sfrp-1, Gsp_013592 (mRNA) Girardia sp.

Overview
Namesfrp-1
Unique NameGsp_013592
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1317
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|48475052|ref|NP_003004.1| (secreted frizzled-related protein 2 precursor [Homo sapiens])

HSP 1 Score: 153.295 bits (386), Expect = 1.5554e-41
Identity = 90/294 (30.61%), Postives = 142/294 (48.30%), Query Frame = 1
Query:  235 TFILFVFNVNCFIGDWQSF------QSGYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT----LVPE-----KNCDLCI-KNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTDLNL-------RLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
+ +L +C +G + Y C IP N LC + Y M LPN + HE+++E ++ + W+ LV QCH D +KF+CSL+APVC+ + + PC LCV VK+ C P M +GF WP +++C +FPQ N LCIP L+P K C+ C KN I C + ++ K+K I I T +I+L+ KSK + S+ DL L+C C + + +++M + E V+ + +W++ + EFK + I+
Sbjct: 7 SLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|188528609|ref|NP_003006.2| (secreted frizzled-related protein 5 precursor [Homo sapiens])

HSP 1 Score: 140.969 bits (354), Expect = 8.87287e-37
Identity = 86/260 (33.08%), Postives = 133/260 (51.15%), Query Frame = 1
Query:  313 QCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI-------PRTLVP-EKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTD---LNLRLK----CNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
QC IP + LC VGY RM LPN ++HES+ E Q + W+ L+ +CH D + F+CSL+APVC+ + + PCR LC V+ C P M+ YGF WP ++ C KFP N LCI P T P K C C S + + + C S V++ +IK I I + +++ +K K L + D L L +K C C L +L G +++M + + ++ + +W +K E K ++K + ++
Sbjct: 52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIK-IENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLD----SLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 301
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|56117838|ref|NP_003003.3| (secreted frizzled-related protein 1 precursor [Homo sapiens])

HSP 1 Score: 137.117 bits (344), Expect = 1.88891e-35
Identity = 88/271 (32.47%), Postives = 129/271 (47.60%), Query Frame = 1
Query:  271 IGDWQSFQSGYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTLV-------PEKN--CDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSK----TMQIVLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQN 1044
IG +QS + QC IP + LC NVGY +MVLPN ++HE++ E Q + W+ L+N CH + F+CSL+APVC+ + + PCR LC V++SC P M+ +GF WP ++KC KFP + +CI T P+ C C E I C S +R KIK + + K K L C C L L ++IM + +++ ++ I KW +K EFK+ MK ++N
Sbjct: 43 IGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP--EGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLD----NLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKN 303
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 96.2857 bits (238), Expect = 1.78941e-20
Identity = 44/119 (36.97%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  310 DQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFQNSLCI 663
D Y P + LC ++ YN+ ++PN + H + E+A + LV QC +++ F+CS+YAPVC + Q +PPCR LC ++ C M +GF WP +KC KFP LC+
Sbjct: 112 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLE--QALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCV 228
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|13994190|ref|NP_114072.1| (frizzled-8 precursor [Homo sapiens])

HSP 1 Score: 95.1301 bits (235), Expect = 4.53486e-20
Identity = 43/116 (37.07%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  343 LCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTLVPEKN 690
LC+ +GYN +PN H++ +EA + LV QC D++ F+CS+Y P+C+ + + +PPCR +C K C P M+ YGF WP M+C + P+ N P TL + N
Sbjct: 42 LCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYK-KPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGN----PDTLCMDYN 152
BLAST of sfrp-1 vs. uniprot
Match: gi|61216791|sp|Q863H1|SFRP2_CANFA (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; Flags: Precursor [Canis lupus familiaris])

