frizzled-like, Gsp_021429 (mRNA) Girardia sp.

Overview
Namefrizzled-like
Unique NameGsp_021429
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length2375
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of frizzled-like vs. RefSeq Human
Match: gi|6005762|ref|NP_009128.1| (frizzled-10 precursor [Homo sapiens])

HSP 1 Score: 362.844 bits (930), Expect = 1.11289e-113
Identity = 202/530 (38.11%), Postives = 302/530 (56.98%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNI----SCAQICSANVQ--FNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK 1763
+C PI+ P C DI Y TRMPN +G +Q +A+ +L ++ L+ C +L+ +LCS+Y PMC T S + C+ +C+ + KC P M E WP+ L+C KLP K ++ + + L+ + H + + K GG C N G+ ++ SCA +C+ V ++ DK FA +WL W+VLCFFS T++ F + RF YPE+PI+FLS+C+ Y+ G L+ G + +AC D +VI +G E+T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ SS HL WA+PA+K+I IL++ ++ DELTG CYVG+ + N L GFV+IP YL+ G F+ G+++L +R+ N +LEKLM +IG+FS+LY VP C IA Y + M Y+ + L A + N TK ++ C ++ +P+VE+ M++IFM LV+GITSG+WIW SKTL+
Sbjct: 33 KCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKND-----PNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPL----KDGGPGRGGC----DNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIAC-DRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQTK------TLDC--LMAASIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTLQ 529
BLAST of frizzled-like vs. RefSeq Human
Match: gi|22547161|ref|NP_036325.2| (frizzled-4 precursor [Homo sapiens])

HSP 1 Score: 342.043 bits (876), Expect = 2.75898e-106
Identity = 191/529 (36.11%), Postives = 287/529 (54.25%), Query Frame = 3
Query:  189 KQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQL----PNISCAQICSANVQFNSHD-KTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTL 1760
++C PI+ C ++ Y T+MPN VG Q+DA +L + LI CS+ L+ +LCS+Y PMC ++ + PC +C VK++CEP +KE WPE LNC K P + N M ++ + K G +C N Q +++C C + S K F +IW+ W+ LCF S T++ F +++RF YPE+PI+FLS+C+ Y+ ++ +GR+ ++C + +I +G + T C I FL++YFFG +S++WWV+LT+TWFL+A WG+EAIE SS H+ WA+PA+K+I ILI+ +DADELTG CYVGN N + L GFV+ P YL+ G +F+ G ++L K+R S LQ+ D +LE+LM KIGVFS+LY VP C IA Y +++++ ALFR+S + ++ + ML+IFM+L++GITSG+WIW ++KTL
Sbjct: 43 RRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIP---IGPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFPPQND-------------------------------HNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR-SNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACY--------FYEISNWALFRYSAD---------------------DSNMAVEMLKIFMSLLVGITSGMWIW-SAKTL 501
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503835|ref|NP_003499.1| (frizzled-9 precursor [Homo sapiens])

HSP 1 Score: 329.331 bits (843), Expect = 8.88988e-101
Identity = 192/529 (36.29%), Postives = 290/529 (54.82%), Query Frame = 3
Query:  195 CVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKG---KICF-TPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQ--FNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK 1763
C ++ P C I Y TRMPN +G SQ +A+ L ++ L+ C ++L+ +LCS+Y PMC T S + C+ +C+ + +C P M E WP+ L+C +LP + +C PE+ + ++ + + + ++ GG G+ P + + + SCA C V+ ++ DK FA +W+ WS LCFFS T++ F +RF YPE+PI+FLS+C+ Y+ L+ +V G + VAC + +VI +G E T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ S H+ W +PALK+I IL L K+ DELTG CYV + + L GFV++P YL+ G FL G+++L +RK N ++LEKLM KIGVFSILY VP C I Y+ + M ++ LRA + G S+ + P+V + ML+IFM+LV+GITSG+W+W +SKT +
Sbjct: 39 CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMC---TDQVSTPIPACRPMCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRNDPHALCMEAPEN------------ATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS-GTCENPEKFQYVE-KSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC-DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWR--LRATEQPCAAAAGPGGRRDCSLPGGSV-----PTVAVFMLKIFMSLVVGITSGVWVW-SSKTFQ 535
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503833|ref|NP_003498.1| (frizzled-7 precursor [Homo sapiens])

HSP 1 Score: 310.457 bits (794), Expect = 6.7058e-94
Identity = 176/552 (31.88%), Postives = 276/552 (50.00%), Query Frame = 3
Query:  171 VNVDIYKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLP--EKGKICFTPESFXXXXXXXXXXXXXXXXXXLYR-QFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSAN-----VQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVD-AFKMTYFDV-ALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKR 1796
++V + C PI P C DI Y +T +PN +G +Q DA + + L+ ++CS L+ +LCS+Y P+C ++ Q + PC+ LC+ +Q CE M + WPE L CE P G+IC + + L F + G + + + +P + L C C + F ++ FA +W+ WSVLC S T++ + + RF YPE+PI+FLS C+F A ++ G +L + V + D + QG + C I F+++YFFG +S++WWV+L++TWFL+A WG+EAIE+ S HL WAVPA+K+I IL + ++D D L+G CYVG ++ + L GFV+ P +YL G FL G++SL ++R D ++LEKLM +IGVFS+LY VP +A Y + AF+ + L+ ++ C + PM P + M++ M +++GIT+G WIW KT++ W+R
Sbjct: 41 ISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC----TVLDQAIPPCRSLCERARQGCEALMNK-FGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLK---VPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGH------------FPPMSPDFTVFMIKYLMTMIVGITTGFWIWSG--------KTLQSWRR 559
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503827|ref|NP_001457.1| (frizzled-2 precursor [Homo sapiens])

