laminin, Gsp_020815 (mRNA) Girardia sp.

Overview
Namelaminin
Unique NameGsp_020815
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length3609
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of laminin vs. RefSeq Human
Match: gi|578798995|ref|XP_006710657.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X2 [Homo sapiens])

HSP 1 Score: 190.274 bits (482), Expect = 1.0816e-47
Identity = 137/503 (27.24%), Postives = 219/503 (43.54%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APDFSVSVSKGLICQKPYYNNDAWYPE---MCLRCYCSNVTDDCTSATGY-------ITKPE---------PIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPV--YASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
C + C+N CI + CDG++DC D SDE D C PN C N C +K W+CDG DC + DE NCP K G T F C + N IP S+ CD E DC DE C PQV+ P ++ I T+ TC G P P I+WR NW H+P +H T TS TL+I+D+ G Y+CE ++ R ++ PD + L+ Q+ + +Y E CL C+C +T C S + +P+ P + G P ++ L+ E ++ + + ++++++ +P Q + G + G L+ Y + Y+L P+ ++M G YRL + + N R + +++W ++ PV R +++ VL+ + L + Y +S ++M + + +E+C CP+G+SGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP---SHPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLE----LVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPP-----LSSTQLQIDPSLHEFQLVDLSR-RFLVHDSFWA--LPEQ--FLGNKVDSYGGSLR---YNVRYELARGMLEPVQRPDVVLM-----------GAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 761
BLAST of laminin vs. RefSeq Human
Match: gi|578799001|ref|XP_006710660.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X9 [Homo sapiens])

HSP 1 Score: 189.889 bits (481), Expect = 1.22844e-47
Identity = 137/503 (27.24%), Postives = 219/503 (43.54%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APDFSVSVSKGLICQKPYYNNDAWYPE---MCLRCYCSNVTDDCTSATGY-------ITKPE---------PIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPV--YASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
C + C+N CI + CDG++DC D SDE D C PN C N C +K W+CDG DC + DE NCP K G T F C + N IP S+ CD E DC DE C PQV+ P ++ I T+ TC G P P I+WR NW H+P +H T TS TL+I+D+ G Y+CE ++ R ++ PD + L+ Q+ + +Y E CL C+C +T C S + +P+ P + G P ++ L+ E ++ + + ++++++ +P Q + G + G L+ Y + Y+L P+ ++M G YRL + + N R + +++W ++ PV R +++ VL+ + L + Y +S ++M + + +E+C CP+G+SGLSCE+
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP---SHPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLE----LVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPP-----LSSTQLQIDPSLHEFQLVDLSR-RFLVHDSFWA--LPEQ--FLGNKVDSYGGSLR---YNVRYELARGMLEPVQRPDVVLM-----------GAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 744
BLAST of laminin vs. RefSeq Human
Match: gi|126012571|ref|NP_005520.4| (basement membrane-specific heparan sulfate proteoglycan core protein isoform b precursor [Homo sapiens])

HSP 1 Score: 189.889 bits (481), Expect = 1.34883e-47
Identity = 137/503 (27.24%), Postives = 219/503 (43.54%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APDFSVSVSKGLICQKPYYNNDAWYPE---MCLRCYCSNVTDDCTSATGY-------ITKPE---------PIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPV--YASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
C + C+N CI + CDG++DC D SDE D C PN C N C +K W+CDG DC + DE NCP K G T F C + N IP S+ CD E DC DE C PQV+ P ++ I T+ TC G P P I+WR NW H+P +H T TS TL+I+D+ G Y+CE ++ R ++ PD + L+ Q+ + +Y E CL C+C +T C S + +P+ P + G P ++ L+ E ++ + + ++++++ +P Q + G + G L+ Y + Y+L P+ ++M G YRL + + N R + +++W ++ PV R +++ VL+ + L + Y +S ++M + + +E+C CP+G+SGLSCE+
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP---SHPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLE----LVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPP-----LSSTQLQIDPSLHEFQLVDLSR-RFLVHDSFWA--LPEQ--FLGNKVDSYGGSLR---YNVRYELARGMLEPVQRPDVVLM-----------GAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 744
BLAST of laminin vs. RefSeq Human
Match: gi|767903961|ref|XP_011539621.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X6 [Homo sapiens])

HSP 1 Score: 188.734 bits (478), Expect = 2.90257e-47
Identity = 134/502 (26.69%), Postives = 217/502 (43.23%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APD--FSVSVSKGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGY-------ITKPE---------PIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPV--YASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
C + C+N CI + CDG++DC D SDE D C PN C N C +K W+CDG DC + DE NCP K G T F C + N IP S+ CD E DC DE C PQV+ P ++ I T+ TC G P P I+WR NW H+P +H T TS TL+I+D+ G Y+CE ++ R ++ PD + + C ++ + + CL C+C +T C S + +P+ P + G P ++ L+ E ++ + + ++++++ +P Q + G + G L+ Y + Y+L P+ ++M G YRL + + N R + +++W ++ PV R +++ VL+ + L + Y +S ++M + + +E+C CP+G+SGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP---SHPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPP-----LSSTQLQIDPSLHEFQLVDLSR-RFLVHDSFWA--LPEQ--FLGNKVDSYGGSLR---YNVRYELARGMLEPVQRPDVVLM-----------GAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 762
BLAST of laminin vs. RefSeq Human
Match: gi|767903954|ref|XP_011539619.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X1 [Homo sapiens])

HSP 1 Score: 188.348 bits (477), Expect = 3.85319e-47
Identity = 134/502 (26.69%), Postives = 217/502 (43.23%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APD--FSVSVSKGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGY-------ITKPE---------PIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPV--YASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
C + C+N CI + CDG++DC D SDE D C PN C N C +K W+CDG DC + DE NCP K G T F C + N IP S+ CD E DC DE C PQV+ P ++ I T+ TC G P P I+WR NW H+P +H T TS TL+I+D+ G Y+CE ++ R ++ PD + + C ++ + + CL C+C +T C S + +P+ P + G P ++ L+ E ++ + + ++++++ +P Q + G + G L+ Y + Y+L P+ ++M G YRL + + N R + +++W ++ PV R +++ VL+ + L + Y +S ++M + + +E+C CP+G+SGLSCE+
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP---SHPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPP-----LSSTQLQIDPSLHEFQLVDLSR-RFLVHDSFWA--LPEQ--FLGNKVDSYGGSLR---YNVRYELARGMLEPVQRPDVVLM-----------GAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 762
BLAST of laminin vs. uniprot
Match: gi|1172451|sp|Q05793|PGBM_MOUSE (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 183.341 bits (464), Expect = 3.78581e-45
Identity = 135/504 (26.79%), Postives = 213/504 (42.26%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNE---CNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APD--FSVSVSKGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGY----------------ITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFEN--NIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
C + C + CI + CDG++DC D SDE C C PN C+ N C +K W+CDG DC + DE NC VK G THF C + N IP S+ CD E DC DE C PQV+ P +Q I T+ TC +G P P I+WR NW H+P H T TS TL+I+D+ G Y+CE ++ R ++ PD + +G +Y D+ CL C+C VT+ C S+ + + P + G+ P + L+ +E ++ + + +++ ++ +P Q + G + G +L+ Y + Y+L P+ +++ G YRL N R +++W ++ PV R +++ L + L + Y +S + M + + +E+C CP+G+SGLSCE+
Sbjct: 285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQ-SIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPA---HPRVTMTSEGG--RGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDS---ASCLPCFCFGVTNVCQSSLRFRDQIRLSFDQPNDFKGVNVTMPSQPGVPPLSST-----QLQIDPALQEFQLVDLSR-RFLVHDAFWA--LPKQ--FLGNKVDSYGGFLR---YKVRYELARGMLEPVQKPDVILV-----------GAGYRLHSRGHTPTHPGTLNQRQVQLSEEHWVHESG--RPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGRAHSVEECRCPIGYSGLSCES 744
BLAST of laminin vs. uniprot
Match: gi|317373536|sp|P98160|PGBM_HUMAN (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; AltName: Full=Perlecan; Short=PLC; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 162.155 bits (409), Expect = 1.00002e-38
Identity = 126/475 (26.53%), Postives = 201/475 (42.32%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIG-THFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVM--APDFSVSVSKGLICQKPYYNNDAWYPE---MCLRCYCSNVTDDCTSATGY-------ITKPE---------PIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPV--YASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAI 3415
C + C+N CI + CDG++DC D SDE D C PN C N C +K W+CDG DC + DE NCP K G T F C + N IP S+ CD E DC DE C PQV+ P ++ I T+ TC G P P I+WR NW H+P +H T TS TL+I+D+ G Y+CE ++ R ++ PD + L+ Q+ + +Y E CL C+C +T C S + +P+ P + G P + L+ E ++ + + ++++++ +P Q + G + G L+ Y + Y+L P+ ++M G YRL + + N R + +++W ++ PV R +++ VL+ + L + Y +S ++M +
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP---SHPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLE----LVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSST-----QLQIDPSLHEFQLVDLSR-RFLVHDSFWA--LPEQ--FLGNKVDSYGGSLR---YNVRYELARGMLEPVQRPDVVLM-----------GAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTV 716
BLAST of laminin vs. uniprot
Match: gi|30179887|sp|Q06561|UNC52_CAEEL (RecName: Full=Basement membrane proteoglycan; AltName: Full=Perlecan homolog; AltName: Full=Uncoordinated protein 52; Short=Protein unc-52; Flags: Precursor)

HSP 1 Score: 161.384 bits (407), Expect = 1.7804e-38
Identity = 180/644 (27.95%), Postives = 268/644 (41.61%), Query Frame = 2
Query: 1808 LTVTPKSITIKPGSTARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGG-------DASSLLEIKDVTRDDHGTIYECV----FNKLTEFVTLNV--------------EEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDR--QRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVK-NQNRCIGTHFLCNN-NTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS-RRRVMA-PDFSVSV----------------------SKGLICQKPYYNN--------------------DAWY-----PEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVG---KIEKCNCPLGFSGLSCE 3496
+TV P ++ G F C+ R +D R R+GG D+ L I V D GT Y CV N + TL+V +C +++ C N C+ + CDG+ DC D SDE C PN C+ N +CV K W CDG DDCG+N DELNC K + + C T F C++ +P S+ CDG DC DE+ C P V++P Q + + +T LTCK P P I+WR NW PV T+ TL I D G Y+CE I+ + RV+A PD V V ++G + PY NN A++ PE CL+C+C V++DC S+ Y TK + +G DA V +E R F+ K Y + + Y+ G + YG M ++++ SG S + PMV++KG +I V+ + V S+ I + +E +Y + + +R D++ VL ++ L + + QT + +S + A+ D+Y+ G ++E+C CP G+ G SCE
Sbjct: 47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDP-PQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWG--PVCEPPRCLQTSEGG---YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAV--TPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAG----DAEGVTISDIEERTIDRNTPFSFF-KTGYLTFDGTTDGVA----KYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGN-QNILVHRVRNQEHVLRSDSPVR--ITVETYETNYEQLNGAA---ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAV---DRYTPDGLALEVEQCVCPPGYLGTSCE 646