HSP 1 Score: 155.221 bits (391), Expect = 7.70195e-42
Identity = 92/293 (31.40%), Postives = 144/293 (49.15%), Query Frame = 1
Query:  235 TFILFVFNVNCFIGDWQSFQSG-----YTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT----LVPE-----KNCDLCI-KNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTDLNL-------RLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
+ +L V +C +G + G Y C IP N LC + Y M LPN + HE+++E ++ + W+ LV QCH D +KF+CSL+APVC+ + + PC LCV VK+ C P M +GF WP +++C +FPQ N LCIP L+P K C+ C KN I C + ++ K+K I I T +I+L+ KSK + S+ DL L+C C + + +++M + E V+ + +W++ + EFK + I+
Sbjct: 7 SLLLLVLASHCCLGSARGLFFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQKLGGELVITSVKRWQKGQREFKRISRSIRKL 292
BLAST of sfrp-1 vs. uniprot
Match: gi|61216828|sp|Q96HF1|SFRP2_HUMAN (RecName: Full=Secreted frizzled-related protein 2; Short=FRP-2; Short=sFRP-2; AltName: Full=Secreted apoptosis-related protein 1; Short=SARP-1; Flags: Precursor)

HSP 1 Score: 153.295 bits (386), Expect = 4.12127e-41
Identity = 90/294 (30.61%), Postives = 142/294 (48.30%), Query Frame = 1
Query:  235 TFILFVFNVNCFIGDWQSF------QSGYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT----LVPE-----KNCDLCI-KNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTDLNL-------RLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
+ +L +C +G + Y C IP N LC + Y M LPN + HE+++E ++ + W+ LV QCH D +KF+CSL+APVC+ + + PC LCV VK+ C P M +GF WP +++C +FPQ N LCIP L+P K C+ C KN I C + ++ K+K I I T +I+L+ KSK + S+ DL L+C C + + +++M + E V+ + +W++ + EFK + I+
Sbjct: 7 SLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. uniprot
Match: gi|61216765|sp|P97299|SFRP2_MOUSE (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; AltName: Full=Protein SDF5; AltName: Full=Secreted apoptosis-related protein 1; Short=SARP-1; Flags: Precursor)

HSP 1 Score: 152.91 bits (385), Expect = 6.24306e-41
Identity = 87/267 (32.58%), Postives = 134/267 (50.19%), Query Frame = 1
Query:  298 GYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT----LVPE-----KNCDLC-IKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTDLNL-------RLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
Y C IP N LC + Y M LPN + HE+++E ++ + W+ LV QCH D +KF+CSL+APVC+ + + PC LCV VK+ C P M +GF WP +++C +FPQ N LCIP L+P K C+ C KN I C + ++ K+K I I T +I+L+ KSK + S+ DL L+C C + + +++M + E V+ + +W++ + EFK + I+
Sbjct: 34 SYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293
BLAST of sfrp-1 vs. uniprot
Match: gi|61216861|sp|Q9XSC1|SFRP5_BOVIN (RecName: Full=Secreted frizzled-related protein 5; Short=sFRP-5; Flags: Precursor)

HSP 1 Score: 148.673 bits (374), Expect = 3.91792e-39
Identity = 91/261 (34.87%), Postives = 135/261 (51.72%), Query Frame = 1
Query:  313 QCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI-------PRTLVP-EKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRI-IPIGSKTMQIVLQKKSKFLKFFANFSQTD---LNLRLK----CNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
QC IP + LC VGY RM LPN ++HES+ E Q + W+ L+ +CH D + F+CSL+APVC+ + + PCR LC V+ C P M+ YGF WP ++ C KFP N LCI P T P K C C S + + + C S V++ +IK I I G + + I QKK K LK + D L L +K C C L +L G +++M + + ++ + +W +K E K ++K + ++
Sbjct: 50 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKL-IGAQKKKKLLK-SGPLKRKDTKRLVLHMKNSAGCPCPQLD----SLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 299
BLAST of sfrp-1 vs. uniprot
Match: gi|61216846|sp|Q9IA96|SFRP2_CHICK (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; Flags: Precursor [Gallus gallus])