HSP 1 Score: 310.071 bits (793), Expect = 7.48074e-94
Identity = 182/573 (31.76%), Postives = 277/573 (48.34%), Query Frame = 3
Query:  171 VNVDIYKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKG--KICF----------------TPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICS-----ANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQP--------MLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKR 1796
+++ + C PI P C DI Y +T MPN +G +Q DA + + L+ ++CS L+ +LCS+Y P+C ++ Q + PC+ +C+ +Q CE M + WPE L CE P G +IC P G Y E+ ++ + +PS ++ L CA C ++ F+ + FA +W++ WSVLC S F T+ + + RF YPE+PI+FLS C+ + + G VL +VV + + + QG + C I F+M+YFF +S++WWV+L++TWFL+A WG+EAIE+ S HL WAVPA+K+I IL + +ID D L+G C+VG N+ + L GFV+ P +YL G FL G++SL ++R D ++LE+LM +IGVFS+LY VP IA Y +++ A R + S W S C + P M P + M++ M L++GITSG WIW KT+ W++
Sbjct: 31 ISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC----TVLEQAIPPCRSICERARQGCEALMNK-FGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLK-----------------VPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLERLMVRIGVFSVLYTVPATIVIACY--------FYEQAFREHWERS----------WVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSG--------KTLHSWRK 550
BLAST of frizzled-like vs. uniprot
Match: gi|17433091|sp|Q9ULW2|FZD10_HUMAN (RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz10; AltName: Full=FzE7; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 362.844 bits (930), Expect = 2.94876e-113
Identity = 202/530 (38.11%), Postives = 302/530 (56.98%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNI----SCAQICSANVQ--FNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK 1763
+C PI+ P C DI Y TRMPN +G +Q +A+ +L ++ L+ C +L+ +LCS+Y PMC T S + C+ +C+ + KC P M E WP+ L+C KLP K ++ + + L+ + H + + K GG C N G+ ++ SCA +C+ V ++ DK FA +WL W+VLCFFS T++ F + RF YPE+PI+FLS+C+ Y+ G L+ G + +AC D +VI +G E+T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ SS HL WA+PA+K+I IL++ ++ DELTG CYVG+ + N L GFV+IP YL+ G F+ G+++L +R+ N +LEKLM +IG+FS+LY VP C IA Y + M Y+ + L A + N TK ++ C ++ +P+VE+ M++IFM LV+GITSG+WIW SKTL+
Sbjct: 33 KCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKND-----PNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPL----KDGGPGRGGC----DNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIAC-DRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQTK------TLDC--LMAASIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTLQ 529
BLAST of frizzled-like vs. uniprot
Match: gi|17433077|sp|Q9PWH2|FZD10_CHICK (RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-10; Flags: Precursor [Gallus gallus])

