piwi-1, Gsp_021025 (mRNA) Girardia sp.

Overview
Namepiwi-1
Unique NameGsp_021025
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length4501
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of piwi-1 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 255.758 bits (652), Expect = 1.67801e-69
Identity = 217/816 (26.59%), Postives = 364/816 (44.61%), Query Frame = 1
Query:  232 KVGKDGRVVNLKSNYANFNIKIDGPFYMYDV----VMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTTSKWHS-TDDVEKFTVN--NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDIK--EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPD------DWK---FGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK------VHLALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKT-GKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
K G G +V L +N+ + Y Y + +ME + +RS L G+ FDG LF + +V T N +V I+I L +S Q NI+F + M ++IGR ++ ++ P I G++T+I + N S +L + ++VL +V+ ++ +LIG ++TKYNNKTYR+ DI + + + +G+++S+ Y++++YN + + KQP ++S+ KR GP T ++ IP ELCYL G +D R++ N+ K L + P +R ++ + + + ++ W ++ + ++ GR L + + KT D DW G V + ++ RN N+ I ++ + + + + EV+D ++RV + + + + DK A K +QCV R + + +A K +Q+ K+G + W + + + MIVGID +H T G+RS+ V SI+ +++ S E + L A+ A+ MP R I+YRDGVGD QL +E + ++ I N P++ +VVKKR++ +FF NP PGTV+D ++ +P +Y+F++VSQ G+ SPT+YNV+ D S + P +Q++TY L H+Y+NW G IRVP P YA +LA LVG +HR N + RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL-----QTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKP--LDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 255.758 bits (652), Expect = 1.67801e-69
Identity = 217/816 (26.59%), Postives = 364/816 (44.61%), Query Frame = 1
Query:  232 KVGKDGRVVNLKSNYANFNIKIDGPFYMYDV----VMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTTSKWHS-TDDVEKFTVN--NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDIK--EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPD------DWK---FGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK------VHLALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKT-GKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
K G G +V L +N+ + Y Y + +ME + +RS L G+ FDG LF + +V T N +V I+I L +S Q NI+F + M ++IGR ++ ++ P I G++T+I + N S +L + ++VL +V+ ++ +LIG ++TKYNNKTYR+ DI + + + +G+++S+ Y++++YN + + KQP ++S+ KR GP T ++ IP ELCYL G +D R++ N+ K L + P +R ++ + + + ++ W ++ + ++ GR L + + KT D DW G V + ++ RN N+ I ++ + + + + EV+D ++RV + + + + DK A K +QCV R + + +A K +Q+ K+G + W + + + MIVGID +H T G+RS+ V SI+ +++ S E + L A+ A+ MP R I+YRDGVGD QL +E + ++ I N P++ +VVKKR++ +FF NP PGTV+D ++ +P +Y+F++VSQ G+ SPT+YNV+ D S + P +Q++TY L H+Y+NW G IRVP P YA +LA LVG +HR N + RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL-----QTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKP--LDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 255.758 bits (652), Expect = 1.67801e-69
Identity = 217/816 (26.59%), Postives = 364/816 (44.61%), Query Frame = 1
Query:  232 KVGKDGRVVNLKSNYANFNIKIDGPFYMYDV----VMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTTSKWHS-TDDVEKFTVN--NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDIK--EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPD------DWK---FGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK------VHLALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKT-GKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
K G G +V L +N+ + Y Y + +ME + +RS L G+ FDG LF + +V T N +V I+I L +S Q NI+F + M ++IGR ++ ++ P I G++T+I + N S +L + ++VL +V+ ++ +LIG ++TKYNNKTYR+ DI + + + +G+++S+ Y++++YN + + KQP ++S+ KR GP T ++ IP ELCYL G +D R++ N+ K L + P +R ++ + + + ++ W ++ + ++ GR L + + KT D DW G V + ++ RN N+ I ++ + + + + EV+D ++RV + + + + DK A K +QCV R + + +A K +Q+ K+G + W + + + MIVGID +H T G+RS+ V SI+ +++ S E + L A+ A+ MP R I+YRDGVGD QL +E + ++ I N P++ +VVKKR++ +FF NP PGTV+D ++ +P +Y+F++VSQ G+ SPT+YNV+ D S + P +Q++TY L H+Y+NW G IRVP P YA +LA LVG +HR N + RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL-----QTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKP--LDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 255.758 bits (652), Expect = 1.67801e-69
Identity = 217/816 (26.59%), Postives = 364/816 (44.61%), Query Frame = 1
Query:  232 KVGKDGRVVNLKSNYANFNIKIDGPFYMYDV----VMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTTSKWHS-TDDVEKFTVN--NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDIK--EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPD------DWK---FGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK------VHLALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKT-GKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