HSP 1 Score: 147.132 bits (370), Expect = 6.80961e-39
Identity = 87/267 (32.58%), Postives = 129/267 (48.31%), Query Frame = 1
Query:  298 GYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPR---------TLVPEKNCDLCI-KNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTD-------LNLRLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNF 1047
Y C IP LCR + Y M LPN + HE+++E ++ + W+ LV QCH D RKF+CSL+APVCI + + PC LC VKESC P M +GF WP ++ CS+FP+ N LCIP T K CD C KN I C + ++ K+K I I T +I + KSK + ++ D L L+C C + + +++M + E V+ + +W++ + FK + I+
Sbjct: 31 SYKRSNCKPIPAPMLLCRGIEYQSMRLPNLLGHETVQEVLEQATTWIPLVQKQCHPDTRKFLCSLFAPVCIDDLD-EIIQPCHSLCEEVKESCAPVMSAFGFPWPDMLDCSRFPK-DNDLCIPLASSDHILPVTREAPKVCDACKNKNEDDNDIMENLCKNDFALKIKVKEIAYINGDT-KITPETKSKTIYKLNGLTERDLRKIVLWLKGGLQCTCDEM----NDINVPYLVMGQKQAGELVITSLKRWQKGQRAFKRFSRSIRKL 290
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 89.7373 bits (221), Expect = 7.81017e-19
Identity = 50/129 (38.76%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  292 QSGYTIDQCYH----IPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFQNSLCI 663
SG +D H P S+C+N+ YN ++PN I H EEA + LV C D++ F+CSLY PVC +R +PPCR LC + + C MK Y F+WP ++CSKFP LC+
Sbjct: 39 SSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER--PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 89.3521 bits (220), Expect = 9.46308e-19
Identity = 50/129 (38.76%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  292 QSGYTIDQCYH----IPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFQNSLCI 663
SG +D H P S+C+N+ YN ++PN I H EEA + LV C D++ F+CSLY PVC +R +PPCR LC + + C MK Y F+WP ++CSKFP LC+
Sbjct: 39 SSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER--PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 86.6557 bits (213), Expect = 9.25965e-18
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  343 LCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTLVPEKNCDLCIKNPSY 720
+CR +GYN PN + HE+ +EA + LV +C D++ F+CS+Y P+C+ + +P CR +C + C P M+ Y F+WP M C P + P+ +LC++ PSY
Sbjct: 71 MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGD---------PD---NLCMEQPSY 183
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 86.6557 bits (213), Expect = 9.25965e-18
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  343 LCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTLVPEKNCDLCIKNPSY 720
+CR +GYN PN + HE+ +EA + LV +C D++ F+CS+Y P+C+ + +P CR +C + C P M+ Y F+WP M C P + P+ +LC++ PSY
Sbjct: 71 MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGD---------PD---NLCMEQPSY 183
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 86.6557 bits (213), Expect = 9.25965e-18
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  343 LCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTLVPEKNCDLCIKNPSY 720
+CR +GYN PN + HE+ +EA + LV +C D++ F+CS+Y P+C+ + +P CR +C + C P M+ Y F+WP M C P + P+ +LC++ PSY
Sbjct: 71 MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGD---------PD---NLCMEQPSY 183
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001274 (Asxlregen_comp63361_c0_seq1|m.13574|m.6037)

HSP 1 Score: 537.339 bits (1383), Expect = 0
Identity = 272/342 (79.53%), Postives = 298/342 (87.13%), Query Frame = 1
Query:  214 MVIIFRFTFILFVFNVNCFIGDWQSFQSGYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTLVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVN-QNEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLXXXXXXXXXXXXXXXX-----QQTRRSKKPINTRSSSIS* 1221
M IF + +LF+ NVN FIGDWQ+FQSGYTIDQCY IPDNF+LC NVGY MVLPNYIQHESIEEA QHS+VWMGLVNTQCH+DI+KFICSLYAPVCIS+QR QKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQF+NSLCIP+T+VP K CDLC+K SYEVIANRFCLSPIVIRAKIKRIIP +QI+LQKKSKFLKF ANFSQ L L LKCNCTNLKFKQRALKGRWIIMA+++ N+AVVNFI+KWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNN++KYSN Q++R+S KP N RS+ IS*
Sbjct: 3 MTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKP-NNRSAGIS* 343
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15040524 (dd_smedV4_8832_0_1|m.39951|m.18186)

HSP 1 Score: 187.578 bits (475), Expect = 1.38454e-54
Identity = 106/281 (37.72%), Postives = 166/281 (59.07%), Query Frame = 1
Query:  271 IGDWQSFQSGYTIDQCYHIPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT--LVPE-------KNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFANFSQTDL----NLRLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKL 1074
+ +W + GY+ +C+ IP+ F LC+N+GYN+M+LPN++QHE+++EA+ S W + +CH D R+F+CSLYAPVC+ ++ V+K+ PC+ELC++VK++C P+M +G+ WP I+ C KFPQ LCI T VP K C+ C S I + +C S VIRAKI R+ + + L KKSK +K + TDL ++ + C C + KGRW++M VN + + +TKWK+K +FK ++ ++ F +C S+
Sbjct: 25 VPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIK----SNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRF 299
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15030883 (SmedSxlregen_c55322_g1_i1|m.6956|m.30359)