HSP 2 Score: 58.5362 bits (140), Expect = 4.67277e-07
Identity = 55/237 (23.21%), Postives = 96/237 (40.51%), Query Frame = 2
Query: 2786 PEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCE 3496
P+ C+ C+CS VT C++++ T + D + T + +P T A + R Q Y+ G + YG + Y K SG + +++ ++A Y K+R P YA + EN ++I + E + D +R ++ L ++ L K Y TD Q+ +++ A E + ++E+C CP G+ G SCE
Sbjct: 715 PQGCIPCFCSGVTQQCSASSYRRTS---VSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEAR---GQTLYWKLPEKFLGDKVTSYGGTLEYTFKFSGNGNSDQSADVILRGNDIALQY----KHREPFYA---DRENKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCE 934
BLAST of laminin vs. uniprot
Match: gi|160409939|sp|A2ARV4|LRP2_MOUSE (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 89.7373 bits (221), Expect = 1.25976e-16
Identity = 54/128 (42.19%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDED-RQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDEL-NCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP 2446
C NQ C N CI + CDG +DCGD SDED R C N +S +N+ PN+RC+ +HW CDG DC + DEL NC ++ C F C N I +S+ CD DC DE CS P
Sbjct: 2908 CSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTCINSRPPNRRCIPQHWVCDGDADCADALDELQNCTMR---ACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP 3032

HSP 2 Score: 82.0333 bits (201), Expect = 3.36701e-14
Identity = 45/117 (38.46%), Postives = 60/117 (51.28%), Query Frame = 2
Query: 2087 KCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDC 2437
+C N CI CDG DDCGDNSDE+ EC + C +++C+ W CD +DCG+N DE +C +K C HF C + +P++ CDG DCL DE C
Sbjct: 3728 RCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 3 Score: 81.2629 bits (199), Expect = 5.26275e-14
Identity = 53/161 (32.92%), Postives = 77/161 (47.83%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRC--NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNR-CIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFT-NSTLILTCKMSGRPVP 2539
C L Q +C++ C C+ + DC D SDEDR C + C N C NKRC+ ++WQCD +DDC +N DE P +R C F CNN IP+S+ CD + DC D EP+ + + + ++ +CK + R +P
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDED--PSHCASRTCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSD----------EPIHECMTAAYNCDNHTEFSCKTNYRCIP 3696

HSP 4 Score: 79.7221 bits (195), Expect = 1.62777e-13
Identity = 49/163 (30.06%), Postives = 74/163 (45.40%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNEC---NPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDEL--NCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCS---DPQVIEPVKQMQISIFTNSTLILTCKMSGRP 2533
C +CKN +CI CDG++DC D SDE+ C +P CD N RC+ H C+G+DDCG+ DE +C C T + C+N + + Y CD DC + DE C+ + E + + + +N I +C+ +P
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCD-------NSRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTCAEKICEQNCTQLSNGGFICSCRPGFKP 3999

HSP 5 Score: 74.3294 bits (181), Expect = 7.03311e-12
Identity = 49/128 (38.28%), Postives = 63/128 (49.22%), Query Frame = 2
Query: 2054 NVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDC 2437
+ E C+ N R CI + C+G DDC DNSDE C+P+ DF N C+ W+CDGIDDCG+N DE +C + C + F C + IP + CD E DC DE DC
Sbjct: 3683 HTEFSCKTNYR------CIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DFRCG---NHHCIPLRWKCDGIDDCGDNSDEESCVPR---ECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795

HSP 6 Score: 74.3294 bits (181), Expect = 7.33567e-12
Identity = 48/140 (34.29%), Postives = 63/140 (45.00%), Query Frame = 2
Query: 2057 VEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVK--NQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDE-------IDCSDPQ 2449
V EC ++ +C ++ CI CD ++DCGDNSDE C+P C + CV K CDG DC + DE CP + N C F C N+ I + CDGE DC+ DE + C PQ
Sbjct: 3757 VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQ 3889

HSP 7 Score: 72.0182 bits (175), Expect = 3.63511e-11
Identity = 45/140 (32.14%), Postives = 68/140 (48.57%), Query Frame = 2
Query: 2063 EECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRC----NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKN-QNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVK 2467
++C + C N C+ CDG DDC DNSDE +C N C+ ++ C +C+ W+CD +DC + DE NCP ++ + C T F C+N+ IP+ + CD + DC DE +C P +
Sbjct: 1023 QQCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDE--HQCGALNNTCSSSAFTCVH------GGQCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQ 1154

HSP 8 Score: 71.633 bits (174), Expect = 4.92275e-11
Identity = 45/123 (36.59%), Postives = 63/123 (51.22%), Query Frame = 2
Query: 2069 CELNQRKCKN-EICIDENKFCDGKDDCGDNSDEDRQRC--NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDE 2428
C+ + KC+ IC+ CDG +DCGD SDE+ C + C N C +P+ RC+ +W CDG DC ++ DE + + N C F C+N I S+ CDG+ DC M DE
Sbjct: 2823 CQPDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSPH-RCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDE 2939

HSP 9 Score: 71.2478 bits (173), Expect = 6.39155e-11
Identity = 51/145 (35.17%), Postives = 66/145 (45.52%), Query Frame = 2
Query: 2069 CELNQRKCKN-EICIDENKFCDGKDDCGDNSDED---RQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFT 2491
C +Q KC + CI+ CDG DC DNSDE + C+P+ C + C+ W+CDG DC DE N V C +HFLC+N I S+ CDG+ DC M DE DC P Q Q ++
Sbjct: 1188 CTSSQFKCADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQC------QGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKT--CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDCPTQPFHCPSSQWQCPGYS 1324

HSP 10 Score: 69.3218 bits (168), Expect = 2.18601e-10
Identity = 65/223 (29.15%), Postives = 94/223 (42.15%), Query Frame = 2
Query: 1847 STARFLCQLNGLEGKVIWR---------RTDRKSLTVNRENRLG------GDASSLLEIKDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNE--CNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNT---------LIPRSYWCDGEPDCLSMEDEIDC 2437
S+ +FLC N + W+ +D L +R RLG G+ +S + + +D + E L CE N+ +C N+ CI E CD DDC DNSDED C C P C+ N RC+ + W+CD +DCG+ DE P+ + C+ + C+N+T IP+ C+G DC DE C
Sbjct: 3515 SSTQFLCGNNEKCIPIWWKCDGQKDCSDGSDESDLCPHRFCRLGQFQCRDGNCTSPQALCNARQD--------CADGSDEDRVLCEHHRCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCN-------NGRCIPQSWKCDVDNDCGDYSDE---PI---HECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716

HSP 11 Score: 69.3218 bits (168), Expect = 2.31876e-10
Identity = 71/258 (27.52%), Postives = 106/258 (41.09%), Query Frame = 2
Query: 1667 KIERPSLTSSTSFIVINNVLKRHEGTYVCQVLNTKVFGKII----VRTKPVLTVTPKSITIKPGSTARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEI----KDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRC--NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDC 2410
KIER +LT S +VI+ V+G+ I TK + + T R Q +G+ V +T ++ + N ++ G S + + G+ Y NK + ++ C Q C N CI ++ CD +DCGD SDE C + C + C N RCV H++CD +DCG+N DE C ++ N T F C+N IP SY C+G +C
Sbjct: 2575 KIERSTLTGSNREVVISTAF---------HSFGLTVYGQYIYWTDFYTKKIYRANKYDGSDLIAMTTRLPTQPSGISTVV---KTQQQQCS-NPCDQFNGGCSHICAPGPNGAECQCPHEGSWYLANDNK---YCVVDTGARCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTC-------ANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNC 2807

HSP 12 Score: 66.2402 bits (160), Expect = 1.91989e-09
Identity = 45/158 (28.48%), Postives = 64/158 (40.51%), Query Frame = 2
Query: 2090 CKNEICIDENKFCDGKDDCGDNSDEDR-QRCNECNPNSIHC----------------DFLNNSNP----------------NKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEP 2461
C N +CI + CD +DC D SDE Q C+P C D ++ S+ C+ ++CDG+ DC +N DE CP + C F C + T IP ++ CDG PDC+ DE + P+ P
Sbjct: 1117 CDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKTCSP 1274

HSP 13 Score: 63.1586 bits (152), Expect = 1.74344e-08
Identity = 42/115 (36.52%), Postives = 53/115 (46.09%), Query Frame = 2
Query: 2105 CIDENKFCDGKDDCGDNSDED----RQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDC 2437
CI CD ++DC D SDE R + C P S CD N C+ K W CD +DC + DE NC + C T F C ++ I Y CDG+ DC+ DE C
Sbjct: 1079 CIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCD-------NHMCIPKEWVCDTDNDCSDGSDEKNC--QASGTCHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGC 1184

HSP 14 Score: 62.003 bits (149), Expect = 4.11514e-08
Identity = 42/125 (33.60%), Postives = 61/125 (48.80%), Query Frame = 2
Query: 2078 NQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNE-CNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQ 2449
+Q C N C + ++ CD K DC D+SDE C C+ C + C+++ + CD +DC +N DE NC N + C G F C+N I +++ CDG+ DC DE C Q
Sbjct: 148 DQLTCANGACYNTSQKCDHKVDCRDSSDE--ANCTTLCSQKEFQCG-------SGECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 15 Score: 56.9954 bits (136), Expect = 1.23451e-06
Identity = 39/122 (31.97%), Postives = 55/122 (45.08%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNR-CIGTHFLC-NNNTLIPRSYWCDGEPDCLSMEDE 2428
C + +C + CI CD +DC DNSDE + C + C N +C+ ++W CDG DDC ++ DE C ++ C + C + I CDG PDC EDE
Sbjct: 183 CSQKEFQCGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCS-------NGQCINQNWVCDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGEDE 297

HSP 16 Score: 55.0694 bits (131), Expect = 4.43781e-06
Identity = 42/129 (32.56%), Postives = 52/129 (40.31%), Query Frame = 2
Query: 2063 EECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDE-LNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP 2446
+EC +C N CI + CDG DC D++DE C P S F C+ W CD DC + DE NCP C C+N +P Y CD DC DE +C P
Sbjct: 26 QECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDE-----IGCPPRSCGSGFF-LCPAEGTCIPSSWVCDQDKDCSDGADEQQNCP---GTTCSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145