K G G +V L +N+ + Y Y + +ME + +RS L G+ FDG LF + +V T N +V I+I L +S Q NI+F + M ++IGR ++ ++ P I G++T+I + N S +L + ++VL +V+ ++ +LIG ++TKYNNKTYR+ DI + + + +G+++S+ Y++++YN + + KQP ++S+ KR GP T ++ IP ELCYL G +D R++ N+ K L + P +R ++ + + + ++ W ++ + ++ GR L + + KT D DW G V + ++ RN N+ I ++ + + + + EV+D ++RV + + + + DK A K +QCV R + + +A K +Q+ K+G + W + + + MIVGID +H T G+RS+ V SI+ +++ S E + L A+ A+ MP R I+YRDGVGD QL +E + ++ I N P++ +VVKKR++ +FF NP PGTV+D ++ +P +Y+F++VSQ G+ SPT+YNV+ D S + P +Q++TY L H+Y+NW G IRVP P YA +LA LVG +HR N + RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL-----QTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKP--LDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 255.758 bits (652), Expect = 1.67801e-69
Identity = 217/816 (26.59%), Postives = 364/816 (44.61%), Query Frame = 1
Query:  232 KVGKDGRVVNLKSNYANFNIKIDGPFYMYDV----VMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTTSKWHS-TDDVEKFTVN--NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDIK--EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPD------DWK---FGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK------VHLALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKT-GKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
K G G +V L +N+ + Y Y + +ME + +RS L G+ FDG LF + +V T N +V I+I L +S Q NI+F + M ++IGR ++ ++ P I G++T+I + N S +L + ++VL +V+ ++ +LIG ++TKYNNKTYR+ DI + + + +G+++S+ Y++++YN + + KQP ++S+ KR GP T ++ IP ELCYL G +D R++ N+ K L + P +R ++ + + + ++ W ++ + ++ GR L + + KT D DW G V + ++ RN N+ I ++ + + + + EV+D ++RV + + + + DK A K +QCV R + + +A K +Q+ K+G + W + + + MIVGID +H T G+RS+ V SI+ +++ S E + L A+ A+ MP R I+YRDGVGD QL +E + ++ I N P++ +VVKKR++ +FF NP PGTV+D ++ +P +Y+F++VSQ G+ SPT+YNV+ D S + P +Q++TY L H+Y+NW G IRVP P YA +LA LVG +HR N + RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL-----QTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKP--LDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861
BLAST of piwi-1 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 1467.21 bits (3797), Expect = 0
Identity = 697/809 (86.16%), Postives = 755/809 (93.33%), Query Frame = 1
Query:  121 MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLM----TKSDGQPFCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRERLFYL 2535
MD TNV+ DP RP+RGGL++RFAIIEP LQP+T+TDK+GKDGRVV+LKSNYANFNIK++GPFYMYDVVME KSIR+KL+LL+ +K++GQPFCFDGRRLFTTSKWHS +D E + +VEISIRLLTTF+K+SEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI+EGPSFFKM+NFKILGGYSTTITRGTNE+GTASTLLYLERINRVLNEN+V++VYRRDQIDQLIGRDIITKYNNKTYRISDIKEM +NDE++L KISY NYFKQRYNI LKNDKQPFVISR+KRSM RPKEK+ENEPEGP ETDQSLSIPGELCYLCGFSDSERSNINLQK+LG VLKREPRERLNDI+DFCKWTG GKSKDYMK+W M IEEQPITIRGREL PVDI SN+VKIN K PDDWKFGE+KFDVPKG HRFGVLVVDRNPSHFNNFI+DVKREI RLRINYT+D+I+SCR NEVEDALT+F+RV+KVH+ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQ+F+KLGYDPWGI+LKMAPTMIVG+DTFHSKTGKRSVQASVFSIS+KFSQY+SFVNS KGKNEFHENLGKNFLTA+T FQ KF TMP R IIYRDGVGDSQL TKKFETDAVMKM+EKIYENQ LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQ+TTKGTASPTNYNVLMDTK+ NKKTNEVS M+PSVLQQITYSLTHLYFNWMGTIRVPVP HYA RLAELVG +HRG PP IN+RIRERLFYL
Sbjct: 1 MDSTNVTTDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMV-RPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808
BLAST of piwi-1 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 941.028 bits (2431), Expect = 0
Identity = 451/804 (56.09%), Postives = 590/804 (73.38%), Query Frame = 1
Query:  163 KRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLM----TKSDGQP--FCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKE--GPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKDYMKT-WNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK--VHLALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQ--NLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRERLFYL 2535
+RGGL++RF I+EP LQP DK+G G+VV L+SN+ F++ + MYD + KL+L + K P FC+DGRRLFT+ W D+++FT++ ++S+RL++TF+ +EEYYQMIN++ NN+QI MGQEKIG+ +FLGSN + + GP+FF+ NFK+LGG+ TT+ RGT +G +TLLY+ERINRVLN+NSV+ Y R IDQLIGRDI+TKYNNKTYRIS+IKEM IN+ E+ G +SY YFK+RYNI L ++QPFV++R+K+ + R K K NE E P++ D +L+I GELC+LCGFSD E+SNI+LQK+LG VLKR PRERL+DI FC W + M W + I+ P+ I GRELP D++S +IN K DDWKFG+V+F+V KG+ H V++VDRN S + NF++DV+ EI +LR + I + C N+VE +L + +R +ALVF+PDD+VYAKVK+FT+STGLLTQCVT RNG+NR+D+RR+ V+ K+VMQIF+K GYDPW I +KM PTMIVG+DTFH+K K+S+ ASVFSI+S FSQYMSF NSPKGK EFH+ L NF A+T F++ + +P R ++YRDGVGDSQL TK+FE DA+ +VE IY+ +PQIIYV+VKKRI K F G N NPGT+VD++IVKPNF+EF+LVSQR T+GTASPTNYNVL DT+Y N K + + P+ LQ+ITY+LTHLYFNWMGTIRVPVPVHYA +LAEL+G VH+G+ P INERIR RLFYL
Sbjct: 17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK-IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818
BLAST of piwi-1 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 918.687 bits (2373), Expect = 0