HSP 1 Score: 159.844 bits (403), Expect = 7.59736e-44
Identity = 89/303 (29.37%), Postives = 150/303 (49.50%), Query Frame = 1
Query:  268 FIGDWQSFQSGYTIDQCYHIPDNFSLCRNVG-YNRM-VLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT-------------------------------LVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQIVLQKKSKFLKFFA--NFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQNEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSK 1071
F D++ + ++QCY N +LC G N M +++ ++ S +W+ L++T+CH+D+ KF+C++YAP+C+ R +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP + CI T + +KNC +C + E++ FC +VIRAKI I + I LQ KS + S +L ++C C+ L+ + KG+W++ + + +V F+TKW+RK+ +F+ + + CK++
Sbjct: 17 FSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 319
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001054 (Asxlregen_comp62015_c0_seq1|m.11130|m.22104)

HSP 1 Score: 100.908 bits (250), Expect = 1.07677e-22
Identity = 43/106 (40.57%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  325 IPDNFSLCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQ 642
IP S+C+ +GYN +PN + H S+EEA + + LV C D+R F+CS+YAP+C+ + ++P CR LC++ +E C M YGF WP M C K P+
Sbjct: 36 IPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWP-NRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE 140
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15028068 (SmedSxldir_c94438_g1_i1|m.35603|m.6544)