HSP 17 Score: 54.299 bits (129), Expect = 8.34325e-06
Identity = 40/118 (33.90%), Postives = 56/118 (47.46%), Query Frame = 2
Query: 2090 CKNEICIDENKFCDGKDDCGDNSDEDRQRCN--ECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLC-NNNTLIPRSYWCDGEPDCLSMEDEID 2434
C N CI + C+G ++C DN D + C C P+ C N CV + + CDG +DCG+ DE N + C F C + + IP ++CDGE DC+ DE D
Sbjct: 2789 CSNGRCIPLSYVCNGINNCHDNDTSDEKNCPPITCQPDFAKCQTTN------ICVPRAFLCDGDNDCGDGSDE-NPIYCASHTCRSNEFQCVSPHRCIPSYWFCDGEADCVDSSDEPD 2899
BLAST of laminin vs. uniprot
Match: gi|1708867|sp|P98158|LRP2_RAT (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 87.8113 bits (216), Expect = 5.60155e-16
Identity = 52/128 (40.62%), Postives = 68/128 (53.12%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDED-RQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDEL-NCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP 2446
C +Q +C N CI N CDG +DCGD SDED R C N +S +N+ PN+RC+ ++W CDG DC + DEL NC ++ C F C N + +S+ CD DC DE CS P
Sbjct: 2908 CRASQFQCDNGRCISGNWVCDGDNDCGDMSDEDQRHHCELQNCSSTQFTCVNSRPPNRRCIPQYWVCDGDADCSDALDELQNCTMRT---CSAGEFSCANGRCVRQSFRCDRRNDCGDYSDERGCSYP 3032

HSP 2 Score: 82.8037 bits (203), Expect = 1.77456e-14
Identity = 45/117 (38.46%), Postives = 61/117 (52.14%), Query Frame = 2
Query: 2087 KCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDC 2437
+C N CI CDG DDCGDNSDE+ EC+ + C +++C+ W CD +DCG+N DE +C +K C HF C + +P++ CDG DCL DE C
Sbjct: 3728 RCANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 3 Score: 77.7962 bits (190), Expect = 5.61702e-13
Identity = 45/122 (36.89%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRC--NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDE 2428
C L Q +C++ C C+ + DC D SDEDR C + C N C NKRC+ + WQCD ++DC +N DE ++ C F CNN IP+S+ CD + DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCESNEWQC-------ANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRT-CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 4 Score: 74.7146 bits (182), Expect = 4.69393e-12
Identity = 49/140 (35.00%), Postives = 63/140 (45.00%), Query Frame = 2
Query: 2057 VEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVK--NQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDE-------IDCSDPQ 2449
V EC ++ +C ++ CI CD ++DCGDNSDE C+P C + CV K CDG DC + DE CP + N C F C N+ I + CDGE DC+ DE I C PQ
Sbjct: 3757 VPRECSESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPQ 3889

HSP 5 Score: 73.1738 bits (178), Expect = 1.3341e-11
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 2063 EECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRC----NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVK-NQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVK 2467
++C C N C+ CDG DDC DNSDE +C N C+P++ C +C+ W CD +DC + DE NCP + C T F C+N+ IP+ + CD + DC DE +C +P +
Sbjct: 1023 QQCGSLSFPCNNGKCVPSFFRCDGVDDCHDNSDE--HQCGVFNNTCSPSAFAC------VRGGQCIPGQWHCDRQNDCLDGSDEQNCPTHATSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSDEKNCQASGTCQPTQ 1154

HSP 6 Score: 73.1738 bits (178), Expect = 1.46362e-11
Identity = 49/128 (38.28%), Postives = 62/128 (48.44%), Query Frame = 2
Query: 2054 NVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDC 2437
+ E C+ N R CI + C+G DDC DNSDE C+P+ DF N C+ W+CDG DDCG+N DE NC + C + F C + IP + CD E DC DE DC
Sbjct: 3683 HTEFSCKTNYR------CIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DF---RCANHHCIPLRWKCDGTDDCGDNSDEENCVPR---ECSESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795

HSP 7 Score: 71.2478 bits (173), Expect = 5.22173e-11
Identity = 44/133 (33.08%), Postives = 58/133 (43.61%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLC-NNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPV 2464
C+ Q +C + CI CDG DC D SDE N C C C+ ++CDG+ DC +N DE CP + C F C + T IP ++ CDG PDC+ DE P+ P
Sbjct: 1150 CQPTQFRCPDHRCISPLYVCDGDKDCADGSDEAGCVLN-CTSAQFKC------ADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIHGSDEHTGCVPKTCSPT 1275

HSP 8 Score: 70.0922 bits (170), Expect = 1.22255e-10
Identity = 79/291 (27.15%), Postives = 119/291 (40.89%), Query Frame = 2
Query: 1640 IETELPIEA-----KIERPSLTSSTSFIVINNVLKRHEGTYVCQVLNTKVFGKII----VRTKPVLTVTPKSITIKPGSTARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEI----KDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRC--NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCL--SMEDEIDCSDPQVIEP 2461
+ET+L A KIER +LT + +V++ V+G+ I + T+ + + T R Q +G+ V +T R+ + N ++ G S + + G Y NK + ++ C Q C N CI+++ CD +DCGD SDE C + C + C N RCV H++CD +DCG+N DE C +N N T F C+N IP SY C+G +C DE +C P P
Sbjct: 2561 LETDLLYWADASLQKIERSTLTGTNREVVVSTAF---------HSFGLTVYGQYIYWTDLYTRKIYRANKYDGSDLVAMTTRLPTQPSGISTVV---KTQRQQCS-NPCDQFNGGCSHICAPGPNGAECQCPHEGNWYLANDNK---YCVVDTGTRCNQLQFTCLNGHCINQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCG-------NGRCVPYHYRCDYYNDCGDNSDEAGCLFRNCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCP-PHTCPP 2825

HSP 9 Score: 70.0922 bits (170), Expect = 1.43471e-10
Identity = 44/123 (35.77%), Postives = 62/123 (50.41%), Query Frame = 2
Query: 2069 CELNQRKCKN-EICIDENKFCDGKDDCGDNSDEDRQRC--NECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDE 2428
C + KC+ IC+ CDG +DCGD SDE+ C + C N C +P +RC+ +W CDG DC + DE + + N C + F C+N I ++ CDG+ DC M DE
Sbjct: 2823 CPPDFTKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----LSP-QRCIPSYWFCDGEADCADGSDEPDTCGHSVNTCRASQFQCDNGRCISGNWVCDGDNDCGDMSDE 2939

HSP 10 Score: 69.707 bits (169), Expect = 1.57398e-10
Identity = 50/145 (34.48%), Postives = 66/145 (45.52%), Query Frame = 2
Query: 2069 CELNQRKCKN-EICIDENKFCDGKDDCGDNSDED---RQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFT 2491
C Q KC + CI+ CDG DC DNSDE + C+P+ C + C+ W+CDG DC + DE V C THFLC+N I +++ CDG+ DC M DE DC P Q Q ++
Sbjct: 1188 CTSAQFKCADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQC------QGDGTCIPNTWECDGHPDCIHGSDEHTGCVPKT--CSPTHFLCDNGNCIYKAWICDGDNDCRDMSDEKDCPTQPFHCPSTQWQCPGYS 1324

HSP 11 Score: 65.855 bits (159), Expect = 2.27206e-09
Identity = 47/131 (35.88%), Postives = 61/131 (46.56%), Query Frame = 2
Query: 2060 EEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNE--CNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDEL--NCPVKNQNRCIGTHFLCNNN-TLIPRSYWCDGEPDCLSMEDEIDC 2437
CE N+ +C N+ CI ++ CD +DC DNSDED C C P C+ N RC+ + W+CD +DCG+ DE C N T F C N IP+ C+G DC DE C
Sbjct: 3593 HHRCESNEWQCANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRTCRPGQFKCN-------NGRCIPQSWKCDVDNDCGDYSDEPIDECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716

HSP 12 Score: 61.2326 bits (147), Expect = 5.66674e-08
Identity = 42/125 (33.60%), Postives = 61/125 (48.80%), Query Frame = 2
Query: 2078 NQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNE-CNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQ 2449
+Q C N C + ++ CD K DC D+SDE C C+ C + C+++ + CD +DC +N DE NC N + C G F C+N I +++ CDG+ DC DE C Q
Sbjct: 148 DQLTCANGACYNTSQRCDQKVDCRDSSDE--ANCTTLCSQKEFECG-------SGECILRAYVCDHDNDCEDNSDERNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 13 Score: 59.3066 bits (142), Expect = 2.71276e-07
Identity = 32/90 (35.56%), Postives = 47/90 (52.22%), Query Frame = 2
Query: 2069 CELNQR-KCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRC 2335
CE QR +C N C+ ++ C+G DDCGD SDE + C + P C N C+ +H+ CD ++DCG+ DE C + + C
Sbjct: 3885 CESPQRFRCDNSRCVYGHQLCNGVDDCGDGSDEKEEHCRK--PTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLSDETGCNLGDNRTC 3972

HSP 14 Score: 56.9954 bits (136), Expect = 1.09727e-06
Identity = 39/122 (31.97%), Postives = 57/122 (46.72%), Query Frame = 2
Query: 2069 CELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPV-KNQNRCIGTHFLC-NNNTLIPRSYWCDGEPDCLSMEDE 2428
C + +C + CI CD +DC DNSDE + C + C N +C+ ++W CDG DDC ++ DE C ++ +RC + C + I CDG PDC +DE
Sbjct: 183 CSQKEFECGSGECILRAYVCDHDNDCEDNSDERNCNYDTCGGHQFTCS-------NGQCINQNWVCDGDDDCQDSGDEDGCESNQSHHRCYPREWACPGSGRCISIDKVCDGVPDCPEGDDE 297
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389369|ref|NP_001284822.1| (terribly reduced optic lobes, isoform AS [Drosophila melanogaster])