Identity = 448/810 (55.31%), Postives = 587/810 (72.47%), Query Frame = 1
Query:  166 RGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQ------PFCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--KEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR------PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKDYM-KTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK--VHLALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSF-VNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQN--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRERLFYL 2535
RGGLR F I+EP LQP IT+K G GR V L+SN+ F++ F MYD V + K++L Q FCFDGRRLFT+ KWH D+++F+ + ++++RL++T + +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL N + GP+FF+ +FK+LGG+ TT+ RGT G +TLLY+ERINRVLN+NSV+ Y R IDQLIGRDIITKYNNKTYRIS+IKEM ++++ E+ G +SY YFK+RYNI L QPFV++R+K+ M + E E E P+E D +L+IPGELC+LCGFSD E+SN++LQK+LG VLKREPRERL+DI +C W + M W + I+ +P+ I GRELPP D++S KIN K DDWKFG V+FD+ + H V++VDRN + NF++DV++E+ +RI+ + + +C N+VE L + R +ALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQIFAK GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI+S F+QYMSF VNSPKG+ EFHE LGKNF A+ F++++ +PQR +++RDGVGD+QL TK FE DA+ ++E IY+ +PQIIYV+VKKR+ K F G NPNPGTVVD++IVKPNFYEF+LVSQRTTKGTA+PTNYNVL DT+ KK + PMAP+ LQ+ITY+LTHLYFNWMGTIRVPVPVHYA RLAELVG VH+G+ P INERIR RLFYL
Sbjct: 25 RGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833
BLAST of piwi-1 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 280.796 bits (717), Expect = 1.96581e-77
Identity = 231/829 (27.86%), Postives = 380/829 (45.84%), Query Frame = 1
Query:  163 KRGGLRQRF---AIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDV----VMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTTSKWHSTDDV---EKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV---YRRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDI-KDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSND--VKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISR---LRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFH-SKTGKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
+RGG R+ F + L K G G + L++N+ + Y Y V ME + +RS L ++ G+ FDG LF +K + + V E VEI++ L SS Q NI+F I + ++IGR ++ + P I G+ TTI + +S +L + ++VL +V+ R+ DQ L+G I+TKYNNKTYRI DI + N+ + T+IS+ NYFK +Y + + + Q ++S +KR ++ +P E CYL G +D R++ N+ K L + P +R I + G ++ + TW ++ E + +++ GR LP I+ + N T D W + ++ ++ R + + ++S +R+ + R + AL + V + + +V +P DK K + +QCV R S + TVA K +Q+ K+G + W + + + MIVGID +H + GKRS+ A V S++ S++ S E + L + A+ A+ + ++P R I+YRDGVGD L +E +M+ ++ + ++ P++ VVVKKRIS +FF DG ANP PGTV+D ++ +P +Y+F++VSQ G +PT+YNV+ D S + P +Q++TY L H+Y+NW G +RVP P YA +LA LVG +H+ P +N + + L+YL
Sbjct: 76 ERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---------NPDDPFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP-----------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTAD-WSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNV-ARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858
BLAST of piwi-1 vs. uniprot
Match: gi|33112431|sp|Q9VKM1|PIWI_DROME (RecName: Full=Protein piwi)

HSP 1 Score: 272.707 bits (696), Expect = 7.07311e-75
Identity = 232/831 (27.92%), Postives = 384/831 (46.21%), Query Frame = 1
Query:  139 SRDPASRPKRGGLRQRFAIIE-------PT-------------LQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEP--KSIRSKLQLLMTKSD--GQPFCFDGRRLFTTSKWHSTDDV----EKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRD----------IITKYNNKTYRISDIKEMGINDE--IELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDF-CKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWK--FGEVK-FDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISR--LRINYTIDNIA-SCRGNEVEDALTEFVRVNKVHLALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHS-KTGKRSVQASVFSIS-SKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG 2469
S DP + P+ R+R A+ E PT +P + K G DG V L++N+ K + Y V EP ++ R ++ +L ++ G + FDG +LFTT K+ V K + +ISI+ + + + Q++N++ + E +GR F I+E FKME + GY T+I + + LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ + G + G IS+ Y+ +YNI +++ QP +IS+ +R K N E + IP ELC + G + RSN L +++ + P++R + ++ F + +S ++ WNM +++ ++GR + +I+ ++ K+ A DW+ F + + P R+ V+ RN +D + R S LRI + I R A+ + VR + L L +P+D Y+ +K + + TQ VT + NR ++A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L +FE +++ ++ Y L PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LVG
Sbjct: 38 SGDPRADPRIEASRERRALEEAPRREGGPTERKPWGDQYDYLNTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIE-YKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF--DPRAKIEIRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDV-DFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTNASE------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 272.707 bits (696), Expect = 8.16486e-76
