaster][more]
gi|24653664|ref|NP_523742.2|7.000740e-3329.29lamin C, isoform A [Drosophila melanogaster][more]
back to top
BLAST of ifb vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150119560.000000e+085.86SmedAsxldir_c69509_g1_i1|m.14946|m.134[more]
SMU150389472.257960e-16747.08dd_smedV4_3871_0_1|m.24747|m.30510[more]
SMU150132381.797750e-11238.46SmedAsxldir_c85434_g1_i1|m.24146|m.11304[more]
SMU150067297.452470e-8035.09SmedAsxldir_c108652_g1_i5|m.91471|m.38848[more]
SMU150067272.567490e-7936.59SmedAsxldir_c108652_g1_i3|m.91469|m.23241[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_021856 ID=Gsp_021856|Name=ifb|organism=Girardia sp.|type=mRNA|length=1951bp
ACAACGAGTAAAACAAATTTTAAAACAACAACCAATACTGCAAATATTCA
ACCGATTTCTGGTTATAGAAATGTAGTAATAACAAGAACAGGACCGGCAG
TTTCAACTACAGGAAACCAGAATGCCTCGAGTGTTAGAACAATTGAAATG
AAAAAAAGCTATGGAGTAAGCGCGACTCCTGGTGCAACATCAAATATCGT
TCATAGTGGTGTTAATAATCTGATGAATGGTAGAGAAAAGGAGAAAAATG
AATTACAAGAATTAAATGATCGATTTGCAAATTATATAGATAAAGTACGT
AGTTTGGAAGATGAAAATAAAAGGCTAACAGATGAGCTAAATGATTTAAA
AGATCAGTGGGGTAAAGAGACTGCCAGAATCAAAGCTTTATATGATTCTG
ATATGAGTCAATTAAGGCGTTCATTGGATCAAGCTGAAGCATCAAAAGCT
CAACTTGAAATGAAAATAAACACTTTAGAGGATCTTATTCAAGAAGCTCA
AATGGAATTAAATGATGCTACCCAGTTGCATTCTGCTGATAAAGAAACAA
TAGATAAAATGAGCAGTACTTTGGCTGACTATGAACATGAAATTGGAAAT
CTTCGAAAAAGATTGAGCTCATTAGAGGAAGAAAAAATTAGAGATAATAA
AGAAATAATTCGATTAAAAGAAGAGCTTAATCAATTGAAAAAGGATTTGG
ATAAAGAAACTCTAGAACATATTACTGCTCATAATGAAGTTCAATCATTA
CTCGATCAAATCGAATTTTTGAAGAAAATATTCGAATCTGAAATAAGAGA
ATTGGCTGCATTGGTTTATAAGGATTCCTCTGAAAGTAAAGATTTCTGGA
GAAATGAAATGGCCCAAGCTTTAAGAGATATTCAGTCGGAATACGATAAA
AAAATGGAAGCTTTGCACTATGATATGGAAGCACAATATACTCTTAAAAT
ACAAGAAATTCGAACAAATCAAAGCAAAGAAAACGTTGAGACAGTACAAT
TAAGAGAGGAAAATACTAGATTGAAAGATCAGTTGGCAGATATGAGAAAT
AGACTTCCAGAATTAGAAGCTAGAAATAGTGAATTGGAAAGATTATTAGA
ATTGTTGAGACGAGAAATTGAAGAAAAGAATCGTGAATTTGATATGGAGA
AAGCTAATTTAAGGAAAGAACTGATGAATCGACAATCGGAACTTGAATCA
ATACTTATAGAATTGCAAATTTTACTAGATGCCAAATTAAGCTTAGAACT
TGAAATTATAGCTTATAGAAAAATGTTGGAAGGTGAAGAATATAGAGTCA
ATCGTAAAAATAATATCAGTAGTAGTAATTCATTTAACCAAGCAGGAAGA
AATGTTGATTTGATGGATCATGTAACAAGATCCAGTATCAGTCAACAACA
AGCTGCTCCTTCAACTAAAACTCAAGTTACGAGTATTGTCAAAGGAGAAA
TGTCAGCAAAGACGTCTTTTCAAAGAACTGCAAAAGGTAATGTAACAATT
CAAGAATGTTCGGCTGATGGAAAATTTATTATTCTTGAAAATACTGGATC
ACAAGATGAGGATATTTCCGGTTATATTCTCAACAGAAATACTGACAATG
GACGAATTATTGTCAAGCATGTGATTTCACCAAAAACTATTTTAGAACCC
ACAGGAAAAAATCGATATTATAAAATATGGGCAAGAGGAAATAAACCTCA
AGGTTCAAATGATGCAGAATGCTCAGAATCGAATTGGGGATACGGAGCTC
AGATTGTTACGACATTGCAAAATTCAAAAGGCGAAGAAAAGGCAACTCAC
ACCCAAAGAACAGTTTATCAACTGTAATTCAAAATGAGAAAACTTTAGAC
AATTTTCAAACTATTAATTCTTTCTGATTCTTTTATAGACAATATTATAA
ATTTACTTGATTATAATTAGAGAAATATAATTTTGTTTTGATGAAAAAAA
A