HSP 1 Score: 98.9821 bits (245), Expect = 5.42906e-22
Identity = 45/113 (39.82%), Postives = 68/113 (60.18%), Query Frame = 1
Query:  343 LCRNVGYNRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCISSQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNS--LCIPRTL 675
LCR + YNR +PN HE+ EEA Q + +M LV +C D+ F+CS++ P+C+ + + +PPCR +C K+ C P M+ YGF WP M+C +FP+ LC+ R +
Sbjct: 56 LCRGLWYNRTRMPNMFNHETQEEAGQQVQQFMYLVTVKCSPDLHFFLCSIFTPICVENYD-KPLPPCRSICQRSKDGCTPIMRRYGFSWPPQMECEQFPERSTDKQLCMERNI 167
The following BLAST results are available for this feature:
BLAST of sfrp-1 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|48475052|ref|NP_003004.1|1.555400e-4130.61secreted frizzled-related protein 2 precursor [Hom... [more]
gi|188528609|ref|NP_003006.2|8.872870e-3733.08secreted frizzled-related protein 5 precursor [Hom... [more]
gi|56117838|ref|NP_003003.3|1.888910e-3532.47secreted frizzled-related protein 1 precursor [Hom... [more]
gi|4503825|ref|NP_003496.1|1.789410e-2036.97frizzled-1 [Homo sapiens][more]
gi|13994190|ref|NP_114072.1|4.534860e-2037.07frizzled-8 precursor [Homo sapiens][more]
back to top
BLAST of sfrp-1 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|61216791|sp|Q863H1|SFRP2_CANFA7.701950e-4231.40RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216828|sp|Q96HF1|SFRP2_HUMAN4.121270e-4130.61RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216765|sp|P97299|SFRP2_MOUSE6.243060e-4132.58RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216861|sp|Q9XSC1|SFRP5_BOVIN3.917920e-3934.87RecName: Full=Secreted frizzled-related protein 5;... [more]
gi|61216846|sp|Q9IA96|SFRP2_CHICK6.809610e-3932.58RecName: Full=Secreted frizzled-related protein 2;... [more]
back to top
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|442632294|ref|NP_001261836.1|7.810170e-1938.76frizzled, isoform C [Drosophila melanogaster][more]
gi|17864440|ref|NP_524812.1|9.463080e-1938.76frizzled, isoform A [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|9.259650e-1832.54frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|9.259650e-1832.54frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|9.259650e-1832.54frizzled 2, isoform C [Drosophila melanogaster][more]
back to top
BLAST of sfrp-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150012740.000000e+079.53Asxlregen_comp63361_c0_seq1|m.13574|m.6037[more]
SMU150405241.384540e-5437.72dd_smedV4_8832_0_1|m.39951|m.18186[more]
SMU150308837.597360e-4429.37SmedSxlregen_c55322_g1_i1|m.6956|m.30359[more]
SMU150010541.076770e-2240.57Asxlregen_comp62015_c0_seq1|m.11130|m.22104[more]
SMU150280685.429060e-2239.82SmedSxldir_c94438_g1_i1|m.35603|m.6544[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_013592 ID=Gsp_013592|Name=sfrp-1|organism=Girardia sp.|type=mRNA|length=1317bp
TTCAAATCAATAACATGCAATAAGAAAAAAACGAGTTTGTATATTAGTAT
GTGGATATTTAACATTGTGACATCTGACGGTAATTAATATGATTGGCTAT
TTTCCACTTATCAGACACCACCAAACACAAGTTATTAAACTATAATATTT
AATCAAATTTTACCAAAATTATTTGAATTTTTCCTTCGTAAATTTTTTTT
TTGATTTTTGGAAATGGTAATAATTTTCCGTTTTACTTTTATATTATTTG
TTTTTAACGTGAATTGTTTCATTGGAGATTGGCAATCGTTCCAAAGTGGT
TACACAATTGATCAATGCTATCATATTCCTGATAATTTCAGTCTTTGTCG
TAATGTTGGTTATAATAGAATGGTTTTACCAAATTACATTCAACATGAAT
CTATTGAAGAAGCTGTACAACATTCTCGAGTTTGGATGGGTTTAGTAAAT
ACACAGTGTCATATTGATATCAGAAAATTCATTTGTTCTCTTTATGCTCC
GGTATGTATTAGCAGTCAAAGAGTTCAAAAGGTTCCACCTTGTAGGGAAT
TATGTGTAACTGTAAAGGAATCTTGTTTACCAAGTATGAAAATGTATGGA
TTTGATTGGCCAACAATAATGAAATGTTCAAAGTTTCCACAATTTCAAAA
TTCTCTATGTATACCAAGAACTCTCGTTCCAGAAAAGAACTGTGATTTAT
GCATAAAAAATCCATCATATGAAGTTATAGCAAATAGATTTTGTTTATCA
CCGATAGTTATTCGAGCAAAAATCAAACGAATTATTCCGATTGGTAGTAA
AACAATGCAGATAGTATTACAGAAAAAATCGAAATTTCTCAAATTTTTTG
CTAATTTCAGTCAAACCGATTTGAATTTACGTTTGAAATGTAACTGCACA
AATTTAAAATTCAAACAACGAGCATTGAAAGGTCGATGGATAATAATGGC
TAAAGTAAATCAAAATGAAGCTGTTGTAAATTTCATTACTAAATGGAAAA
GGAAAAAAGCTGAATTCAAACATTCAATGAAAATCATACAGAATTTTGGA
CATATTGTGTGCAAATCAAAATTACCAGATGGGATTAGTTTACGAGAACG
ATATGCTGCCTATTTGAAAATGAACAATAAAATTAAATATTCTAATAATA
ACAATAAATCTAAACAGCAGACAAGACGATCTAAAAAACCGATCAATACT
CGATCGTCAAGCATTTCCTGATTGCATTTTCGTTTTAAAAATCATGTTCA
TAAATGGATTTAGTTGAATGTTCTCTGTAATTTCTACCATAACAAATTTC
TTATTGATTAATGCACA

Design Primers for sfrp-1

back to top

protein sequence

>Gsp_013592-protein ID=Gsp_013592-protein|Name=sfrp-1|organism=Girardia sp.|type=polypeptide|length=336bp
MVIIFRFTFILFVFNVNCFIGDWQSFQSGYTIDQCYHIPDNFSLCRNVGY
NRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCIS
SQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI
PRTLVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQI
VLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQ
NEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAY
LKMNNKIKYSNNNNKSKQQTRRSKKPINTRSSSIS*
back to top