HSP 1 Score: 362.073 bits (928), Expect = 6.14822e-113
Identity = 204/532 (38.35%), Postives = 305/532 (57.33%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQF--ENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNI----SCAQICS--ANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK 1763
+C PI+ P C DI Y TRMPN +G +Q +A+ +L ++ L+ C +LK +LCS+Y PMC T S + C+ +C+ + KC P M E WP+ L+C KLP K P ++ + + L F + GH + Q K + + S N G+ ++ SCA +C+ +V ++ DK FA IW+ WS+LCFFS T++ F + RF YPE+PI+FLS+C+ Y+ G ++ G + +AC D +VI +G E+T C I FL++Y+FG +S+LWWV+LT+TWFL+A + WG+EAIE+ SS HL WA+PA+K+I IL++ ++ DELTG CYVG+ + N L GFV+IP YL+ G F+ G+++L +R+ N +LEKLM +IGVFS+LY VP C IA Y + M Y+ + + + + N TKN + C ++ +P+VE+ M++IFM LV+GITSG+WIW SKTL+
Sbjct: 37 RCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKND----PNYLCMEAPNNGSDEPPRGSSMLPPMFRPQRPSTGHDLQQHKDSLSRT-----------SCENPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIAC-DRDSGQLYVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT-----GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKI-VASQQKCKMNNQTKN------LDC--MMNNSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTLQ 533
BLAST of frizzled-like vs. uniprot
Match: gi|52782829|sp|Q8BKG4|FZD10_MOUSE (RecName: Full=Frizzled-10; Short=Fz-10; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 357.451 bits (916), Expect = 3.30131e-111
Identity = 209/576 (36.28%), Postives = 322/576 (55.90%), Query Frame = 3
Query:  117 IIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNI----SCAQICSANVQ--FNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK----YCIKTIRFWKRTKELEI 1814
++ +MI S I +D D +C P++ P C DI Y TRMPN +G +Q +A+ +L ++ L+ C ++L+ +LCS+Y PMC T S + C+ +C+ + KC P M E + WP+ L+C KLP K + + D+ ++ G Q + Q H + K GG + C N G+ ++ SCA +C+ V ++ DK FA +WL WSVLCFFS T++ F + +RF YPE+PI+FLS+C+ Y+ G ++ G + +AC D +VI +G E+T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ SS HL WA+PA+K+I IL++ ++ DELTG CYVG+ + N L GFV++P YL+ G F+ G+++L +R+ N +LEKLM +IGVFS+LY VP C IA Y + M Y+ + L + N TK + C ++ +P+VE+ M+++ M LV+GITSG+W+W SKTL+ C + ++ R K +
Sbjct: 11 VLQVMIGSCTAISSMDLERPGD--GKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPL---------KDGGPGRAGC----DNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIAC-DRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKM-LATQHKCKMNNQTK------TPDC--LMTTSIPAVEVFMVKVSMLLVVGITSGVWVW-TSKTLQSWQHVCSRGLKRKSRRKPASV 551
BLAST of frizzled-like vs. uniprot
Match: gi|17433043|sp|Q9DEB5|FZ10A_XENLA (RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=Xfz10-A; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 352.058 bits (902), Expect = 3.98961e-109
Identity = 204/533 (38.27%), Postives = 300/533 (56.29%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQF--ENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNI----SCAQICSANVQ--FNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDV-ALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK 1763
+C I+ P C DI Y TRMPN +G +Q +A+ +L ++ L+ C ++LK +LCS+Y PMC T S + C+ +C+ + KC P M E WP+ L+C KLP K P ++ + L F + GH EI+ K S C N G+ ++ SCA +CS++V ++ DK FA IW+ WS+LCFFS T++ F + RF YPE+PI+FLS+C+ Y+ G ++ G +AC D +VI +G E+T C I FL++Y+FG +S+LWWV+LT+TWFL+A + WG+EAIE+ SS HL WA+PA+K+I IL++ ++ DELTG CYVG+ + N L GFV+IP YL+ G F+ G+++L +R+ N +LEKLM +IGVFS+LY VP C IA Y + M ++ + A + + T + SSI P+VE+ M++IFM LV+GITSG+WIW SKT++
Sbjct: 39 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKND----PNYLCMEAPNNGTDETPRGSSMLPPIFRPQRPSSGH-------EIYPK-DPTSRSSCE----NSGKFHHVEKSASCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIAC-DRDSGQLYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT-----GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILATQDKCKMDSQTKTLDCTMTSSI----------PAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQ 534
BLAST of frizzled-like vs. uniprot
Match: gi|17433096|sp|Q9W742|FZ10B_XENLA (RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=Xfz10-B; AltName: Full=Frizzled-9; Short=Fz-9; Short=Xfz9; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 350.517 bits (898), Expect = 1.24478e-108
Identity = 202/540 (37.41%), Postives = 299/540 (55.37%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKI--EIFKKIGGMIGSQCLPSEI-------NIGQLPNI----SCAQICSANVQ--FNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDV-ALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK 1763