Identity = 232/831 (27.92%), Postives = 384/831 (46.21%), Query Frame = 1
Query:  139 SRDPASRPKRGGLRQRFAIIE-------PT-------------LQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEP--KSIRSKLQLLMTKSD--GQPFCFDGRRLFTTSKWHSTDDV----EKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRD----------IITKYNNKTYRISDIKEMGINDE--IELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDF-CKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWK--FGEVK-FDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISR--LRINYTIDNIA-SCRGNEVEDALTEFVRVNKVHLALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHS-KTGKRSVQASVFSIS-SKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG 2469
S DP + P+ R+R A+ E PT +P + K G DG V L++N+ K + Y V EP ++ R ++ +L ++ G + FDG +LFTT K+ V K + +ISI+ + + + Q++N++ + E +GR F I+E FKME + GY T+I + + LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ + G + G IS+ Y+ +YNI +++ QP +IS+ +R K N E + IP ELC + G + RSN L +++ + P++R + ++ F + +S ++ WNM +++ ++GR + +I+ ++ K+ A DW+ F + + P R+ V+ RN +D + R S LRI + I R A+ + VR + L L +P+D Y+ +K + + TQ VT + NR ++A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L +FE +++ ++ Y L PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LVG
Sbjct: 38 SGDPRADPRIEASRERRALEEAPRREGGPTERKPWGDQYDYLNTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIE-YKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF--DPRAKIEIRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDV-DFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTNASE------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 272.707 bits (696), Expect = 8.16486e-76
Identity = 232/831 (27.92%), Postives = 384/831 (46.21%), Query Frame = 1
Query:  139 SRDPASRPKRGGLRQRFAIIE-------PT-------------LQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEP--KSIRSKLQLLMTKSD--GQPFCFDGRRLFTTSKWHSTDDV----EKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRD----------IITKYNNKTYRISDIKEMGINDE--IELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDF-CKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWK--FGEVK-FDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISR--LRINYTIDNIA-SCRGNEVEDALTEFVRVNKVHLALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHS-KTGKRSVQASVFSIS-SKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG 2469
S DP + P+ R+R A+ E PT +P + K G DG V L++N+ K + Y V EP ++ R ++ +L ++ G + FDG +LFTT K+ V K + +ISI+ + + + Q++N++ + E +GR F I+E FKME + GY T+I + + LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ + G + G IS+ Y+ +YNI +++ QP +IS+ +R K N E + IP ELC + G + RSN L +++ + P++R + ++ F + +S ++ WNM +++ ++GR + +I+ ++ K+ A DW+ F + + P R+ V+ RN +D + R S LRI + I R A+ + VR + L L +P+D Y+ +K + + TQ VT + NR ++A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L +FE +++ ++ Y L PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LVG
Sbjct: 38 SGDPRADPRIEASRERRALEEAPRREGGPTERKPWGDQYDYLNTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIE-YKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF--DPRAKIEIRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDV-DFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTNASE------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 267.314 bits (682), Expect = 3.12449e-74
Identity = 224/808 (27.72%), Postives = 391/808 (48.39%), Query Frame = 1
Query:  166 RGGLRQRFAIIEPTL-QPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQ---LLMTKSDGQPFCFDGRRLFTTSKWHSTDD----VEKFTVN----NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFK--ILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQID-------QLIGRDIITKYNNKTYRISDIKEMGIN-DEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGK-SKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKI---NAKTPDDWKFGEVKFDVPKGI-THRFGVLVVDRNPSHFNNFIDDVKREISRLRINYT---IDNIASCRGNEVEDALTEFVRVNKVHLALVFI--PDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRR--KTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGK-RSVQASVFSISSKFS-QYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYEN---QNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG 2469
RG +R R I + +P +T K G G + +++NY + + Y Y V P ++L+ L K + FDG +F +++ + D +E T + N+EI I+ + + + E +Q++N++ + + + R ++ + + +ENF+ + GY T+I + N+ S + + ++ R ++++ RD D ++G I+T YNNKTYRI D+ + + N +ISY +Y+K+RYNI +++ KQP V+SR P +K N G DQ++ I EL G +D+ R++ +++ + P R+ ++ F K K S + +K+WN+ ++ + I R LPP I+ + KI +A+ DW + K + +R+ V+ RN F+ R S +++N + I R A+ + N + +V + P+++ Y+ +K T + + +Q VT + + R + ++A K V+Q+ AKL PW + + + M VG D HS K +S A V ++ K S +Y S VN E E + N A+ ++Q++ ++P+R + +RDGVGD QL+ E + + +++IY++ Q ++ +++V KRI+ ++F NP PGTVVD+ I P Y+F+LVSQ GT SPT+YNV+ D N LQ ++Y +TH+Y+N+ GTIRVP HYA +LA LV