Design Primers for ifb

back to top

protein sequence

>Gsp_021856-protein ID=Gsp_021856-protein|Name=ifb|organism=Girardia sp.|type=polypeptide|length=609bp
TTSKTNFKTTTNTANIQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEM
KKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVR
SLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKA
QLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGN
LRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSL
LDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDK
KMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRN
RLPELEARNSELERLLELLRREIEEKNREFDMEKANLRKELMNRQSELES
ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGR
NVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTI
QECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEP
TGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATH
TQRTVYQL*
back to top

coding sequence

>Gsp_021856.1.1827 ID=Gsp_021856.1.1827|Name=Gsp_021856.1.1827|organism=Girardia sp.|type=CDS|length=1827bp
ACAACGAGTAAAACAAATTTTAAAACAACAACCAATACTGCAAATATTCA
ACCGATTTCTGGTTATAGAAATGTAGTAATAACAAGAACAGGACCGGCAG
TTTCAACTACAGGAAACCAGAATGCCTCGAGTGTTAGAACAATTGAAATG
AAAAAAAGCTATGGAGTAAGCGCGACTCCTGGTGCAACATCAAATATCGT
TCATAGTGGTGTTAATAATCTGATGAATGGTAGAGAAAAGGAGAAAAATG
AATTACAAGAATTAAATGATCGATTTGCAAATTATATAGATAAAGTACGT
AGTTTGGAAGATGAAAATAAAAGGCTAACAGATGAGCTAAATGATTTAAA
AGATCAGTGGGGTAAAGAGACTGCCAGAATCAAAGCTTTATATGATTCTG
ATATGAGTCAATTAAGGCGTTCATTGGATCAAGCTGAAGCATCAAAAGCT
CAACTTGAAATGAAAATAAACACTTTAGAGGATCTTATTCAAGAAGCTCA
AATGGAATTAAATGATGCTACCCAGTTGCATTCTGCTGATAAAGAAACAA
TAGATAAAATGAGCAGTACTTTGGCTGACTATGAACATGAAATTGGAAAT
CTTCGAAAAAGATTGAGCTCATTAGAGGAAGAAAAAATTAGAGATAATAA
AGAAATAATTCGATTAAAAGAAGAGCTTAATCAATTGAAAAAGGATTTGG
ATAAAGAAACTCTAGAACATATTACTGCTCATAATGAAGTTCAATCATTA
CTCGATCAAATCGAATTTTTGAAGAAAATATTCGAATCTGAAATAAGAGA
ATTGGCTGCATTGGTTTATAAGGATTCCTCTGAAAGTAAAGATTTCTGGA
GAAATGAAATGGCCCAAGCTTTAAGAGATATTCAGTCGGAATACGATAAA
AAAATGGAAGCTTTGCACTATGATATGGAAGCACAATATACTCTTAAAAT
ACAAGAAATTCGAACAAATCAAAGCAAAGAAAACGTTGAGACAGTACAAT
TAAGAGAGGAAAATACTAGATTGAAAGATCAGTTGGCAGATATGAGAAAT
AGACTTCCAGAATTAGAAGCTAGAAATAGTGAATTGGAAAGATTATTAGA
ATTGTTGAGACGAGAAATTGAAGAAAAGAATCGTGAATTTGATATGGAGA
AAGCTAATTTAAGGAAAGAACTGATGAATCGACAATCGGAACTTGAATCA
ATACTTATAGAATTGCAAATTTTACTAGATGCCAAATTAAGCTTAGAACT
TGAAATTATAGCTTATAGAAAAATGTTGGAAGGTGAAGAATATAGAGTCA
ATCGTAAAAATAATATCAGTAGTAGTAATTCATTTAACCAAGCAGGAAGA
AATGTTGATTTGATGGATCATGTAACAAGATCCAGTATCAGTCAACAACA
AGCTGCTCCTTCAACTAAAACTCAAGTTACGAGTATTGTCAAAGGAGAAA
TGTCAGCAAAGACGTCTTTTCAAAGAACTGCAAAAGGTAATGTAACAATT
CAAGAATGTTCGGCTGATGGAAAATTTATTATTCTTGAAAATACTGGATC
ACAAGATGAGGATATTTCCGGTTATATTCTCAACAGAAATACTGACAATG
GACGAATTATTGTCAAGCATGTGATTTCACCAAAAACTATTTTAGAACCC
ACAGGAAAAAATCGATATTATAAAATATGGGCAAGAGGAAATAAACCTCA
AGGTTCAAATGATGCAGAATGCTCAGAATCGAATTGGGGATACGGAGCTC
AGATTGTTACGACATTGCAAAATTCAAAAGGCGAAGAAAAGGCAACTCAC
ACCCAAAGAACAGTTTATCAACTGTAA
back to top
Gene Groups
ifb is similar in sequence to the genes of this group: GG6276
Gene NameGene ID
SMU15011956SMU15011956
ifbDdo_001875
ifbGsp_021856
ifbPgr_011052
ifbPmo_026655