+C I+ P C DI Y TRMPN +G +Q +A+ +L ++ L+ C ++LK +LCS+Y PMC T S + C+ +C+ + KC P M E WP+ L+C KLP K + L + N S I IF+ G + P + N G+ ++ SCA +CS++V ++ +DK FA IW+ WS+LCFFS T++ F + RF YPE+PI+FLS+C+ Y+ G ++ G +AC D +VI +G E+T C I FL++Y+FG +S+LWWV+LT+TWFL+A + WG+EAIE+ SS HL WA+PA+K+I IL++ ++ DELTG CYVG+ + N L GFV+IP YL+ G F+ G+++L +R+ N +LEKLM +IGVFS+LY VP C IA Y + M ++ + A + + T + SSI P+VE+ M++IFM LV+GITSG+WIW SKT++
Sbjct: 33 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNY-----------------------LCMEAPNNGTDEAPRSSSILPPIFRPQRPNSGHEMYPKDPKGRSSCENSGKFHHVEKSASCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIAC-DRDSGQLYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT-----GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILATQDKCKMDSQTKTLDCTMTSSI----------PAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQ 528
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 246.514 bits (628), Expect = 8.8418e-71
Identity = 159/542 (29.34%), Postives = 261/542 (48.15%), Query Frame = 3
Query:  186 YKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQS---KIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRS--------YDDQNDFVIGQG-RETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFR-----FSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTL 1760
+ +C PI C +IPY T MPN +G Q +A + + L+ I CS+ L+L+LCS+Y P+C ++ + + PC+ LC+ + CE MK + WPE L C K P G + + R+ + ++ N +++ +G + E+ +G C C A + F ++T W+ W+ +C SC T++ F +++RF YPE+ IVFL++C+ + G G V +CR Q I QG R+TT C + F+ +YF ++ WW L WFL+A WG+EAIE+ S + HL+ WAVPAL++I +L L K++ D L+G C+VG + + L F+I+P IYL G +FL G+ISL ++R D +LE+LM +IG FS L+I+P + + + + FD + R FS C + P ++ M++ ++++G+TS +W++ +SKT+
Sbjct: 50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESAR-VCEKLMK-TYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLG-------MGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSV-SCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKT-----DGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYN---FDEWMIQWHRDICKPFSIPCPAARAPGSPEAR---------PIFQIFMVKYLCSMLVGVTSSVWLY-SSKTM 558
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 246.899 bits (629), Expect = 1.03016e-70
Identity = 157/541 (29.02%), Postives = 261/541 (48.24%), Query Frame = 3
Query:  186 YKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQS---KIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRS--------YDDQNDFVIGQG-RETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSV----EMRMLRIFMNLVIGITSGIWIWGNSKTL 1760
+ +C PI C +IPY T MPN +G Q +A + + L+ I CS+ L+L+LCS+Y P+C ++ + + PC+ LC+ + CE MK + WPE L C K P G + + R+ + ++ N +++ +G + E+ +G C C A + F ++T W+ W+ +C SC T++ F +++RF YPE+ IVFL++C+ + G G V +CR Q I QG R+TT C + F+ +YF ++ WW L WFL+A WG+EAIE+ S + HL+ WAVPAL++I +L L K++ D L+G C+VG + + L F+I+P IYL G +FL G+ISL ++R D +LE+LM +IG FS L+I+P + + + + + + ++ SI C P P ++ M++ ++++G+TS +W++ +SKT+
Sbjct: 50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESAR-VCEKLMK-TYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLG-------MGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSV-SCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-----TDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWH-----------RDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLY-SSKTM 558
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 238.424 bits (607), Expect = 5.22092e-67
Identity = 135/358 (37.71%), Postives = 195/358 (54.47%), Query Frame = 3
Query:  726 NIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQP-MLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKR 1796
I +PN C C F++ +K FA +W+ WS LCF S +T+ F +T RF YPE+PIVFLS C+F A G L + L + +AC + G + C + FL+ YFFG +S++WWV+L+ TWFL+A WG EAI S HL W +P ++S+ +L+L +D D + G CYVGN N + L FV+ P +YL+ G FL G++SL ++R Q+ +LEKLM +IG+FS+LY VP I Y+ +A YF+ ++AL + C ++ P P + ML+ FM L +GITSG+WIW + KTL+ RFW+R
Sbjct: 293 RIAGVPN--CGIPCKGPF-FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRES---STGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEA---AYFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIW-SGKTLE---SWRRFWRR 619