HSP 1 Score: 195.282 bits (495), Expect = 7.98395e-50
Identity = 167/593 (28.16%), Postives = 241/593 (40.64%), Query Frame = 2
Query: 1808 LTVTPKSITIKPGSTARFLCQLNG-LEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEF-------VTLNVEE----------ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCN---ECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNC-PVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR--RVMAPDFSVSVS--KGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSAT--GYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQT-DFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
L P S IK F C+ G KV W R + L +R G LEI ++ +D GT Y C + V LNVE C Q C N CID++ CDG DC D SDE Q C+ +C PN C N +CV + W+CDG +DCG+N DE +C P + C F C + IP+S+ CD PDC DE+ C P I P Q +S+ L LTC +G P PTI WR NW H+P S T TL D+ SG YSCE I+ R + PD V+V + +C+ ++N A E C++C+C V C SA Y P + + + + + + P +++ N + R P Y + G+ LK YG + Y++ G + + P V+I G ++ L + +NN + W SR +I+ +L V L ++ Y + + +++ A +EKC CP G+ G SCE+
Sbjct: 694 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVP-------DKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1247

HSP 2 Score: 69.707 bits (169), Expect = 1.91486e-11
Identity = 41/125 (32.80%), Postives = 58/125 (46.40%), Query Frame = 2
Query: 2066 ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCS 2440
EC+ N+ +C N CID K C+ DC + DE+ + C C N C+ N CV C+G +C ++ DELNC C+ F CN+ + S C+G DC DE +C
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCG 604

HSP 3 Score: 58.5362 bits (140), Expect = 5.12787e-08
Identity = 61/259 (23.55%), Postives = 93/259 (35.91%), Query Frame = 2
Query: 2054 NVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNR--------------------------CIGTHFLCNNNTLIPRSYWCDG----------EPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTL-------ILTCKMSGRPVPTISW-RFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS 2695
N E C NQ +C N C+ + C+G +C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC ++ C T F C N I C+G E DC + ++ID +D P Q+ + + +S + I C+ G + W R LP L I +I + +G Y CE +
Sbjct: 524 NEECRCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDIDPADSNDRRP-NQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDR-----------NGRLEIPNIRVEDAGTYVCEAVG 763
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389355|ref|NP_001245492.2| (terribly reduced optic lobes, isoform AL [Drosophila melanogaster])

HSP 1 Score: 195.282 bits (495), Expect = 8.86874e-50
Identity = 167/593 (28.16%), Postives = 241/593 (40.64%), Query Frame = 2
Query: 1808 LTVTPKSITIKPGSTARFLCQLNG-LEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEF-------VTLNVEE----------ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCN---ECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNC-PVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR--RVMAPDFSVSVS--KGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSAT--GYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQT-DFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
L P S IK F C+ G KV W R + L +R G LEI ++ +D GT Y C + V LNVE C Q C N CID++ CDG DC D SDE Q C+ +C PN C N +CV + W+CDG +DCG+N DE +C P + C F C + IP+S+ CD PDC DE+ C P I P Q +S+ L LTC +G P PTI WR NW H+P S T TL D+ SG YSCE I+ R + PD V+V + +C+ ++N A E C++C+C V C SA Y P + + + + + + P +++ N + R P Y + G+ LK YG + Y++ G + + P V+I G ++ L + +NN + W SR +I+ +L V L ++ Y + + +++ A +EKC CP G+ G SCE+
Sbjct: 617 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVP-------DKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1170

HSP 2 Score: 77.7962 bits (190), Expect = 6.04823e-14
Identity = 57/218 (26.15%), Postives = 86/218 (39.45%), Query Frame = 2
Query: 2066 ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTL-------ILTCKMSGRPVPTISW-RFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS 2695
EC+ N+ +C N CID K C+ DC + DE+ + C C N C+ N CV C+G +C ++ DELNC C+ F CN+ + S C+G DC DE +C+ Q+ + + +S + I C+ G + W R LP L I +I + +G Y CE +
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDR-----------NGRLEIPNIRVEDAGTYVCEAVG 686

HSP 3 Score: 51.2174 bits (121), Expect = 7.74402e-06
Identity = 31/94 (32.98%), Postives = 47/94 (50.00%), Query Frame = 2
Query: 2054 NVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDE-DRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNR 2332
N E C NQ +C N C+ + C+G +C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + +R
Sbjct: 524 NEECRCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 610
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389377|ref|NP_001027033.3| (terribly reduced optic lobes, isoform AW [Drosophila melanogaster])

HSP 1 Score: 195.282 bits (495), Expect = 9.44398e-50
Identity = 167/593 (28.16%), Postives = 241/593 (40.64%), Query Frame = 2
Query: 1808 LTVTPKSITIKPGSTARFLCQLNG-LEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEF-------VTLNVEE----------ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCN---ECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNC-PVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR--RVMAPDFSVSVS--KGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSAT--GYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQT-DFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
L P S IK F C+ G KV W R + L +R G LEI ++ +D GT Y C + V LNVE C Q C N CID++ CDG DC D SDE Q C+ +C PN C N +CV + W+CDG +DCG+N DE +C P + C F C + IP+S+ CD PDC DE+ C P I P Q +S+ L LTC +G P PTI WR NW H+P S T TL D+ SG YSCE I+ R + PD V+V + +C+ ++N A E C++C+C V C SA Y P + + + + + + P +++ N + R P Y + G+ LK YG + Y++ G + + P V+I G ++ L + +NN + W SR +I+ +L V L ++ Y + + +++ A +EKC CP G+ G SCE+
Sbjct: 896 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVP-------DKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1449

HSP 2 Score: 63.1586 bits (152), Expect = 1.67033e-09
Identity = 39/126 (30.95%), Postives = 53/126 (42.06%), Query Frame = 2
Query: 2066 ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVK--NQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDC 2437
EC+ N+ +C N CID K C+ DC + DE+ + C+ C RC+ QCDG DC + DE +C + C F C IP CD DC DE++C
Sbjct: 531 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQC------RDGTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNC 650

HSP 3 Score: 54.299 bits (129), Expect = 8.93325e-07
Identity = 39/162 (24.07%), Postives = 60/162 (37.04%), Query Frame = 2
Query: 2234 NKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTL-------ILTCKMSGRPVPTISW-RFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS 2695
N CV C+G +C ++ DELNC C+ F CN+ + S C+G DC DE +C+ Q+ + + +S + I C+ G + W R LP L I +I + +G Y CE +
Sbjct: 817 NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDR-----------NGRLEIPNIRVEDAGTYVCEAVG 965
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389383|ref|NP_001096869.3| (terribly reduced optic lobes, isoform AZ [Drosophila melanogaster])

HSP 1 Score: 195.282 bits (495), Expect = 9.67733e-50
Identity = 167/593 (28.16%), Postives = 241/593 (40.64%), Query Frame = 2
Query: 1808 LTVTPKSITIKPGSTARFLCQLNG-LEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEF-------VTLNVEE----------ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCN---ECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNC-PVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR--RVMAPDFSVSVS--KGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSAT--GYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQT-DFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
L P S IK F C+ G KV W R + L +R G LEI ++ +D GT Y C + V LNVE C Q C N CID++ CDG DC D SDE Q C+ +C PN C N +CV + W+CDG +DCG+N DE +C P + C F C + IP+S+ CD PDC DE+ C P I P Q +S+ L LTC +G P PTI WR NW H+P S T TL D+ SG YSCE I+ R + PD V+V + +C+ ++N A E C++C+C V C SA Y P + + + + + + P +++ N + R P Y + G+ LK YG + Y++ G + + P V+I G ++ L + +NN + W SR +I+ +L V L ++ Y + + +++ A +EKC CP G+ G SCE+
Sbjct: 878 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVP-------DKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1431

HSP 2 Score: 68.5514 bits (166), Expect = 4.31525e-11
Identity = 54/213 (25.35%), Postives = 80/213 (37.56%), Query Frame = 2
Query: 2081 QRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTL-------ILTCKMSGRPVPTISW-RFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS 2695
Q +C + C E++ CD C D SDE N C N C+ N CV C+G +C ++ DELNC C+ F CN+ + S C+G DC DE +C+ Q+ + + +S + I C+ G + W R LP L I +I + +G Y CE +
Sbjct: 759 QHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDR-----------NGRLEIPNIRVEDAGTYVCEAVG 947
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389363|ref|NP_001245498.2| (terribly reduced optic lobes, isoform AP [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 1.03156e-49
Identity = 167/593 (28.16%), Postives = 241/593 (40.64%), Query Frame = 2
Query: 1808 LTVTPKSITIKPGSTARFLCQLNG-LEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEF-------VTLNVEE----------ECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCN---ECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNC-PVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR--RVMAPDFSVSVS--KGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSAT--GYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQT-DFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCET 3499
L P S IK F C+ G KV W R + L +R G LEI ++ +D GT Y C + V LNVE C Q C N CID++ CDG DC D SDE Q C+ +C PN C N +CV + W+CDG +DCG+N DE +C P + C F C + IP+S+ CD PDC DE+ C P I P Q +S+ L LTC +G P PTI WR NW H+P S T TL D+ SG YSCE I+ R + PD V+V + +C+ ++N A E C++C+C V C SA Y P + + + + + + P +++ N + R P Y + G+ LK YG + Y++ G + + P V+I G ++ L + +NN + W SR +I+ +L V L ++ Y + + +++ A +EKC CP G+ G SCE+
Sbjct: 695 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVP-------DKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1248

HSP 2 Score: 68.5514 bits (166), Expect = 4.83772e-11
Identity = 54/213 (25.35%), Postives = 80/213 (37.56%), Query Frame = 2
Query: 2081 QRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTL-------ILTCKMSGRPVPTISW-RFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS 2695
Q +C + C E++ CD C D SDE N C N C+ N CV C+G +C ++ DELNC C+ F CN+ + S C+G DC DE +C+ Q+ + + +S + I C+ G + W R LP L I +I + +G Y CE +
Sbjct: 576 QHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDR-----------NGRLEIPNIRVEDAGTYVCEAVG 764

HSP 3 Score: 61.2326 bits (147), Expect = 7.3288e-09
Identity = 44/166 (26.51%), Postives = 67/166 (40.36%), Query Frame = 2
Query: 2066 ECELNQRKCKNEICIDENKFCDGKDDCGDNSDED------RQRCNECNPNSIHCD------------FLNNSN----------------PNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEP 2461
EC+ N+ +C N CID K C+ DC + DE+ R + ++C+P +CD ++ S+ P+ RC + +CD C + DE NC C F CNN + S C+G +C DE++C Q P
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPTTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLP 649
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003325 (SmedAsxldir_c101543_g1_i1|m.51138|m.8906)