Sbjct: 9 RGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR--------PTDK--NIRGG---NDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAI-DNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVA 777
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 267.314 bits (682), Expect = 7.48485e-74
Identity = 224/808 (27.72%), Postives = 391/808 (48.39%), Query Frame = 1
Query:  166 RGGLRQRFAIIEPTL-QPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQ---LLMTKSDGQPFCFDGRRLFTTSKWHSTDD----VEKFTVN----NVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFK--ILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQID-------QLIGRDIITKYNNKTYRISDIKEMGIN-DEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGK-SKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKI---NAKTPDDWKFGEVKFDVPKGI-THRFGVLVVDRNPSHFNNFIDDVKREISRLRINYT---IDNIASCRGNEVEDALTEFVRVNKVHLALVFI--PDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRR--KTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGK-RSVQASVFSISSKFS-QYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYEN---QNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG 2469
RG +R R I + +P +T K G G + +++NY + + Y Y V P ++L+ L K + FDG +F +++ + D +E T + N+EI I+ + + + E +Q++N++ + + + R ++ + + +ENF+ + GY T+I + N+ S + + ++ R ++++ RD D ++G I+T YNNKTYRI D+ + + N +ISY +Y+K+RYNI +++ KQP V+SR P +K N G DQ++ I EL G +D+ R++ +++ + P R+ ++ F K K S + +K+WN+ ++ + I R LPP I+ + KI +A+ DW + K + +R+ V+ RN F+ R S +++N + I R A+ + N + +V + P+++ Y+ +K T + + +Q VT + + R + ++A K V+Q+ AKL PW + + + M VG D HS K +S A V ++ K S +Y S VN E E + N A+ ++Q++ ++P+R + +RDGVGD QL+ E + + +++IY++ Q ++ +++V KRI+ ++F NP PGTVVD+ I P Y+F+LVSQ GT SPT+YNV+ D N LQ ++Y +TH+Y+N+ GTIRVP HYA +LA LV
Sbjct: 80 RGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR--------PTDK--NIRGG---NDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAI-DNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVA 848
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 263.462 bits (672), Expect = 1.76112e-72
Identity = 221/833 (26.53%), Postives = 383/833 (45.98%), Query Frame = 1
Query:  127 ITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEP--KSIRSKLQLLMTKSD--GQPFCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCK-WTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHF-NNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVN-----KVHLALVFIPDDKVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGK-RSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVG-IVHRGTAPPTINERIRERLFYL 2535
IT+ S++ ++ +G + A P+ I G G VN+ NY + Y+V P S+ +++ L D G FDG L+ + V +VE+ IR+L + Q+ NI+F+ + + K R+ F S P + ++ GY T + ++ +L + +R+L + +V+ + Y+ L+G ++T+YNN+TY+I+DI + + E+ SY Y+KQ +NI +K+ QP + S +KS P +E Q IP ELCYL G D RS+ L + + + P +R + F + + +++ + +W +++ I GR++ I + + ++A ++ V ++ K + +++ RN + +D++K+ L +N + + S + + DA + +R N ++ + + D YA +K S + +Q + + N D + ++V K V+Q+ KLG W + + MI GID++H + + SV A V SI+S +SQ+ S + E L +F A+ ++++ G +P IIYRDG+GD QL+ +E + E + N+ +I Y+VV+KRI+ + F NP PGTVVD+ I K N Y+F+LVSQ +GT +PT+Y VL D CN P ++Q+++Y L LY+NW GT+R+P YA +LA L+G + R A E + E+LFYL
Sbjct: 88 ITSESKENITKKTKGPESEAIASENGLFFPDLI---YGSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS----------IKKSRGIP-AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRI-DAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQN--DLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD--CN--------YGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVA-----EALSEKLFYL 867
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 1467.6 bits (3798), Expect = 0
Identity = 699/812 (86.08%), Postives = 757/812 (93.23%), Query Frame = 1
Query:  115 Y*MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLM----TKSDGQPFCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRERLFYL* 2538
Y MD TNV+ DP RP+RGGL++RFAIIEP LQP+T+TDK+GKDGRVV+LKSNYANFNIK++GPFYMYDVVME KSIR+KL+LL+ +K++GQPFCFDGRRLFTTSKWHS +D E + +VEISIRLLTTF+K+SEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI+EGPSFFKM+NFKILGGYSTTITRGTNE+GTASTLLYLERINRVLNEN+V++VYRRDQIDQLIGRDIITKYNNKTYRISDIKEM +NDE++L KISY NYFKQRYNI LKNDKQPFVISR+KRSM RPKEK+ENEPEGP ETDQSLSIPGELCYLCGFSDSERSNINLQK+LG VLKREPRERLNDI+DFCKWTG GKSKDYMK+W M IEEQPITIRGREL PVDI SN+VKIN K PDDWKFGE+KFDVPKG HRFGVLVVDRNPSHFNNFI+DVKREI RLRINYT+D+I+SCR NEVEDALT+F+RV+KVH+ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQ+F+KLGYDPWGI+LKMAPTMIVG+DTFHSKTGKRSVQASVFSIS+KFSQY+SFVNS KGKNEFHENLGKNFLTA+T FQ KF TMP R IIYRDGVGDSQL TKKFETDAVMKM+EKIYENQ LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQ+TTKGTASPTNYNVLMDTK+ NKKTNEVS M+PSVLQQITYSLTHLYFNWMGTIRVPVP HYA RLAELVG +HRG PP IN+RIRERLFYL*