Gene Group Protein Sequences

>SMU15011956

MLTSKTTTSKTNYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSN
IRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFAN
YIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQ
AEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDY
EHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAH
NELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDI
QTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQ
LAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNR
KAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQT
GRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNV
TIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTIL
EPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKA
THTQRTVYQL*
>Ddo_001875 ifb
PIYSEYIKSLSLYTNLIMQTSKTTSSKTTYSVLAQSNIQPISGPRNVVIT
RTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGR
EKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIK
ALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHI
SDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQ
LKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASD
SKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES
AETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHR
EFESEKIHLRKELMNRQAELENIVLELQLLLDAKLSLELEIAAYRKMLEG
EEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGE
MSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDN
GRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGA
QILTTLQNSKGEEKATHTQRTVYQM*
>Gsp_021856 ifb
TTSKTNFKTTTNTANIQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEM
KKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVR
SLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKA
QLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGN
LRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSL
LDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDK
KMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRN
RLPELEARNSELERLLELLRREIEEKNREFDMEKANLRKELMNRQSELES
ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGR
NVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTI
QECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEP
TGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATH
TQRTVYQL*
>Pgr_011052 ifb
TSSTIIMQSSRTATSTNVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGG
AGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELN
DRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLR
KSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNS
QLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLD
HIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQ
ALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNT
KLKEQLSEMRNRLPELEARNNELERMLEMLRREIDERSRDYDMERANLRK
ELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKNAM
SLNAMSSNAMSSSSGQRMDFADSTITRTNVGQSMAAVTTSKTQVSSTVKG
QMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTD
NGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVG
TLIVTMLFNKKGEEKASHTQRTVYQM*
>Pmo_026655 ifb
MQSSRTVTSTNVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNV
RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANY
IDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSA
EGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYE
NEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQN
EVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQ
SEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQL
SDMRNRLPELEAKNNELEKMLEMLRREMDERNREYDLERANLRKELANQQ
AHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGR
RADATDSMVTRTVAGQSMAAVTTSKTQVVSSTVKGQMSAKTSFQRTAKGN
VTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTI
LEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEK
ASHTQRTVYQM*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.