HSP 2 Score: 75.0998 bits (183), Expect = 1.51528e-13
Identity = 37/113 (32.74%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKG 530
+C I P C I Y T PN + +Q +A + + L+ I+CS LK +LCS+Y P+C D + C+ +C+ + C P M++ WPE + CE LP G
Sbjct: 63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHG 171
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 238.424 bits (607), Expect = 5.22092e-67
Identity = 135/358 (37.71%), Postives = 195/358 (54.47%), Query Frame = 3
Query:  726 NIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQP-MLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKR 1796
I +PN C C F++ +K FA +W+ WS LCF S +T+ F +T RF YPE+PIVFLS C+F A G L + L + +AC + G + C + FL+ YFFG +S++WWV+L+ TWFL+A WG EAI S HL W +P ++S+ +L+L +D D + G CYVGN N + L FV+ P +YL+ G FL G++SL ++R Q+ +LEKLM +IG+FS+LY VP I Y+ +A YF+ ++AL + C ++ P P + ML+ FM L +GITSG+WIW + KTL+ RFW+R
Sbjct: 293 RIAGVPN--CGIPCKGPF-FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRES---STGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEA---AYFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIW-SGKTLE---SWRRFWRR 619

HSP 2 Score: 75.0998 bits (183), Expect = 1.51528e-13
Identity = 37/113 (32.74%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKG 530
+C I P C I Y T PN + +Q +A + + L+ I+CS LK +LCS+Y P+C D + C+ +C+ + C P M++ WPE + CE LP G
Sbjct: 63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHG 171
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 238.424 bits (607), Expect = 5.22092e-67
Identity = 135/358 (37.71%), Postives = 195/358 (54.47%), Query Frame = 3
Query:  726 NIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQP-MLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKR 1796
I +PN C C F++ +K FA +W+ WS LCF S +T+ F +T RF YPE+PIVFLS C+F A G L + L + +AC + G + C + FL+ YFFG +S++WWV+L+ TWFL+A WG EAI S HL W +P ++S+ +L+L +D D + G CYVGN N + L FV+ P +YL+ G FL G++SL ++R Q+ +LEKLM +IG+FS+LY VP I Y+ +A YF+ ++AL + C ++ P P + ML+ FM L +GITSG+WIW + KTL+ RFW+R
Sbjct: 293 RIAGVPN--CGIPCKGPF-FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRES---STGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEA---AYFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIW-SGKTLE---SWRRFWRR 619

HSP 2 Score: 75.0998 bits (183), Expect = 1.51528e-13
Identity = 37/113 (32.74%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKG 530
+C I P C I Y T PN + +Q +A + + L+ I+CS LK +LCS+Y P+C D + C+ +C+ + C P M++ WPE + CE LP G
Sbjct: 63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHG 171
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15029711 (SmedSxlregen_c141340_g1_i1|m.45153|m.4173)

HSP 1 Score: 973 bits (2514), Expect = 0
Identity = 458/623 (73.52%), Postives = 541/623 (86.84%), Query Frame = 3
Query:   99 NFTMMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPYNNWKLNSSYP-ANEFGLATV 1964
+ +M K ++I+I FI+ ++ R DIYKQCVPIKEPEC D+ Y+ T MPN VG SQ++AS+R RD+N LINI+CSNYLKL+LCS+YFPMCETDTSM+S VKPC+HLC HVK++CEP MKE+ ++ W EEL+CEK PE+GKIC TP+SFS D+ SQ D Q LYR+ + VMQG++I QSK+EI++K+ M+G+QCLPSE+NIGQ PNISCAQICSANVQFN+HDK FANIWL+GWSVLCFFSC LTIIVFSCNTNRFLYPEKPIVFLSIC+FFYASGNL G++LGR VVACR+++D+ DF++G GRETTWCKINFLM+YFFGS+SALWWVVLTITWFLSASRHWGYEAIESISSMLHL+ WA+PALKSIFILILHKIDADELTGQC+VGN+N VLWGFVI+P MIYL G++FLT+GYISLLKVR+SFLQRPDCIDTNNLKRLEKLMAKIGVFSILY++PV+CTI SY+VDA+KMT FD+ L+ALFRFSPNC+ +NG+NWSSIKC+EILQP+LPSVEMRMLRIFMNLVIGITSGIWIWGN KT+K CI T+RFW++ KE E P N CDSST NN P+ +Q+KQ ETLLPY++WKLNSSYP E+GL TV
Sbjct: 18 HISMTKTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPL--SQTKQKETLLPYHDWKLNSSYPVVVEYGLPTV 638
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15005387 (SmedAsxldir_c106380_g2_i1|m.75515|m.16659)