Sbjct: 42 YEMDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMV-RPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 922.539 bits (2383), Expect = 0
Identity = 449/814 (55.16%), Postives = 591/814 (72.60%), Query Frame = 1
Query:  166 RGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSNYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQ------PFCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--KEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR----------PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKDYM-KTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNK--VHLALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQN--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRERLFYL* 2538
RGGLR+ F I+EP LQP IT+K G GR V L+SN+ F++ F MYD V + K++L Q FCFDGRRLFT+ KWH D+++F+ + ++++RL++T + +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL N + GP+FF+ +FK+LGG+ TT+ RGT G +TLLY+ERINRVLN+NSV+ Y R IDQLIGRDIITKYNNKTYRIS+IKEM ++++ E+ G +SY YFK+RYNI L QPFV++R+K+ M +++ E E E P+E D +L+IPGELC+LCGFSD E+SN++LQK+LG VLKREPRERL+DI +C W + M W + I+ +P+ I GRELPP D++S KIN K DDWKFG V+FD+ + H V++VDRN + NF++DV++E+ +RI+ + + +C N+VE L + R +ALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQIFAK GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI+S F+QYMSFVNSPKG+ EFHE LGKNF A+ F++++ +PQR +++RDGVGD+QL TK FE DA+ ++E IY+ +PQIIYV+VKKR+ K F G NPNPGTVVD++IVKPNFYEF+LVSQRTTKGTA+PTNYNVL DT+ KK + PMAP+ LQ+ITY+LTHLYFNWMGTIRVPVPVHYA RLAELVG VH+G+ P INERIR RLFYL*
Sbjct: 25 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 237.269 bits (604), Expect = 6.31738e-64
Identity = 216/806 (26.80%), Postives = 369/806 (45.78%), Query Frame = 1
Query:  256 VNLKSNYANFNIKIDGP-FYMYDVVMEP----KSIRSKLQLLMTKSD----GQPFCFDGRRLFTTSKWHSTDDVEKFTVNNVEISIRLLTTFVKSS--EEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY-------------RRDQIDQLIGRDIITKYNNKTYRISDIK-EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRI-KRSMTHRPKEKSENEPEGPKETDQSLS--IPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERLNDIKDFC-KWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI-MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNP-SHFNNFIDDVKREISRLRINYTIDNIASCRGNEVEDALTEFVR-----VNKVHLALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDPWGISLKMAPTMIVGIDTFHSKTGK-RSVQASVFSISSKFSQYMSFVNSPKGKNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFETDAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRERLFYL* 2538
+ L +NY ++ P Y Y V P + +R K+ +++SD + FDG L+ + + + K + + + F + E + N++F I+ + KIGR +F E +I GY T+I N DG LL + ++V+ +SV + + I+QL+G+ ++T +NN+ YRI+DI E + G KISY +YFK Y + +++ +QP ++S+ RS +R P+G KE D L IP ELC L G +D + L + L + P++R + +F ++K + W +TIE+ + I ++ P I N+ ++A ++K V GI +L+ ++ + N + + + R+ + + I + E+ L E R V V L + +D+ Y +K F + + +Q V + + ++ + +VA +QI AKLG + W + + + M+VG+D +H G+ RSV A V S ++ +++ S + + E L L+ + A+ ++ +P+ +YRDGV D QL +K E + K+ E + P ++Y VV+KRI+ + + NPNPGT+VD + + N Y+F+LVSQ +GT +PT+Y VL D S P +Q + Y H+Y+NW GT+RVP P YA +LA +VG A P+ + +RLFYL*
Sbjct: 212 LTLSANYVK--VRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFY---------PEKKIVLDRRRMEIWPGYVTSIQ---NFDG--GLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNR-------GPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK-PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVG--QNLKAEPS--NLLCDRLFYL* 975
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15015027 (SmedAsxldir_c97534_g1_i3|m.40524|m.26292)

HSP 1 Score: 111.309 bits (277), Expect = 7.74542e-28
Identity = 55/74 (74.32%), Postives = 61/74 (82.43%), Query Frame = 1
Query:  880 MGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCY 1101
M +NDE++L KISY NYFKQRYNI LKND+QPFVISR+KRS+ R KEK ENEPEGP ETDQSLSI GEL Y
Sbjct: 1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSVV-RQKEKIENEPEGPTETDQSLSISGELGY 73
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15019034 (SmedSxldir_c108571_g1_i1|m.79372|m.45480)

HSP 1 Score: 114.005 bits (284), Expect = 1.6868e-27
Identity = 65/189 (34.39%), Postives = 108/189 (57.14%), Query Frame = 3
Query: 2919 NSNASFYLTIEKKKKGISARSAAIEICEVEGDKFVSKTTAIKWFKRFNFSNTGINDDSRSGRPRTVDTQAIMLSVDENPCTSVRRLSDEVQIPKSSVHRKRTAHGKRNRKCKVFPHELTPEQAEKRLLICEQLLRYPNDERFLKTIVTCDEKWLYFRNPDLRNQWLDPNQSPIPVTKCQRFENKVLLCV 3485
N +SF+ + +KG+S R+A VEG V ++ A +WFKRFN + ++D RP ++ A++ +++E+ S R L+ +++ +VH ++ + P+ LT QA+KR+ IC+QLL+ P D+RF + IVTCDEKW+YF N + QW+ + P PV + RF K ++C+
Sbjct: 6 NRYSSFFTPL--LEKGLSTRAA------VEGKGTVKESAAAEWFKRFNDGDLSLDDKPLFRRPSALNENALVDALNEDKHASTRYLATSLRVCNKTVHNNLQHLHYTLKRPRQDPYNLTDAQAKKRVEICQQLLKNPTDDRFCRRIVTCDEKWIYFVNNNRLKQWVKHGEEPEPVIRQDRF-GKNVVCI 185
The following BLAST results are available for this feature:
BLAST of piwi-1 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|1.678010e-6926.59piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|1.678010e-6926.59PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|1.678010e-6926.59PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|1.678010e-6926.59PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|1.678010e-6926.59PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of piwi-1 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000000e+086.16RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000000e+056.09RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000000e+055.31RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE1.965810e-7727.86RecName: Full=Piwi-like protein 1[more]
gi|33112431|sp|Q9VKM1|PIWI_DROME7.073110e-7527.92RecName: Full=Protein piwi[more]
back to top
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|8.164860e-7627.92piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|8.164860e-7627.92piwi, isoform B [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|3.124490e-7427.72aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|7.484850e-7427.72aubergine, isoform A [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|1.761120e-7226.53argonaute 3, isoform D [Drosophila melanogaster][more]
back to top
BLAST of piwi-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150261770.000000e+086.08SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159470.000000e+055.16SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150001116.317380e-6426.80Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150150277.745420e-2874.32SmedAsxldir_c97534_g1_i3|m.40524|m.26292[more]
SMU150190341.686800e-2734.39SmedSxldir_c108571_g1_i1|m.79372|m.45480[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_021025 ID=Gsp_021025|Name=piwi-1|organism=Girardia sp.|type=mRNA|length=4501bp
AATAATTACAATTAATATTGTTATTTAATATTATTTAATAATATTAATAA
ATAATATAATAATTAATTCATTTTGTTTGAAATTTAATTATTTGCTGTCT
TTGTTCTTCGAAAATATTAAATGGATATAACTAATGTATCAAGAGATCCT
GCTTCGAGACCGAAGAGAGGAGGTCTTCGGCAAAGATTTGCAATAATCGA
GCCAACTTTGCAACCAGAAACAATTACTGACAAGGTCGGCAAAGATGGTA
GAGTCGTCAATTTAAAATCCAACTATGCCAACTTTAACATTAAAATTGAT
GGTCCTTTTTATATGTATGATGTTGTTATGGAGCCAAAAAGTATTCGGTC
CAAACTGCAATTATTGATGACAAAAAGTGATGGGCAGCCATTTTGTTTTG
ATGGTCGTAGATTATTTACTACTTCTAAATGGCATTCAACGGATGATGTA
GAGAAATTTACTGTTAACAACGTCGAAATTTCAATAAGGTTGCTGACAAC
ATTTGTAAAAAGTTCTGAAGAATATTATCAAATGATTAATATTGTGTTTA
ATAATATTCAAATTTTTATGGGACAAGAGAAAATTGGGCGACAATTTTTT
TTGGGTTCGAATTGTGAGAGTGGTGGAATAAAAGAGGGTCCGAGTTTTTT
CAAAATGGAGAATTTTAAAATTTTGGGCGGTTATTCAACTACCATTACCA
GGGGTACTAATGAAGATGGAACAGCTTCAACTTTATTATACTTAGAAAGA
ATAAATCGTGTTCTTAATGAAAATTCGGTAATCGCTGTTTATAGAAGAGA
TCAAATCGATCAATTAATAGGGCGAGACATCATTACCAAATACAATAATA
AAACATACAGAATATCCGATATTAAAGAAATGGGTATTAATGACGAAATT
GAATTGAATGGCACTAAAATTTCGTATTACAATTACTTTAAACAGCGTTA
TAATATTACTTTGAAAAACGACAAGCAGCCATTTGTTATTTCTAGAATCA
AAAGATCAATGACTCATCGGCCTAAGGAAAAAAGTGAAAATGAACCAGAA
GGTCCAAAGGAAACGGATCAAAGTTTATCCATTCCAGGTGAATTGTGTTA
TTTATGCGGATTTTCTGATAGTGAAAGAAGCAATATAAATCTACAAAAAA
GTTTAGGTGGTGTGCTAAAAAGAGAGCCTCGTGAAAGATTAAACGATATA
AAAGATTTTTGCAAATGGACAGGTGGGGGCAAATCCAAAGATTATATGAA
AACCTGGAATATGACTATTGAGGAACAGCCTATTACGATACGAGGTCGTG
AATTACCTCCGGTAGATATTATGTCCAACGATGTTAAAATTAATGCTAAA
ACTCCAGATGATTGGAAATTTGGTGAAGTAAAATTTGATGTTCCTAAAGG
TATAACGCATAGATTTGGCGTTTTAGTTGTAGATCGTAATCCTAGTCATT
TTAATAATTTTATCGATGATGTAAAAAGAGAAATTAGTAGGCTCAGAATT
AATTACACTATTGATAATATAGCTTCTTGTAGGGGTAATGAAGTTGAAGA
CGCTCTTACTGAATTTGTTCGTGTTAACAAAGTTCATTTGGCGTTAGTAT
TTATACCTGATGATAAGGTATATGCAAAAGTCAAAAACTTTACTATGTCT
ACTGGATTGTTGACACAATGTGTGACTCAAAGAAATGGAAGTAACCGAGA
TGATAGACGCCGTAAGACCGTGGCTGATAAATCTGTTATGCAGATATTTG
CTAAATTAGGATACGATCCGTGGGGTATCAGTTTAAAGATGGCTCCAACA
ATGATTGTAGGAATAGATACTTTCCATAGTAAAACTGGTAAGAGATCGGT
ACAAGCATCCGTGTTTTCTATAAGTTCTAAGTTTTCTCAGTATATGAGTT
TTGTCAATTCCCCTAAGGGTAAAAATGAATTTCATGAGAACTTGGGCAAA
AATTTCTTAACGGCAATTACTGCATTCCAACAAAAATTTGGCACTATGCC
TCAACGATTTATTATCTATCGTGATGGGGTAGGAGATTCCCAATTATTCC
TCACGAAAAAATTCGAGACAGATGCTGTAATGAAAATGGTCGAAAAGATT
TATGAGAATCAAAATTTGCCTCAAATAATTTATGTAGTTGTTAAAAAACG
GATTAGTGTAAAATTCTTTAAAGATGGAGCTAATCCGAATCCGGGAACAG
TGGTTGATGAAAAGATTGTTAAACCTAACTTTTATGAATTCTATTTGGTT
TCACAGCGAACTACTAAAGGAACAGCATCTCCAACGAATTATAATGTTCT
TATGGATACGAAGTATTGTAATAAGAAAACCAACGAAGTGTCCCCAATGG
CTCCAAGCGTTTTGCAACAAATAACTTACTCTCTTACTCACTTGTATTTT
AATTGGATGGGTACAATAAGAGTTCCTGTACCCGTTCATTATGCAGATCG
TTTGGCAGAGTTGGTCGGAATAGTACATCGTGGAACTGCTCCCCCAACCA
TTAATGAGAGAATTAGGGAACGCTTATTTTATTTATAGAATAGCTGTCTA
TGTCAATTTTTCCCACTTATGTTATTATTGGTGTCTAATAAAAAAATTAT
TTTTGTAGCGTGTTATAATTACTTTTTTTGAATTAATGCAAGTTAACAAA
AATAAAGATCATTGTTGTAATTCATTTTATTTAAATGATATAGTACATTT
TACAATTGAACCTTTTTATTTATCTGAAGTGTAAATTTGGTTTCTTCGTT
TTCTTTTAAAACAACCCCATAGATTGCAAAAGAATTTTTTCTCTAAATAT