HSP 1 Score: 1610.89 bits (4170), Expect = 0
Identity = 759/1156 (65.66%), Postives = 944/1156 (81.66%), Query Frame = 2
Query:   53 TFNN-IPLLIFIFTKILQSEGFQPTRNVSVDVDDLKIRNMNLYFVCPYVRSKTNVIKYFKYVENTSIVLKEKQNAHGIIITLKDASDMGKYGCSVILENGMIKNATFNIIDKQLMENPKLFIYKTEETIYVTQKGNVAELSCGNLMNPSTTWYRPPQYHIYSGSKYIIKDVDRYSYGXXXXXXXXXXXXXXXXRKVILVXXXXXXXXXXXXXXVNYVETLSVQPGTVRYRSSNIAKSNDMIIWENPPGTILLDHERDLYIQSIKDDENIFYYRINRYGDSSINNVGKLIISIKKQDKL-MNLQSPVIYGGEIKMDCIS-STDFNNNTAVIWKRNSEIIFHGNTLTIPSFNKKTFGKYSCEVLQGNEKQKTRFLNLLPEQKIESKIEMTPEPGNFYLYHSGAKKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSVSILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADNVNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSSTSFIVINNVLKRHEGTYVCQVLNTKVFGKIIVRTKPVLTVTPKSITIKPGSTARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVMAPDFSVSVSKGLICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSDAAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAFNMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYRLPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLALFKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCETKID* 3511
+FN IPL IF F I Q+ GFQPTRNVSV++ + K ++FVCPY+R ++IKY+KYVEN +++KE+ + GI+I LK D+GKY CSV+ ++ I+N+T NI D+ ++E+PKLF+YK + +YV Q EL CG+L S W+RPPQYHIYSG KY I +D YSYGTYYC+ N +V V+K+ILVK + + KEK I+EEV Y+E L +RYRS N+ + D++ WE+PPGTILLD+ RD Y++SI ++ YYRINRYGD SIN +GKL+ISIK+ D + M++ +P+ YG E+K+DC++ + + VIWK++ +I +GNTLTI SF K FGKYSCE+++G++++K RF+NL P+QKIE+KIEMTP+PG +YLYHSG KKELHCEI RV+N+WIMK D+IWTFN +KI+ N +++ RLDTNSVSILV+ +++E++EG Y C+Q S + SAKLL+ERS +L+E+APPLQE+ADNVN AELHCRIDT N+NSSSI WKFIPE S E +LP EAK+ERPS SSTSF+VI NVLK+HEGTYVCQVL+TKV+G+I+VRTK VL V+PK +T+KPG ARF+C+L G++GKV+WRR D+KSLTV +E R SLLE+KD T+DD GT+YEC FNKLT++VTL V+EEC LNQRKCKNE CIDENKFCDGK+DCGDNSDEDR++CNEC+PNSIHCDFL ++NPNKRC+IKHWQCDGIDDCGNNFDELNCPVKN+++CIGTH+LCNNN LIPRSYWCDGEPDC SMEDE DCS+PQ+IEPVK ISIFTNSTL +TCKMSGRPVPTISWR+NWDHLP NL++NITTT SNCS+ITS+L +++I+TDHSG+YSCEGISRRR++APDFSVSV+KG ICQ+P+YNNDAWYP+MC+RCYCSN+TD+C+SATGY T P IES IKPSDAAIVNFKT EYYKPAREITFAN M YFINETYY++LVPN DYYFGGAFNM GSWL RYGYP+TYKL LSGE+ Y+P P+V+IKGE SIY+C VKYRLPVYASNE FENN+RI+LWE+D W+ D+ CT+P +R D INVLK VRL LFKVKY+ GQT+FQMSK+SMQEAIET + YSW K+EKC CP G+SGLSCE K++*
Sbjct: 2 SFNKVIPLFIFQFL-ISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCENKVE* 1156
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003584 (SmedAsxldir_c102345_g1_i1|m.54199|m.2277)

HSP 1 Score: 292.738 bits (748), Expect = 1.47518e-83
Identity = 195/610 (31.97%), Postives = 298/610 (48.85%), Query Frame = 2
Query:  968 YGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNKKTFGKYSCEVLQGNEKQKTRFLNLLPE--QKI----ESKIEMTPEPGNFYLYHSGAKKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSVSILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADNVNQGAELHCRIDT-QNVNSSSIIWKFIPEKSLIETELPIEA-KIERPSLTSSTSFIVINNVLKRHEGTYVCQVLNTKVF-GKIIV---RTKPVLTVTPKSITIKPGSTARFLCQLNGLEGKVI----WRRTDRKSLTVNRENR-----LGGDASSLLEIKDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLI-LTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGI-SRRRVMAPDFSV 2728
YG + C F N W + E I + L I SF K G Y C + + + L+L+ E Q+ ESKIE+T +PG H G KKELHCEIE + + K+ W N KK + N + V+RLD VS+LV++DI + +EGNY C GS++ L++ L+E +PP+ +V + Q E HCR++ +V + ++ W F ++ L+ +P ++ + TSFIV+ G Y+C N + ++IV + K LT+TP+ I ++ G C +G+ + T+ K + R+ R +G L ++ D+ C + V + C R C+N C++ KFCD + C D SDED C EC+P S C+ N P K + HW CDG +DCGN +DE NC + N C G F C++N IPR Y CD DC EDE C+ PQ+ + ++ T S L+ LTC+ +G+P+P + WRFNW + + + +++C+ +TS+L IKD G+Y+CE + SR+R + DF V
Sbjct: 236 YGERFSLRC-EVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKC---VASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVFVHRGEKKELHCEIETSSGN---RGKEAEWYINGKKFK---NGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEG--QSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKP--IGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVA--TKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQV 829
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15035123 (SmedSxlregen_c88126_g1_i1|m.36302|m.5005)

HSP 1 Score: 281.182 bits (718), Expect = 4.07165e-79
Identity = 196/592 (33.11%), Postives = 280/592 (47.30%), Query Frame = 2
Query: 1034 WKRNSEIIFHGNTLTIPSFNKKTFGKYSCEVLQGNEKQKTRFLNLLPEQKIE----SKIEMTPEPGNFYLYHSGAKKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLK--RVDRLDTNSVSILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADNVNQGAELHCRID-TQNVNSSSIIWKFIPEKSLIETELP-IEAKIERPSLTSSTSFIVINNVLKRHEGTYVCQVLN--TKVFGKIIVRTKPV--LTVTPKSITIKPGSTARFLCQLNGLEGKVIWR-----------RTDRKSL-TVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR-RVMAPDFSVSV 2734
W RN + G TL P F+K +Y C + E Q FL + +QK+ +KIE+T PG KKELHCEIE ++ + +++ W FN K IE NS++K R+DR++ VSILVL + +EG Y C G A ++++ + ++ P +V + E HCRID N+++ ++ W+F I L + ++ + TSFI ++ G C N T I+V K +TVTP + ++ F C EG D++ L T +R+ A + IKD + C NK V + V+E C NQR+C+N C+ KFCDG DC D SDED CN C P C + P ++ + K+W CDG +DCGNN+DE+NC K+ +C G F C NN IPR CDG DCL EDE DC P +I K + S + L C+ + P+PTI WRFNW LP I+T NC + STL I + +Y+CE +S R ++ DF VS+
Sbjct: 346 WFRNGQYYQTGQTLIFPKFSKLLVDRYECRAIGTTENQVEIFLTVESDQKLTYLSYNKIELTENPGPNIALKLNEKKELHCEIEDIDG---LSGENIEWFFNGKMIE---NSLIKSYRLDRVNKRLVSILVLMNSQLDNEGRYECRYGIVRKEATVMLDIDSGMIVTNPSKIKVIEG--SPVEFHCRIDDVYNIDNRNLSWRFYNNNFQINYSLENSKWRLTESKIADHTSFINLDRATMADSGYIECISGNGLTAQSQLIVVEDKHKFNITVTPNHLRVRKNQLFEFECFGQSDEGIPYGEPKFEFPGGKPVENDKRFLVTTVGPSRIRITAPHGVNIKDELK------LICSVNKQVSAVYIQVQETCPPNQRQCQNRQCLPVGKFCDGIADCVDGSDEDPTVCNSCEPAFTTCQDVYGFAPTRKTINKNWICDGENDCGNNYDEINCEDKS-TKCNGLFFTCKNNMTIPRGQVCDGNSDCLLDEDEADCLKPVIISTSKS-HVKANIGSKVKLQCEATAHPLPTIIWRFNWGCLPNENRVTISTVKKNCRKVISTLTIDEFQAGDDAIYNCEALSSSNRALSQDFHVSI 921
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001730 (Asxlregen_comp65513_c0_seq1|m.19286|m.12982)

HSP 1 Score: 280.026 bits (715), Expect = 9.07463e-79
Identity = 188/587 (32.03%), Postives = 286/587 (48.72%), Query Frame = 2
Query: 1043 NSEIIFHGNTLTIPSFNKKTFGKYSCEVLQGNEKQKTRFLN------LLPEQKIESKIEMTPEPGNFYLYHSGAKKELHCEIERVNNQWIMKAKDVIWTFNNKKIET--IANSVLKRVDRLDTNSVSILVLTDIDEKHEGNYNC-FQGSTVLSAKLLMERSNILLELAPPLQ--EVADNVNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSSTSFIVINNVLKRHEGTYVCQVLNTK--VFGKIIVRTKPVLTVTPKSITIKPGSTARFLCQLNGLEGKVIW---------RRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNT-LIPRSYWCDGEPDCLSMEDEIDCSDPQVI-EPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGIS-RRRVMAPDFSV 2728
N +I + TIP +K G Y C V +G + +N + E K SKIE++ PG +G K+ELHCEI VN ++ K+ IW F ++I + A ++ + RL VSI+VL +I + +EG Y C +G T + ++M +S E++P Q +V D + E HCR++ + +IW F+ +++ T + S TSFI++ + G Y+C T+ +IV + + VTP I ++ G TA F C + G + R D + TV E G L + VT +D+GT + C + T V + V+ C R C+N CI+ KFCDGK DC D SDED++ C +C+P S C+ N P HW CDG DDCGN +DE C N C G + CN+ T IPR++ CD + DC++ +DE C+ P +I E + +I+ T+ LTC+++G P+P I WRFNW L + + NC STL I + G+Y+CE +S +R + D+ +
Sbjct: 337 NDRLISQSSRHTIPRLDKTNMGVYQC-VSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIG-VNTG--LQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSK-NTEVSPSQQTRKVGDGIP--VEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTV--EKLEAGKVQ--LTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC-FGNVLECGGLKYQCNDGTKSIPRAFVCDKDTDCVNGDDESRCTQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQL 908
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15017289 (SmedSxldir_c105356_g1_i1|m.61948|m.29338)