HSP 1 Score: 353.214 bits (905), Expect = 5.83273e-110
Identity = 203/567 (35.80%), Postives = 320/567 (56.44%), Query Frame = 3
Query:  120 IVIMIFSKLF----IDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQ-GHKINQSKIEIFKKIGGMIGSQCLPSEINIG-------QLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTN-RFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACR-SYDDQNDFVI-GQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRP-----DCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTL 1760
+V+ F KL I F + D+Y +C I + C + Y KTRMPNSVGI +Q D+++R+ DY LIN +CS Y + +LC+ YFPMC TD ++ + PC+ +C+ V+ +CEPFMK + ++ WP ELNC+K P +IC P ++ LD N + D +++ Y +++++ + +++E F+ I +CL S +++ + + SC C +N+ ++S DK A IW W++LC S + I F + RFLYPE+PI+F+ +C+ NL L RK + C+ + ND ++ +G E+ C + FL +Y+F +ALWW++L I+ +L++ R W E +E IS+ +H++ W +PA+ + +LILHKID DEL G CYVG N F++IP+++ L G + L L + SL+ +R++ D I N + LEK +AK G+F +Y VP+ C I + + ++ CV K G+ WS C++ L LP VE+R+L IF LVIGITSG+W+W N KTL
Sbjct: 9 VVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFMK-AFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFET---EINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQ--NQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLP--LPLVEVRLLEIFSTLVIGITSGMWMWCNKKTL 566
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15040087 (dd_smedV4_7210_0_1|m.35691|m.13357)

HSP 1 Score: 300.827 bits (769), Expect = 6.00073e-91
Identity = 193/602 (32.06%), Postives = 306/602 (50.83%), Query Frame = 3
Query:  189 KQCVPIK--EPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLP---EKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQ-GRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLK----YCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY---NNWKLNSS-YPANEFG 1952
++C+P K PEC ++ Y T MPN V + +Q +A +L+ + +LI +CS L +LCS+Y PMC+ +++ ++ PC+ LC+ V+ CE M+ +PWP LNC + P +G +C M+G + E F+ + G + + L IN Q C CSAN+ F DK A IWL + LCF S TI+ F NT+RF YPE+P++FL++C+ Y+ + + R+ AC F++ Q G + T C I FL+ +FF ++S +WWV+LT+ W L+A W EAI S HL W + +L ++ +L+L +DADEL G C VG N + L FVIIP +I+L+ G FL G ++L++VR+ + D I T ++LE LM +IG+FS+L++VP + +++ A R + K+G N P++E+ ML+IFM+ V+GITSG+W+W + KTL+ +C+ + K T+ + + N+ P A S++N ++ P N W N+ P +F
Sbjct: 44 RKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCD---PISNYLIGPCQPLCEEVRDSCERIMRP-FNLPWPVTLNCSRFPVRNAEGSMC--------------------------------MEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQ----KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHV--KNDGIKT---EKLEILMVRIGLFSVLFLVPSSTVLGC--------NFYEYANRDHW-------LKSGTN--------------PNIEVYMLKIFMSSVVGITSGVWVW-SIKTLESWQWFCLVKMCCRKPTRSMIEEKKNN-----FPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFS 565
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15001054 (Asxlregen_comp62015_c0_seq1|m.11130|m.22104)

HSP 1 Score: 283.493 bits (724), Expect = 1.63579e-84
Identity = 185/587 (31.52%), Postives = 291/587 (49.57%), Query Frame = 3
Query:  195 CVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKRT--KELEIQPDNHCD-SSTTPNNFPVAHAQSKQNETLLPYNNWKLNSSYPANE 1946
C+PI+ C I Y T +PN + S +A ++ +NAL+ I CS L+L+LCS+Y P+C + + C+ LC ++ C M + WPE +NCEKLPE C ++ + + S+ + + + K + +I S+ +++ G + N C C + F DK+F+ WL W+ +C S +TI+ F + +RF YPE+PI+FLSIC+ + G L+ LG + VAC+S D + C I FL +YFFG +S++WWVVLT TWFL+A WG EAI + + H W +P ++SI IL + +D D ++G CYVGN N+ L FVIIP ++YLL G FL G+++L+K+RK+ ++ + + +LEKLM +I +F I+Y VP + + + ++ R L+ S C + + P + ML+ FMNLV+G T+G WIW KT+ W + K L + H + T + P+ ++ + LL + LNSSY N+
Sbjct: 35 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNR---IPACRSLCISAREGCTRVMNQ-YGFKWPEGMNCEKLPEDNA-CLRKDNKTRSNKTANFVSE---------------RPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISN--CLMNCRSP-YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS-----DAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGE----SKTDKLEKLMIRISIFGIVYSVPTMTVVFC--------SIYEFIFRDLWEQSYTCPCRT-------------KKYQPEYSVFMLKYFMNLVVGTTAGFWIWTP--------KTLDSWSKVFCKLLCCRKSLHYKVTCPTQLDKPLCKPETLSTKALL----YSLNSSYNVND 556
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15036199 (SmedSxlregen_c90692_g1_i1|m.42870|m.18187)