ATATTGTTTGGTTGGTATCTGTTCAAATTTTTCCAATTTGTTGGTATTTC
ATTAATTTCTTCAGTTTGTTCAAATGACCACGAAAATGCAATGAGAAAAC
ATGTTATCAATATAAAACAATTCAAACGCATCATTTTATTTGACGATCGA
AAAAAAAAAAAAAGGAATCAGTGCCAGATCTGCTGCAATTGAAATTTGTG
AAGTTGAAGGAGACAAATTTGTCAGTAAAACCACAGCTATAAAATGGTTT
AAAAGATTCAATTTTAGCAATACGGGTATTAATGATGATTCACGTTCTGG
AAGACCCAGGACAGTTGATACCCAAGCAATTATGCTTTCTGTGGATGAAA
ATCCTTGTACCAGTGTTCGAAGACTTTCAGACGAAGTTCAAATTCCAAAA
TCTTCAGTACACCGCAAACGTACAGCTCATGGCAAGAGAAATAGGAAATG
CAAAGTTTTTCCTCATGAACTGACTCCCGAACAAGCTGAAAAACGTTTGC
TAATCTGTGAACAACTCCTTCGCTATCCAAATGATGAACGATTTCTGAAA
ACCATCGTTACTTGCGATGAGAAATGGCTGTACTTCCGAAATCCAGACTT
GCGGAATCAGTGGTTAGACCCTAACCAGAGTCCCATACCGGTTACCAAGT
GCCAACGATTTGAAAACAAGGTTTTGTTGTGTGTTTGGTGGAATTACGAG
GGGCCTGTGCACTGGGAACTTCTTCCGGATGGTCGAACTATCGATGGTAA
TATTTATGCTGAACAACTACAGCGAGTGCATGATGCTTTGAGCACTCGTT
ATCCAGCTATGTTGAATCGTGGTAAAACACTCCTACAGCATGATAATGCT
CCAACTCATACATCACGAATAGTGAAGCGGAAAATTCAGGAACTGCAAGG
CATCGAAGTCATACCCAGCGTATAGCCCGGATCTTGCTCCTTCTGATTAC
CATATGTTTCTCTCTCTGTCACATTTCTTACGAGGGAGAAGCTTTGGTTC
AGAGAAAGAGGTCAAAAATGGAATCATCAAAAAAACCTGAGTGGTATCGC
CATGGAATTGAGCAATTGTCAGAAAGATGGCTTCGAGTTAAAGAAAATGA
TGAACTATATTTAGAGGATTAATATGATCTGTGTTAAAAAAATTTTGTAA
ATAAAACATTTGCATAAAAACATGAATAACATTTGACTCAATCTAATATG
TGAGGTTGTAAATTTGTATTGAAATATTATTACAGATATTCGAAGATGTA
AAAGTTGTATCTTAATTTTATAAGGTTATAAATGTATTTTATTTTAAATC
TATTATTATCTTAAGCTGGTGTTCTGATTTGATCTATCAATTTAAATGTA
ATAGATGTAATACTTTAGAGAAATTTGTCGTCATCTATACATTGGAGTTC
AAGAGCATAATCGAAATAGTAGTATTGTTTATTCGGAATTATGTTCGAAG
CTGTGATGATAAAGACAAAATCCTAAAATTAATATCACTCATTATTATTT
TACTGATTATTACTTGGGATTGAACGTTTCTAACTTTATTTTGTTTATTT
CAGTGATTTTCTAGCTGCCCGATGACAACGATTATTCCCTCAAAATTAAT
TGTTGTGATATTTTTTGATTTGGAATTTTATGACTAAAACTAATTGAGCA
ATAGTTTCTAGTCAAGACTATGTCGAAATAATAGACAATTGATAAATTTT
A

Design Primers for piwi-1

back to top

protein sequence

>Gsp_021025-protein ID=Gsp_021025-protein|Name=piwi-1|organism=Girardia sp.|type=polypeptide|length=806bp
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
back to top

coding sequence

>Gsp_021025.121.2538 ID=Gsp_021025.121.2538|Name=Gsp_021025.121.2538|organism=Girardia sp.|type=CDS|length=2418bp
ATGGATATAACTAATGTATCAAGAGATCCTGCTTCGAGACCGAAGAGAGG
AGGTCTTCGGCAAAGATTTGCAATAATCGAGCCAACTTTGCAACCAGAAA
CAATTACTGACAAGGTCGGCAAAGATGGTAGAGTCGTCAATTTAAAATCC
AACTATGCCAACTTTAACATTAAAATTGATGGTCCTTTTTATATGTATGA
TGTTGTTATGGAGCCAAAAAGTATTCGGTCCAAACTGCAATTATTGATGA
CAAAAAGTGATGGGCAGCCATTTTGTTTTGATGGTCGTAGATTATTTACT
ACTTCTAAATGGCATTCAACGGATGATGTAGAGAAATTTACTGTTAACAA
CGTCGAAATTTCAATAAGGTTGCTGACAACATTTGTAAAAAGTTCTGAAG
AATATTATCAAATGATTAATATTGTGTTTAATAATATTCAAATTTTTATG
GGACAAGAGAAAATTGGGCGACAATTTTTTTTGGGTTCGAATTGTGAGAG
TGGTGGAATAAAAGAGGGTCCGAGTTTTTTCAAAATGGAGAATTTTAAAA
TTTTGGGCGGTTATTCAACTACCATTACCAGGGGTACTAATGAAGATGGA
ACAGCTTCAACTTTATTATACTTAGAAAGAATAAATCGTGTTCTTAATGA
AAATTCGGTAATCGCTGTTTATAGAAGAGATCAAATCGATCAATTAATAG
GGCGAGACATCATTACCAAATACAATAATAAAACATACAGAATATCCGAT
ATTAAAGAAATGGGTATTAATGACGAAATTGAATTGAATGGCACTAAAAT
TTCGTATTACAATTACTTTAAACAGCGTTATAATATTACTTTGAAAAACG
ACAAGCAGCCATTTGTTATTTCTAGAATCAAAAGATCAATGACTCATCGG
CCTAAGGAAAAAAGTGAAAATGAACCAGAAGGTCCAAAGGAAACGGATCA
AAGTTTATCCATTCCAGGTGAATTGTGTTATTTATGCGGATTTTCTGATA
GTGAAAGAAGCAATATAAATCTACAAAAAAGTTTAGGTGGTGTGCTAAAA
AGAGAGCCTCGTGAAAGATTAAACGATATAAAAGATTTTTGCAAATGGAC
AGGTGGGGGCAAATCCAAAGATTATATGAAAACCTGGAATATGACTATTG
AGGAACAGCCTATTACGATACGAGGTCGTGAATTACCTCCGGTAGATATT
ATGTCCAACGATGTTAAAATTAATGCTAAAACTCCAGATGATTGGAAATT
TGGTGAAGTAAAATTTGATGTTCCTAAAGGTATAACGCATAGATTTGGCG
TTTTAGTTGTAGATCGTAATCCTAGTCATTTTAATAATTTTATCGATGAT
GTAAAAAGAGAAATTAGTAGGCTCAGAATTAATTACACTATTGATAATAT
AGCTTCTTGTAGGGGTAATGAAGTTGAAGACGCTCTTACTGAATTTGTTC
GTGTTAACAAAGTTCATTTGGCGTTAGTATTTATACCTGATGATAAGGTA
TATGCAAAAGTCAAAAACTTTACTATGTCTACTGGATTGTTGACACAATG
TGTGACTCAAAGAAATGGAAGTAACCGAGATGATAGACGCCGTAAGACCG
TGGCTGATAAATCTGTTATGCAGATATTTGCTAAATTAGGATACGATCCG
TGGGGTATCAGTTTAAAGATGGCTCCAACAATGATTGTAGGAATAGATAC
TTTCCATAGTAAAACTGGTAAGAGATCGGTACAAGCATCCGTGTTTTCTA
TAAGTTCTAAGTTTTCTCAGTATATGAGTTTTGTCAATTCCCCTAAGGGT
AAAAATGAATTTCATGAGAACTTGGGCAAAAATTTCTTAACGGCAATTAC
TGCATTCCAACAAAAATTTGGCACTATGCCTCAACGATTTATTATCTATC
GTGATGGGGTAGGAGATTCCCAATTATTCCTCACGAAAAAATTCGAGACA
GATGCTGTAATGAAAATGGTCGAAAAGATTTATGAGAATCAAAATTTGCC
TCAAATAATTTATGTAGTTGTTAAAAAACGGATTAGTGTAAAATTCTTTA
AAGATGGAGCTAATCCGAATCCGGGAACAGTGGTTGATGAAAAGATTGTT
AAACCTAACTTTTATGAATTCTATTTGGTTTCACAGCGAACTACTAAAGG
AACAGCATCTCCAACGAATTATAATGTTCTTATGGATACGAAGTATTGTA
ATAAGAAAACCAACGAAGTGTCCCCAATGGCTCCAAGCGTTTTGCAACAA
ATAACTTACTCTCTTACTCACTTGTATTTTAATTGGATGGGTACAATAAG
AGTTCCTGTACCCGTTCATTATGCAGATCGTTTGGCAGAGTTGGTCGGAA
TAGTACATCGTGGAACTGCTCCCCCAACCATTAATGAGAGAATTAGGGAA
CGCTTATTTTATTTATAG
back to top
Gene Groups
piwi-1 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.