HSP 1 Score: 248.825 bits (634), Expect = 6.33324e-70
Identity = 188/619 (30.37%), Postives = 299/619 (48.30%), Query Frame = 2
Query:  968 YGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNKKTFGKYSCEVLQGNEKQKTRFLNLLPEQKI----ESKIEMTPEPGNFYLYHSGAKKELHCEIERVNNQWIMKAKDVIWTFNNK--KIETIANSVLKRVDRLDTNSVSILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADNVNQGAELHCRID-TQNVNSSSIIWKFIPEKSLIETELPIEA-KIERPSLTSSTSFIVINNVLKRHEGTYVCQVLNTKVF-GKIIV---RTKPVLTVTPKSITIKPGSTARFLC-------------QLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRDDHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDCGDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKH----WQCDGIDDCGNNFDELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDPQVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNITTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRR-RVMAPDFSVSV 2734
+G E+ ++C S+ N WK N +II + L + SF G Y C+ + ++ + L + Q + SKIEM P G KELHCEI+ + K DV W FN K K E + L R DR T SILV+ D + ++G Y C +T S + +++ + + P + EV V E HCRID N+++ ++ W FI K+ +T +P K+ +P T +TSFI NNV G +VC ++ G++IV + ++VTP +++ F C ++ L G + ++ + +T + + + +A L+I + + C + + + ++ +C NQ+ CKN CID N FC+G +C D +DED+ C EC+P S C N++N + I H W CDG +DC + +DE C ++N C F CN+ T P +Y CDG+ DC + EDEI C P ++ K +IS +T+ +TC+++G P+P I+WR+NW + + T S C +TS L I D + +Y CE IS + R + DF V++
Sbjct: 56 FGQELLLECHVSSKIKNFIYSWWK-NEKIIGTESVLKVKSFQMNDTGLYKCKAVGVSKNNEILILETVSSQTVCDAPHSKIEMIPGTGEKIEIKPNQLKELHCEIDHESKH---KGSDVKWEFNGKPLKEEDLEKLDLTRYDRYWT---SILVIQDANSNNDGKYTCKVENTEKSVDVFVQKDRGFIFVNPQIVEVPKEVK--VEFHCRIDGIPNMSNKNLKWNFI-SKNGTKTPMPSGNWKVSKPCDTPNTSFITSNNVSMEDNGQFVCSTPKGEISRGQLIVDEIKNNIKISVTPPKVSVHRNQKFEFECLGQDLNKNPIGDLEVRFLNGSDV-KKNPKFIITELKPSNIKIEAPRGLDIPENELN-----ITCGSGNVKVPMRVEIKTQCPPNQKSCKNGDCIDSNLFCNGVKNCEDGTDEDQSLCYECDPISKPCGAYNSTNFS---TIPHYNINWACDGENDCPDGYDEKICDKPDEN-CNTQIFTCNDGTKKPFAYVCDGQKDCENAEDEIGCLKPIILGTSKN-KISASPGNTIAMTCEVTGYPLPKIAWRYNWGCIKETPRITVKETVSECQKVTSVLTINDFQSGDDAIYGCEAISGKIRAFSNDFFVNM 653
The following BLAST results are available for this feature:
BLAST of laminin vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|578798995|ref|XP_006710657.1|1.081600e-4727.24PREDICTED: basement membrane-specific heparan sulf... [more]
gi|578799001|ref|XP_006710660.1|1.228440e-4727.24PREDICTED: basement membrane-specific heparan sulf... [more]
gi|126012571|ref|NP_005520.4|1.348830e-4727.24basement membrane-specific heparan sulfate proteog... [more]
gi|767903961|ref|XP_011539621.1|2.902570e-4726.69PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903954|ref|XP_011539619.1|3.853190e-4726.69PREDICTED: basement membrane-specific heparan sulf... [more]
back to top
BLAST of laminin vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|1172451|sp|Q05793|PGBM_MOUSE3.785810e-4526.79RecName: Full=Basement membrane-specific heparan s... [more]
gi|317373536|sp|P98160|PGBM_HUMAN1.000020e-3826.53RecName: Full=Basement membrane-specific heparan s... [more]
gi|30179887|sp|Q06561|UNC52_CAEEL1.780400e-3827.95RecName: Full=Basement membrane proteoglycan; AltN... [more]
gi|160409939|sp|A2ARV4|LRP2_MOUSE1.259760e-1642.19RecName: Full=Low-density lipoprotein receptor-rel... [more]
gi|1708867|sp|P98158|LRP2_RAT5.601550e-1640.63RecName: Full=Low-density lipoprotein receptor-rel... [more]
back to top
BLAST of laminin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|665389369|ref|NP_001284822.1|7.983950e-5028.16terribly reduced optic lobes, isoform AS [Drosophi... [more]
gi|665389355|ref|NP_001245492.2|8.868740e-5028.16terribly reduced optic lobes, isoform AL [Drosophi... [more]
gi|665389377|ref|NP_001027033.3|9.443980e-5028.16terribly reduced optic lobes, isoform AW [Drosophi... [more]
gi|665389383|ref|NP_001096869.3|9.677330e-5028.16terribly reduced optic lobes, isoform AZ [Drosophi... [more]
gi|665389363|ref|NP_001245498.2|1.031560e-4928.16terribly reduced optic lobes, isoform AP [Drosophi... [more]
back to top
BLAST of laminin vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150033250.000000e+065.66SmedAsxldir_c101543_g1_i1|m.51138|m.8906[more]
SMU150035841.475180e-8331.97SmedAsxldir_c102345_g1_i1|m.54199|m.2277[more]
SMU150351234.071650e-7933.11SmedSxlregen_c88126_g1_i1|m.36302|m.5005[more]
SMU150017309.074630e-7932.03Asxlregen_comp65513_c0_seq1|m.19286|m.12982[more]
SMU150172896.333240e-7030.37SmedSxldir_c105356_g1_i1|m.61948|m.29338[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_020815 ID=Gsp_020815|Name=laminin|organism=Girardia sp.|type=mRNA|length=3609bp
AATAGTAATGTTTTAATAAGAAGTGAATTTAGGAACTTTATTTTTCATGA
CGACTTTTAATAACATACCGTTACTTATTTTCATTTTTACGAAAATCTTG
CAAAGTGAAGGATTCCAGCCGACAAGAAATGTTTCAGTAGATGTTGACGA
TTTGAAAATTAGAAATATGAACTTATATTTTGTTTGTCCTTACGTTCGAT
CAAAAACTAACGTAATCAAATATTTTAAATATGTTGAAAATACTTCAATA
GTGTTAAAAGAAAAACAAAATGCACATGGAATAATAATCACTTTAAAAGA
CGCATCTGATATGGGTAAATATGGGTGTTCCGTTATTTTAGAAAATGGAA
TGATTAAAAACGCAACATTTAATATTATCGATAAACAATTAATGGAGAAT
CCAAAATTGTTTATTTATAAAACTGAAGAAACAATTTATGTTACTCAGAA
AGGTAACGTTGCTGAATTAAGTTGTGGAAATTTAATGAATCCATCTACTA
CTTGGTATAGACCACCACAATACCACATATATTCAGGCAGTAAATATATA
ATAAAAGATGTTGATCGATATAGTTACGGAACCTATTACTGTACCTCGGA
AACAACAAATACAAATACGGTTTCCGTTCGAAAAGTCATTTTAGTGAAAG
AAATTCCAAAAATAAAAGAAAAGTCAATTGAGGAGGAAGTAAATTATGTA
GAAACCCTCTCAGTACAACCAGGAACTGTTAGATATCGATCATCTAATAT
TGCAAAAAGCAACGATATGATTATTTGGGAAAACCCACCAGGAACTATTT
TATTGGATCATGAAAGAGATTTATATATACAATCCATAAAAGATGATGAA
AATATTTTCTATTATAGAATTAACAGATATGGAGATTCATCTATTAATAA
TGTAGGGAAATTGATAATATCTATTAAAAAACAAGATAAATTAATGAATC
TACAGAGTCCTGTTATTTATGGAGGTGAAATAAAGATGGATTGTATCAGT
TCAACCGATTTCAACAATAATACGGCTGTCATTTGGAAAAGAAATTCCGA
AATTATTTTTCACGGAAATACTTTGACTATACCTTCTTTTAACAAGAAAA
CTTTTGGCAAATATAGTTGTGAAGTTTTGCAAGGAAATGAAAAACAAAAA
ACACGGTTTTTAAATTTATTACCCGAACAAAAAATTGAATCAAAAATAGA
AATGACACCTGAACCTGGAAACTTTTATTTATATCATTCAGGAGCTAAGA
AGGAATTACATTGTGAAATTGAGCGAGTGAATAACCAGTGGATAATGAAG
GCAAAAGATGTAATATGGACATTTAATAACAAAAAAATTGAAACTATTGC
AAACTCGGTTTTAAAAAGAGTAGATAGATTAGATACAAATTCAGTCAGTA
TACTTGTATTGACAGATATTGACGAAAAACATGAAGGAAATTATAACTGT
TTTCAAGGATCAACTGTACTTAGTGCAAAATTATTAATGGAACGTAGTAA
CATTCTCCTTGAACTAGCTCCACCACTGCAAGAAGTGGCAGACAATGTTA
ATCAAGGTGCTGAATTACACTGTCGCATTGATACACAGAATGTTAATTCA
AGTTCGATTATTTGGAAATTTATTCCGGAAAAATCATTAATTGAAACAGA
GTTACCAATCGAAGCTAAAATTGAAAGACCTTCATTAACATCTTCAACAT
CCTTTATTGTAATTAACAATGTTTTGAAAAGACACGAAGGCACATATGTT
TGCCAAGTCCTGAACACCAAAGTATTCGGAAAAATTATTGTGAGAACCAA
ACCTGTGTTGACTGTTACCCCAAAATCGATAACTATAAAACCTGGTAGTA
CTGCTAGATTTCTTTGTCAATTAAATGGACTTGAAGGCAAAGTAATTTGG
CGAAGAACGGATAGAAAAAGTTTGACTGTGAATAGAGAAAATAGATTAGG
AGGTGATGCATCAAGTTTATTGGAAATCAAAGATGTTACACGAGATGATC
ACGGAACCATTTATGAATGTGTTTTTAATAAATTAACAGAATTTGTAACT
CTAAATGTCGAAGAAGAATGTGAATTAAATCAACGTAAATGTAAAAATGA
AATTTGTATTGATGAGAACAAATTTTGTGATGGTAAAGATGACTGTGGCG
ATAATTCAGATGAAGACCGTCAAAGATGCAATGAATGTAATCCGAATTCA
ATCCACTGTGACTTTCTTAATAATTCAAATCCAAATAAACGATGTGTTAT
AAAGCATTGGCAATGCGACGGAATTGATGACTGTGGAAATAATTTCGATG
AACTAAATTGTCCCGTTAAAAATCAAAACAGGTGTATTGGAACACACTTT
CTTTGTAACAACAATACTTTGATTCCTCGTTCGTATTGGTGTGATGGTGA
ACCAGACTGTTTATCTATGGAAGACGAAATAGATTGCAGCGACCCACAAG
TTATAGAGCCTGTGAAGCAAATGCAAATTTCAATATTTACAAACTCAACT
TTAATCTTGACTTGTAAAATGTCAGGACGTCCAGTTCCAACTATTTCATG
GAGATTTAACTGGGATCATTTGCCTGTAAATTTAAATCATAATATTACAA
CAACAACTTCCAATTGTAGCATGATTACAAGCACATTACTAATAAAAGAT
ATAAGTACAGACCACAGTGGTGTATATTCTTGTGAAGGTATTTCAAGAAG
AAGAGTAATGGCACCAGACTTTTCTGTATCAGTTTCAAAAGGATTAATAT
GCCAGAAACCATATTATAATAATGATGCTTGGTATCCAGAAATGTGTCTC
AGGTGTTATTGTTCAAATGTTACAGATGACTGTACAAGTGCGACAGGATA
TATCACAAAACCTGAACCAATTGAAAGTGGAATTAAACCATCTGATGCAG
CAATAGTTAATTTCAAAACTCTTGAATATTATAAGCCAGCTAGAGAAATA
ACATTTGCTAATATGGAAAAAATGAATTACTTTATTAATGAAACATATTA
TCAACGCTTAGTTCCTAATCAGGATTACTATTTTGGAGGTGCATTTAATA
TGGGTGGCTCATGGTTAAAACGATATGGCTACCCTATGACTTATAAGTTA
AAGTTATCTGGAGAAAGCAAGACCTATATTCCTAATCCAATGGTTATGAT
AAAAGGAGAAGTTGCTTCAATATATTATTGTGGCGTTAAATATCGGTTGC
CAGTTTATGCTTCAAATGAAAATTTTGAAAATAACATTCGAATATTTTTA
TGGGAAAAAGATTATTGGTATAATGATTATAGTTGCACAGTACCTGTTTC
TCGAAATGATATAATAAATGTTTTGAAAGAAGTACGACTAGCCTTGTTTA
AAGTAAAGTATTTTGTTGGACAAACTGATTTTCAAATGTCCAAACTTTCA
ATGCAAGAAGCAATCGAAACCAAAGACAAGTATTCTTGGGTGGGTAAAAT
AGAGAAATGTAATTGCCCGTTAGGATTTTCTGGACTCTCCTGTGAAACCA
AAATTGACTAAAATTTGGTTTGAATGACTGAGTATCAATTCAATTTGGTC
ATATGCAACTAATATTTGTTCTTTGTAGTTACTATTTATTCAATAAAATA
ATTGATTTT