HSP 1 Score: 282.722 bits (722), Expect = 7.91476e-84
Identity = 182/549 (33.15%), Postives = 272/549 (49.54%), Query Frame = 3
Query:  192 QCVPIKEPECHDIPYTKTRMPNSVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQIVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESFXXXXXXXXXXXXXXXXXXLYR---QFENVMQGHKINQSKIEIFKKIGGMIGSQCLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCFLTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSYDDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQNVLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCVTKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKTLKYCIKTIRFWKRTKELEIQPDNH 1829
+CVPI P C +I Y T MPN +Q +A + + L+ I CS+ L+L+LCS+Y P+C + + ++ C+ +C+ + C P M + WP+ ++C+KL E + C ++ ++ + +Y QF +V+ G N C Q C + F S DK+F WL W+VLC S T++ F + +RF YPE+PIVFLS C+ + G ++ +G +++AC D G R C I FL++YFFG ++++WWV+LTITWFLSA WG EAI S + H L W + +KSI L L ID D + G CY+GN N L F+I+P +YLL G FL G+I+L+ +RK+ + + + +LEKLM +IG+F +LY VP I ++ ++V R + S NC +IK E P + ML+ FM LV+GITSG WIW SKTL R + ++ + Q D H
Sbjct: 58 KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWP---KPIQACRSVCESARDGCAPVM-NTYGFKWPKSMDCDKLTEN-QACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVAN--------------------------------CFQSCHS-ANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG-DKLRYGTTGPAR----CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGE----SKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHL--------YEVKNREFWEKSNNCYCNR-----NIKSQENFSK--PEYSVFMLKYFMCLVVGITSGFWIW-TSKTLDSWHNAFR--RLSQSICGQSDKH 541
The following BLAST results are available for this feature:
BLAST of frizzled-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|6005762|ref|NP_009128.1|1.112890e-11338.11frizzled-10 precursor [Homo sapiens][more]
gi|22547161|ref|NP_036325.2|2.758980e-10636.11frizzled-4 precursor [Homo sapiens][more]
gi|4503835|ref|NP_003499.1|8.889880e-10136.29frizzled-9 precursor [Homo sapiens][more]
gi|4503833|ref|NP_003498.1|6.705800e-9431.88frizzled-7 precursor [Homo sapiens][more]
gi|4503827|ref|NP_001457.1|7.480740e-9431.76frizzled-2 precursor [Homo sapiens][more]
back to top
BLAST of frizzled-like vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17433091|sp|Q9ULW2|FZD10_HUMAN2.948760e-11338.11RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz1... [more]
gi|17433077|sp|Q9PWH2|FZD10_CHICK6.148220e-11338.35RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-... [more]
gi|52782829|sp|Q8BKG4|FZD10_MOUSE3.301310e-11136.28RecName: Full=Frizzled-10; Short=Fz-10; AltName: C... [more]
gi|17433043|sp|Q9DEB5|FZ10A_XENLA3.989610e-10938.27RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=X... [more]
gi|17433096|sp|Q9W742|FZ10B_XENLA1.244780e-10837.41RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=X... [more]
back to top
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17864440|ref|NP_524812.1|8.841800e-7129.34frizzled, isoform A [Drosophila melanogaster][more]
gi|442632294|ref|NP_001261836.1|1.030160e-7029.02frizzled, isoform C [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|5.220920e-6737.71frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|5.220920e-6737.71frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|5.220920e-6737.71frizzled 2, isoform C [Drosophila melanogaster][more]
back to top
BLAST of frizzled-like vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150297110.000000e+073.52SmedSxlregen_c141340_g1_i1|m.45153|m.4173[more]
SMU150053875.832730e-11035.80SmedAsxldir_c106380_g2_i1|m.75515|m.16659[more]
SMU150400876.000730e-9132.06dd_smedV4_7210_0_1|m.35691|m.13357[more]
SMU150010541.635790e-8431.52Asxlregen_comp62015_c0_seq1|m.11130|m.22104[more]
SMU150361997.914760e-8433.15SmedSxlregen_c90692_g1_i1|m.42870|m.18187[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_021429 ID=Gsp_021429|Name=frizzled-like|organism=Girardia sp.|type=mRNA|length=2375bp
TTCACATATATATTAATATAAATATATGTTTATTTTATCAATTTATATTT
ATTTATATTTTTATATACGAAGAAAAAATTATTTTAAAGAAATAAAGAAA
TTTTACAATGATGAAAATAATTGTCATTATGATTTTCAGTAAACTCTTCA
TCGATTTTGTTGATTGTCGAGTTAATGTTGATATTTACAAACAATGTGTT
CCAATTAAAGAACCTGAATGTCATGATATTCCTTATACAAAAACCAGAAT
GCCAAATTCAGTTGGAATCAATTCACAGTCTGATGCCAGTCAAAGACTCC
GAGATTACAATGCTTTGATCAATATACGATGTAGTAATTATTTGAAGCTT
TATCTTTGTTCAATTTATTTTCCAATGTGTGAGACTGATACTAGTATGAA
TTCACAAATCGTCAAACCATGCAAACATCTCTGTAAACATGTAAAACAAA
AATGCGAGCCATTTATGAAAGAATCTCTACAAATGCCTTGGCCGGAAGAA
TTGAATTGTGAAAAGTTACCAGAAAAAGGAAAAATCTGTTTTACACCAGA
ATCGTTTTCACTTGATGATTTAGACCAACAAAATCAGTCTCAAGGAGATG
ATGTTCAACAACTTTATCGGCAATTTGAAAACGTTATGCAAGGCCATAAA
ATTAATCAATCAAAAATTGAAATTTTTAAGAAAATCGGTGGAATGATTGG
TTCACAATGTCTACCATCAGAAATCAATATTGGTCAATTACCGAATATTT
CTTGTGCTCAGATCTGTTCTGCTAATGTCCAATTCAATAGTCATGATAAA
ACATTCGCCAATATTTGGTTGATGGGTTGGTCGGTTCTTTGTTTTTTTTC
ATGTTTTCTAACGATTATTGTTTTCTCTTGTAATACGAATCGATTTCTCT
ATCCAGAAAAACCGATTGTTTTCCTATCGATTTGTTTTTTTTTCTATGCT
AGTGGTAATTTATTAGGTTCAGTACTCGGTCGAAAAGTTGTTGCCTGTCG
ATCATACGATGATCAAAATGATTTTGTTATCGGACAAGGGAGAGAGACAA
CATGGTGCAAAATCAATTTTCTAATGGTCTATTTTTTCGGTTCTTCTAGT
GCCTTGTGGTGGGTTGTCCTAACTATTACTTGGTTTCTTTCAGCTTCTCG
GCATTGGGGCTATGAAGCTATCGAATCAATTAGTAGTATGTTGCATTTAC
TATGTTGGGCAGTTCCAGCGTTAAAATCGATATTTATATTAATTCTCCAT
AAGATTGATGCCGACGAATTAACCGGTCAATGTTATGTCGGTAATAATAA
TCAAAATGTTTTATGGGGTTTTGTAATTATTCCTCAAATGATCTATTTGT
TGACTGGAGTGATATTTTTGACATTAGGCTATATTTCTTTATTGAAAGTT
CGAAAATCTTTTCTTCAAAGACCAGACTGTATCGATACAAATAATTTGAA
ACGATTAGAAAAATTAATGGCGAAAATCGGTGTTTTTTCAATACTTTATA
TTGTACCGGTGATTTGTACTATTGCTAGTTACATGGTTGATGCATTTAAA
ATGACATATTTCGATGTTGCTCTTAGAGCTTTATTTAGATTTTCTCCAAA
TTGTGTCACGAAAAATGGGGTTAATTGGTCGAGTATAAAGTGCATTGAAA
TTCTACAGCCGATGCTACCATCAGTTGAAATGAGAATGTTGAGAATATTT
ATGAATTTAGTTATTGGTATAACTTCCGGAATATGGATATGGGGAAACTC
GAAAACATTGAAATATTGTATAAAAACCATTAGATTTTGGAAACGAACTA
AAGAACTCGAAATTCAACCAGACAATCATTGCGACTCATCAACAACTCCA
AACAATTTTCCAGTAGCCCATGCACAATCAAAACAAAATGAAACTCTCTT
GCCTTACAATAACTGGAAATTGAATTCTTCATATCCAGCCAATGAATTCG
GTTTAGCTACTGTTTCAGTACCCAGTGAAATTATTCCTCCACCTAATAAC
TCATCAATCAGTGATTTATCCAGCAAACATTAAACACAATTTCTATATGA
AATTTTGATCTCCATTGTATATAATACTTTATTTCTTCAAAAAAAATAAC
AAGAAACTTATGCCTACACTACAAAAAAATGCACAAACAATATCATTAAT
TACTGCATCTAATGTTTTACTTTTTTTTTTAAATTTCAAACCGAGTTAAA
CATTTTAACACAAATACATGTCCATAATAAAATTATTAGGAAATCAATAA
AAAAAAGACATTAATGACAAAAAAAAATTATTTTCAAATTTTGTGATATC
TATATTCTCCTGTATTTTTTTCTTTCGTTCTTTTTTCTTTCTTGTGGAAT
TCATGAAATTGTATTTTCTTAATAT