coding sequence

>Gsp_013592.214.1221 ID=Gsp_013592.214.1221|Name=Gsp_013592.214.1221|organism=Girardia sp.|type=CDS|length=1008bp
ATGGTAATAATTTTCCGTTTTACTTTTATATTATTTGTTTTTAACGTGAA
TTGTTTCATTGGAGATTGGCAATCGTTCCAAAGTGGTTACACAATTGATC
AATGCTATCATATTCCTGATAATTTCAGTCTTTGTCGTAATGTTGGTTAT
AATAGAATGGTTTTACCAAATTACATTCAACATGAATCTATTGAAGAAGC
TGTACAACATTCTCGAGTTTGGATGGGTTTAGTAAATACACAGTGTCATA
TTGATATCAGAAAATTCATTTGTTCTCTTTATGCTCCGGTATGTATTAGC
AGTCAAAGAGTTCAAAAGGTTCCACCTTGTAGGGAATTATGTGTAACTGT
AAAGGAATCTTGTTTACCAAGTATGAAAATGTATGGATTTGATTGGCCAA
CAATAATGAAATGTTCAAAGTTTCCACAATTTCAAAATTCTCTATGTATA
CCAAGAACTCTCGTTCCAGAAAAGAACTGTGATTTATGCATAAAAAATCC
ATCATATGAAGTTATAGCAAATAGATTTTGTTTATCACCGATAGTTATTC
GAGCAAAAATCAAACGAATTATTCCGATTGGTAGTAAAACAATGCAGATA
GTATTACAGAAAAAATCGAAATTTCTCAAATTTTTTGCTAATTTCAGTCA
AACCGATTTGAATTTACGTTTGAAATGTAACTGCACAAATTTAAAATTCA
AACAACGAGCATTGAAAGGTCGATGGATAATAATGGCTAAAGTAAATCAA
AATGAAGCTGTTGTAAATTTCATTACTAAATGGAAAAGGAAAAAAGCTGA
ATTCAAACATTCAATGAAAATCATACAGAATTTTGGACATATTGTGTGCA
AATCAAAATTACCAGATGGGATTAGTTTACGAGAACGATATGCTGCCTAT
TTGAAAATGAACAATAAAATTAAATATTCTAATAATAACAATAAATCTAA
ACAGCAGACAAGACGATCTAAAAAACCGATCAATACTCGATCGTCAAGCA
TTTCCTGA
back to top
Gene Groups
sfrp-1 is similar in sequence to the genes of this group: GG7656
Gene NameGene ID
SMU15001274SMU15001274
sfrp-1Ddo_009225
sfrp-1Gsp_013592
sfrp-1Pgr_015361
sfrp-1Pmo_009874

Gene Group Protein Sequences

>SMU15001274

MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNV
GYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVC
ISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSL
CIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAI
QIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQI
DSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERY
AAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS*
>Ddo_009225 sfrp-1
LIAFSNDIGIRGMITILPLGLLLSLFSNGNCFIGDWESFRSGYTTDQCYK
VPENFSMCHNVGYNKMVLPNFIQHEYMEEAIAHSRVWLSLVKSQCHLDVR
KFLCSLYAPVCITNKRIQKVPPCRELCIIVKEACLPSMKMYGFNWPEIMK
CSKFPPVQNALCIPKTTVKKKNCELCVKNAPYEVIANRFCLSPIVIRAKI
KRIIPKESGFQIVLHQKSKFLKFQSNSSRDSVNLWLKCNCLNLKFQQRAL
RGRWIIMARIVEDRFVVNFISKWKKKKEEFKNSIRIIQKFGNVVCKSKLK
DGISLQERYVAYMKMNNKTNYQNQLKQQTRKFKKRKQNQQRRIP*
>Gsp_013592 sfrp-1
MVIIFRFTFILFVFNVNCFIGDWQSFQSGYTIDQCYHIPDNFSLCRNVGY
NRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCIS
SQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI
PRTLVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQI
VLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQ
NEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAY
LKMNNKIKYSNNNNKSKQQTRRSKKPINTRSSSIS*
>Pgr_015361 sfrp-1
LFLFFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMIL
PNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQ
KVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVS
KGKKCRPCVKSSSYEVMANKFCLSNIVIRAKIKRIVKEGNNGFKIELGQK
TGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVV
NFITKWKRKNTNFRYSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYA
KMNNITQFKNRKNRNNNSKENKKPKKSWTTQKKNAYKN*
>Pmo_009874 sfrp-1
MCILSLFFFNIFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY
KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIY
NMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI
PSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYII
DLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVK
GQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKR
YLAYAKMKNRNKASNKTK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.