Design Primers for laminin

back to top

protein sequence

>Gsp_020815-protein ID=Gsp_020815-protein|Name=laminin|organism=Girardia sp.|type=polypeptide|length=1155bp
MTTFNNIPLLIFIFTKILQSEGFQPTRNVSVDVDDLKIRNMNLYFVCPYV
RSKTNVIKYFKYVENTSIVLKEKQNAHGIIITLKDASDMGKYGCSVILEN
GMIKNATFNIIDKQLMENPKLFIYKTEETIYVTQKGNVAELSCGNLMNPS
TTWYRPPQYHIYSGSKYIIKDVDRYSYGTYYCTSETTNTNTVSVRKVILV
KEIPKIKEKSIEEEVNYVETLSVQPGTVRYRSSNIAKSNDMIIWENPPGT
ILLDHERDLYIQSIKDDENIFYYRINRYGDSSINNVGKLIISIKKQDKLM
NLQSPVIYGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNK
KTFGKYSCEVLQGNEKQKTRFLNLLPEQKIESKIEMTPEPGNFYLYHSGA
KKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSV
SILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADN
VNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSS
TSFIVINNVLKRHEGTYVCQVLNTKVFGKIIVRTKPVLTVTPKSITIKPG
STARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRD
DHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDC
GDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNF
DELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP
QVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNI
TTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVMAPDFSVSVSKGL
ICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSD
AAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAF
NMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYR
LPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLAL
FKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCE
TKID*
back to top

coding sequence

>Gsp_020815.47.3511 ID=Gsp_020815.47.3511|Name=Gsp_020815.47.3511|organism=Girardia sp.|type=CDS|length=3465bp
ATGACGACTTTTAATAACATACCGTTACTTATTTTCATTTTTACGAAAAT
CTTGCAAAGTGAAGGATTCCAGCCGACAAGAAATGTTTCAGTAGATGTTG
ACGATTTGAAAATTAGAAATATGAACTTATATTTTGTTTGTCCTTACGTT
CGATCAAAAACTAACGTAATCAAATATTTTAAATATGTTGAAAATACTTC
AATAGTGTTAAAAGAAAAACAAAATGCACATGGAATAATAATCACTTTAA
AAGACGCATCTGATATGGGTAAATATGGGTGTTCCGTTATTTTAGAAAAT
GGAATGATTAAAAACGCAACATTTAATATTATCGATAAACAATTAATGGA
GAATCCAAAATTGTTTATTTATAAAACTGAAGAAACAATTTATGTTACTC
AGAAAGGTAACGTTGCTGAATTAAGTTGTGGAAATTTAATGAATCCATCT
ACTACTTGGTATAGACCACCACAATACCACATATATTCAGGCAGTAAATA
TATAATAAAAGATGTTGATCGATATAGTTACGGAACCTATTACTGTACCT
CGGAAACAACAAATACAAATACGGTTTCCGTTCGAAAAGTCATTTTAGTG
AAAGAAATTCCAAAAATAAAAGAAAAGTCAATTGAGGAGGAAGTAAATTA
TGTAGAAACCCTCTCAGTACAACCAGGAACTGTTAGATATCGATCATCTA
ATATTGCAAAAAGCAACGATATGATTATTTGGGAAAACCCACCAGGAACT
ATTTTATTGGATCATGAAAGAGATTTATATATACAATCCATAAAAGATGA
TGAAAATATTTTCTATTATAGAATTAACAGATATGGAGATTCATCTATTA
ATAATGTAGGGAAATTGATAATATCTATTAAAAAACAAGATAAATTAATG
AATCTACAGAGTCCTGTTATTTATGGAGGTGAAATAAAGATGGATTGTAT
CAGTTCAACCGATTTCAACAATAATACGGCTGTCATTTGGAAAAGAAATT
CCGAAATTATTTTTCACGGAAATACTTTGACTATACCTTCTTTTAACAAG
AAAACTTTTGGCAAATATAGTTGTGAAGTTTTGCAAGGAAATGAAAAACA
AAAAACACGGTTTTTAAATTTATTACCCGAACAAAAAATTGAATCAAAAA
TAGAAATGACACCTGAACCTGGAAACTTTTATTTATATCATTCAGGAGCT
AAGAAGGAATTACATTGTGAAATTGAGCGAGTGAATAACCAGTGGATAAT
GAAGGCAAAAGATGTAATATGGACATTTAATAACAAAAAAATTGAAACTA
TTGCAAACTCGGTTTTAAAAAGAGTAGATAGATTAGATACAAATTCAGTC
AGTATACTTGTATTGACAGATATTGACGAAAAACATGAAGGAAATTATAA
CTGTTTTCAAGGATCAACTGTACTTAGTGCAAAATTATTAATGGAACGTA
GTAACATTCTCCTTGAACTAGCTCCACCACTGCAAGAAGTGGCAGACAAT
GTTAATCAAGGTGCTGAATTACACTGTCGCATTGATACACAGAATGTTAA
TTCAAGTTCGATTATTTGGAAATTTATTCCGGAAAAATCATTAATTGAAA
CAGAGTTACCAATCGAAGCTAAAATTGAAAGACCTTCATTAACATCTTCA
ACATCCTTTATTGTAATTAACAATGTTTTGAAAAGACACGAAGGCACATA
TGTTTGCCAAGTCCTGAACACCAAAGTATTCGGAAAAATTATTGTGAGAA
CCAAACCTGTGTTGACTGTTACCCCAAAATCGATAACTATAAAACCTGGT
AGTACTGCTAGATTTCTTTGTCAATTAAATGGACTTGAAGGCAAAGTAAT
TTGGCGAAGAACGGATAGAAAAAGTTTGACTGTGAATAGAGAAAATAGAT
TAGGAGGTGATGCATCAAGTTTATTGGAAATCAAAGATGTTACACGAGAT
GATCACGGAACCATTTATGAATGTGTTTTTAATAAATTAACAGAATTTGT
AACTCTAAATGTCGAAGAAGAATGTGAATTAAATCAACGTAAATGTAAAA
ATGAAATTTGTATTGATGAGAACAAATTTTGTGATGGTAAAGATGACTGT
GGCGATAATTCAGATGAAGACCGTCAAAGATGCAATGAATGTAATCCGAA
TTCAATCCACTGTGACTTTCTTAATAATTCAAATCCAAATAAACGATGTG
TTATAAAGCATTGGCAATGCGACGGAATTGATGACTGTGGAAATAATTTC
GATGAACTAAATTGTCCCGTTAAAAATCAAAACAGGTGTATTGGAACACA
CTTTCTTTGTAACAACAATACTTTGATTCCTCGTTCGTATTGGTGTGATG
GTGAACCAGACTGTTTATCTATGGAAGACGAAATAGATTGCAGCGACCCA
CAAGTTATAGAGCCTGTGAAGCAAATGCAAATTTCAATATTTACAAACTC
AACTTTAATCTTGACTTGTAAAATGTCAGGACGTCCAGTTCCAACTATTT
CATGGAGATTTAACTGGGATCATTTGCCTGTAAATTTAAATCATAATATT
ACAACAACAACTTCCAATTGTAGCATGATTACAAGCACATTACTAATAAA
AGATATAAGTACAGACCACAGTGGTGTATATTCTTGTGAAGGTATTTCAA
GAAGAAGAGTAATGGCACCAGACTTTTCTGTATCAGTTTCAAAAGGATTA
ATATGCCAGAAACCATATTATAATAATGATGCTTGGTATCCAGAAATGTG
TCTCAGGTGTTATTGTTCAAATGTTACAGATGACTGTACAAGTGCGACAG
GATATATCACAAAACCTGAACCAATTGAAAGTGGAATTAAACCATCTGAT
GCAGCAATAGTTAATTTCAAAACTCTTGAATATTATAAGCCAGCTAGAGA
AATAACATTTGCTAATATGGAAAAAATGAATTACTTTATTAATGAAACAT
ATTATCAACGCTTAGTTCCTAATCAGGATTACTATTTTGGAGGTGCATTT
AATATGGGTGGCTCATGGTTAAAACGATATGGCTACCCTATGACTTATAA
GTTAAAGTTATCTGGAGAAAGCAAGACCTATATTCCTAATCCAATGGTTA
TGATAAAAGGAGAAGTTGCTTCAATATATTATTGTGGCGTTAAATATCGG
TTGCCAGTTTATGCTTCAAATGAAAATTTTGAAAATAACATTCGAATATT
TTTATGGGAAAAAGATTATTGGTATAATGATTATAGTTGCACAGTACCTG
TTTCTCGAAATGATATAATAAATGTTTTGAAAGAAGTACGACTAGCCTTG
TTTAAAGTAAAGTATTTTGTTGGACAAACTGATTTTCAAATGTCCAAACT
TTCAATGCAAGAAGCAATCGAAACCAAAGACAAGTATTCTTGGGTGGGTA
AAATAGAGAAATGTAATTGCCCGTTAGGATTTTCTGGACTCTCCTGTGAA
ACCAAAATTGACTAA
back to top
Gene Groups
laminin is similar in sequence to the genes of this group: GG2514
Gene NameGene ID
SMU15003325SMU15003325
lamininDdo_003647
lamininGsp_020815
Pgr_001754Pgr_001754
lamininPgr_008586
Pmo_019678Pmo_019678
lamininPmo_031777