Design Primers for frizzled-like

back to top

protein sequence

>Gsp_021429-protein ID=Gsp_021429-protein|Name=frizzled-like|organism=Girardia sp.|type=polypeptide|length=642bp
MMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPN
SVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQ
IVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESF
SLDDLDQQNQSQGDDVQQLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQ
CLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCF
LTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSY
DDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHW
GYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQN
VLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRL
EKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCV
TKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKT
LKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY
NNWKLNSSYPANEFGLATVSVPSEIIPPPNNSSISDLSSKH*
back to top

coding sequence

>Gsp_021429.108.2033 ID=Gsp_021429.108.2033|Name=Gsp_021429.108.2033|organism=Girardia sp.|type=CDS|length=1926bp
ATGATGAAAATAATTGTCATTATGATTTTCAGTAAACTCTTCATCGATTT
TGTTGATTGTCGAGTTAATGTTGATATTTACAAACAATGTGTTCCAATTA
AAGAACCTGAATGTCATGATATTCCTTATACAAAAACCAGAATGCCAAAT
TCAGTTGGAATCAATTCACAGTCTGATGCCAGTCAAAGACTCCGAGATTA
CAATGCTTTGATCAATATACGATGTAGTAATTATTTGAAGCTTTATCTTT
GTTCAATTTATTTTCCAATGTGTGAGACTGATACTAGTATGAATTCACAA
ATCGTCAAACCATGCAAACATCTCTGTAAACATGTAAAACAAAAATGCGA
GCCATTTATGAAAGAATCTCTACAAATGCCTTGGCCGGAAGAATTGAATT
GTGAAAAGTTACCAGAAAAAGGAAAAATCTGTTTTACACCAGAATCGTTT
TCACTTGATGATTTAGACCAACAAAATCAGTCTCAAGGAGATGATGTTCA
ACAACTTTATCGGCAATTTGAAAACGTTATGCAAGGCCATAAAATTAATC
AATCAAAAATTGAAATTTTTAAGAAAATCGGTGGAATGATTGGTTCACAA
TGTCTACCATCAGAAATCAATATTGGTCAATTACCGAATATTTCTTGTGC
TCAGATCTGTTCTGCTAATGTCCAATTCAATAGTCATGATAAAACATTCG
CCAATATTTGGTTGATGGGTTGGTCGGTTCTTTGTTTTTTTTCATGTTTT
CTAACGATTATTGTTTTCTCTTGTAATACGAATCGATTTCTCTATCCAGA
AAAACCGATTGTTTTCCTATCGATTTGTTTTTTTTTCTATGCTAGTGGTA
ATTTATTAGGTTCAGTACTCGGTCGAAAAGTTGTTGCCTGTCGATCATAC
GATGATCAAAATGATTTTGTTATCGGACAAGGGAGAGAGACAACATGGTG
CAAAATCAATTTTCTAATGGTCTATTTTTTCGGTTCTTCTAGTGCCTTGT
GGTGGGTTGTCCTAACTATTACTTGGTTTCTTTCAGCTTCTCGGCATTGG
GGCTATGAAGCTATCGAATCAATTAGTAGTATGTTGCATTTACTATGTTG
GGCAGTTCCAGCGTTAAAATCGATATTTATATTAATTCTCCATAAGATTG
ATGCCGACGAATTAACCGGTCAATGTTATGTCGGTAATAATAATCAAAAT
GTTTTATGGGGTTTTGTAATTATTCCTCAAATGATCTATTTGTTGACTGG
AGTGATATTTTTGACATTAGGCTATATTTCTTTATTGAAAGTTCGAAAAT
CTTTTCTTCAAAGACCAGACTGTATCGATACAAATAATTTGAAACGATTA
GAAAAATTAATGGCGAAAATCGGTGTTTTTTCAATACTTTATATTGTACC
GGTGATTTGTACTATTGCTAGTTACATGGTTGATGCATTTAAAATGACAT
ATTTCGATGTTGCTCTTAGAGCTTTATTTAGATTTTCTCCAAATTGTGTC
ACGAAAAATGGGGTTAATTGGTCGAGTATAAAGTGCATTGAAATTCTACA
GCCGATGCTACCATCAGTTGAAATGAGAATGTTGAGAATATTTATGAATT
TAGTTATTGGTATAACTTCCGGAATATGGATATGGGGAAACTCGAAAACA
TTGAAATATTGTATAAAAACCATTAGATTTTGGAAACGAACTAAAGAACT
CGAAATTCAACCAGACAATCATTGCGACTCATCAACAACTCCAAACAATT
TTCCAGTAGCCCATGCACAATCAAAACAAAATGAAACTCTCTTGCCTTAC
AATAACTGGAAATTGAATTCTTCATATCCAGCCAATGAATTCGGTTTAGC
TACTGTTTCAGTACCCAGTGAAATTATTCCTCCACCTAATAACTCATCAA
TCAGTGATTTATCCAGCAAACATTAA
back to top
Gene Groups
frizzled-like is similar in sequence to the genes of this group: GG4852
Gene NameGene ID
SMU15029711SMU15029711
frizzled-likeDdo_014376
frizzled-likeGsp_021429
Pgr_015739Pgr_015739
frizzled-likePgr_020264
frizzled-likePmo_014048

Gene Group Protein Sequences

>SMU15029711

MCINLYLYIYKTIIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQC
VPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLK
LFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSE
ELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGN
RIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHD
KVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFY
ASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSA
SALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILIL
HKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLK
VRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAY
KMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRI
FMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTI
QNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIVPPPNN
SSISDDSSRH*
>Ddo_014376 frizzled-like
GVLQTQKRFSVFIFTKYFFGYYFFAVTIIMKSIILIVIGINLLFGFVSAK
LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLI
NIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMK
ESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYN
QLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICS
ANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIV
FLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINF
LMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPA
LKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFL
SLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCT
VVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLP
SVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQ
INQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYPNIEFALPSISVPS
EVVFPPPNNSSISDASSKH*
>Gsp_021429 frizzled-like
MMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPN
SVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQ
IVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESF
SLDDLDQQNQSQGDDVQQLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQ
CLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCF
LTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSY
DDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHW
GYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQN
VLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRL
EKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCV
TKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKT
LKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY
NNWKLNSSYPANEFGLATVSVPSEIIPPPNNSSISDLSSKH*
>Pgr_015739 Pgr_015739
MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRM
PNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTS
PPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPE
SFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSE
TKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLS
SLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR
PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASR
HWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNH
LPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLK
RLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPD
CVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK
KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQN
WTYCPSVLSEPTVCGIVNEPCEGIVAPNNSSKSETSSRH*
>Pgr_020264 frizzled-like
KVGIKMRQMFFLWSGILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRY
THTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDA
EAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKM
CLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKA
GSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSL
LCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRR
NVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWF
LSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCF
VGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCID
PSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALY
EYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIW
IWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSPT
QGWNYAPVSESQSTRGVTSQTPIEGIVAPHNSSISEASSRH*
>Pmo_014048 frizzled-like
KLSVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTR
MPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAI
STPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTP
DSFSLDKEVEKEPSHVDTMKNLLQKLELSLKQSDKDKSRIDLLMKAGLYA
SAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANIWLISWSLLCLV
SSLLTIITFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVIC
RPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSAS
RHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNS
DKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNL
KRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSA
DCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGN
KKSFRYCGRNKKDIQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGWSYVP
TLASEHAVGGLSQTPVEGIMAPNNSSISEVSSKH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.