Gene Group Protein Sequences

>SMU15003325

MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIR
PDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDK
TIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESV
NWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVK
NMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTI
LLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAM
DVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFK
KDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSG
VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNS
VSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELAD
NVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAAS
STSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKP
GGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATK
DDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKND
CGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNN
FDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN
PQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYN
ITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKG
QICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPS
DAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGA
FNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKY
RLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLV
LFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSC
ENKVE*
>Ddo_003647 laminin
MFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTY
KCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANI
NSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGT
YVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKV
IWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQ
VTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSP
NAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGT
HFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG
STLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTV
HNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSM
CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAR
EVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSY
QLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKI
RVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMS
KISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIKSNER*
>Gsp_020815 laminin
MTTFNNIPLLIFIFTKILQSEGFQPTRNVSVDVDDLKIRNMNLYFVCPYV
RSKTNVIKYFKYVENTSIVLKEKQNAHGIIITLKDASDMGKYGCSVILEN
GMIKNATFNIIDKQLMENPKLFIYKTEETIYVTQKGNVAELSCGNLMNPS
TTWYRPPQYHIYSGSKYIIKDVDRYSYGTYYCTSETTNTNTVSVRKVILV
KEIPKIKEKSIEEEVNYVETLSVQPGTVRYRSSNIAKSNDMIIWENPPGT
ILLDHERDLYIQSIKDDENIFYYRINRYGDSSINNVGKLIISIKKQDKLM
NLQSPVIYGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNK
KTFGKYSCEVLQGNEKQKTRFLNLLPEQKIESKIEMTPEPGNFYLYHSGA
KKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSV
SILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADN
VNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSS
TSFIVINNVLKRHEGTYVCQVLNTKVFGKIIVRTKPVLTVTPKSITIKPG
STARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRD
DHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDC
GDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNF
DELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP
QVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNI
TTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVMAPDFSVSVSKGL
ICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSD
AAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAF
NMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYR
LPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLAL
FKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCE
TKID*
>Pgr_001754 Pgr_001754
MESPTKFTYDLSQTKYVIQNSGSVELDCGAPANEIVTWFRPPQFHIYTGS
KLKIETLTKFDYGTYYCAIGSTAKSTVPVTKVILLPEEPKQKEKKLDEDF
LFMESLVPKSSEVRFKPSDVAGKFDTVTWEQPPGTILLEHGRNLYFQSYS
PETSKTPFYYRIHRNGDHLINKVGKLFIAHWQDKEEQMTVEGAVQYGNDM
TINCFSDPESINETHVVWRLDDKIIHRGNTYTIKNFQKKYFGKYSCEIEK
GGVRIVSRSINLAPEQDLAAKIEMTPDPGNYYNFHSGKNKELHCEIQRED
GNWKFKSKDIIWTLNGRKIDIGNPGSPFANTKRFGRLNTQSVSILVLKEL
GEDNKGTYKCFQGSTVYAATLLMEPSEILIELSPPEQTAADNVNQMAEFH
CRIDTPNYNSSFIRWSFIPEGSDQEEKVPTEAVIDNPIQTSSTSFVSIEN
VLKRHEGQYVCRVLDRKVVGKLIVKSRPVLKVNPKEITVKPGGTARYLCQ
LTGIEGKVIWRRRDKKSFIENKETRMGGDTNSLLEIKQTTTADDGTVYEC
NFNKLTEYVTLWVKDDCALNQRKCQNSTCIDENKFCDGKNDCGDNSDEDP
KRCNECTPNSIHCDFLNNSIPNKRCVVKHWQCDGVDDCGNNFDELNCPVK
NTEKCLGSHYQCGNETLIPRAYWCDGEVDCKSGEDEEGCTSPQVIEPAKP
SQLTVVENSTMIIECQISGRPVPTVTWRYNWGYLPDKLEHNITDVVTNCS
MVTSTLRINNISPEQSGIYTCEGIAKRRVMAPDISVTVTKETVCKRPFFN
NDAWTQELCLRCYCSNVTDDCTSASGYVINPDLIESQARSSDAAVINYKT
NEYYEPARPVGFANDTLKMYIINKENYKKLIPDDDHFLGGSFNMRGSWIN
RYGFPLTYKLTLAGESVGHISGPIVVMVGHSEKKIFYCTPKYRLPAYASD
DNTENNMRIILWEQDRWFVDDKCSKSVTRSEFIEVLRDVRLVLFRVRYFT
KQTDFKMSKITMQEAIKSKYEHSWIPRIEKCNCPQGYSGLSCENKST*
>Pgr_008586 laminin
MISIAKSLFIVKLVVLGFLVDENTAVFNLTRNVSIQVEPLKYGEVNIYFV
CPNIRSNEDKVMYYKVEKGIKGLIQKRKPHGIILKIKTKSDLGEYQCSII
SKDSSTRNATLNIIDSKEMESPVKFVYDYSKTKYVIEKSGSVELDSEAST
NDMVTWYRPPQFHIFTGRKLKIDNLNEFDFGTYYFAIGMTSKSVLQVTKV
ILLPQRPTKREKTIDEDVMYLENIIPKAKEIRYRPGNVAGISETVTWEQP
PGTILLEHGRDAYFYSYTASKSDLPLYYRINKNGDFTVNKVGKVFISEWK
NREVEMSVEGRAAYGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYF
IKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYY
NFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNIN
RFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIEL
SPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPES
IVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTGILIVKTKQMLTV
NPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNS
LLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDE
GKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQC
DGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKS
MEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG
YLPDTMDHNVTEVVTNCTLITSTLTITNISPEDSGIYTCEGIEKRRIMAP
DFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPD
LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVT
SDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNA
KKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVF
IELLRDVRFIFFRIKYFRKQSDFKMSMITMQEAIKTKYDYLWVPRLEKCN
CPSGYSGLSCETKTE*
>Pmo_019678 Pmo_019678
GVFNNEVVTWYRPPQFHIFTGNKLEIKQLTEFDFGTYYFSVGMTTKSVLL
VTKVILLPSEPEKREKTIDEDVLYLENVIPKAKDIRYRPGNVDGNSDIVT
WEQPPGTILLEHGRDAYFSAYSINQTELPFYYRINRNGDSSVNKVGKVFI
SEWKDREVEMSVEGRAAYGAEMKVNCFPSPDLGNDTEVIWKLDGKEIHRG
NTYIIKTFQKEVYGRYSCEIHSRGILIKSRIINLTPREGIESKIEMTLDP
GLYYNFHPDKTKELHCEIQREDGEWKFKSKDIIWTFNGRKIDVYNPLSAF
GNINRFGRLDTRSVSILVLRNMGEDNQGVYKCFQGPSTYAAILIMEQSEV
LIELSPPKLIVQHNSNHVAEFHCRIDTPGYNSSFIEWKFKEFNSTIEQDI
PPEATVEKPHQTSATSFITIKNSLKKHEGIYVCKVLGQQVSGILIVKTKQ
VLTVNPKEITVSPGGTARFFCQLSGIDGKVVWRRKDRKNFILNKENRKGG
STNSLLEVNHVTTADDGTIYECNFNELTESAILWVKDECALNQRKCKNET
CIDETKFCDGKDDCGDNSDEDPTRCKECIPNSIHCDFLNNSSPIKRCIVR
HWQCDGVDDCGNNFDELNCPVMNKDRCIGSHYLCGNGTLIPRAYWCDGEP
DCRSMEDEEGCSSSQVIEPSKLSHLSIIENSTLTLICQISGRPIPTITWR
YNWGYLPDSLNHNLTEVVTNCSMITSTLTINNIAPENSGIYTCEGIEKRR
IMAPDYAVTVTKGSVCKRPFFNNDAWDQEFCLRCYCSNVTDDCTSASGYI
TNPDLVESKVRSSDAAIMNYKTNDYHEPARSISFVDDNLKMYSINKTNYM
KYVIEDDFFLGGSFNMRGSWINRYGYPLTYKIVISGDSVGHISGPIVVIM
SNNEKKIYYCSWKYRISAYASDEYYENNIRIILWEQDRWFTDNACTTKVQ
RAEFLEILK
>Pmo_031777 laminin
MHIFIPLLVMVGYFTKSYESVFPHTRTVSIDLEKLKKEPFNIYFTCANIR
SKQDRVRYFRVQNGARGLIEKKKRFGIILSIKSESDLGQYECSVTAPDKT
VLNATLNTVDMKKMESPTKFVYDLSKTKYVIQKSGSVELDCGTSGNEVVT
WYKPTQYHIFTGSKLKIDSLTNFDYGTYYCAVGDTNKATLMVTKVILLPE
EPKQKEKKIDEDVMYIESFIPKSKSVRFKPIDVVDKSFAVTWEQPPGTVL
LEHARKLYFQSFSPDQTKIPFFYRITKNGDPSVNKVGKVYISDWTDKEVE
VTLEGAVQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQ
KQFFGKYSCEIQQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMG
KNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRL
DTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQ
TAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKP
VLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGKLIVKSRPVLTVNPKEI
TVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIK
QATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCN
GVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDD
CGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE
GCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDK
LDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVT
VTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESK
VKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHF
LGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYY
CTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEVLR
DVRLVLFRVKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGY
SGLSCEMKEN*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.