pc2, Gsp_010792 (mRNA) Girardia sp.

Overview
Namepc2
Unique NameGsp_010792
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length2205
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of pc2 vs. RefSeq Human
Match: gi|20336244|ref|NP_002585.2| (neuroendocrine convertase 2 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 686.411 bits (1770), Expect = 0
Identity = 370/617 (59.97%), Postives = 438/617 (70.99%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPY 1945
LF + ++ + + TN + V LH G D A +VA E GF + R + + ++H + S +H + L P VK A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + TDAC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 15 FLFCVMVFASAERPVFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. RefSeq Human
Match: gi|320118926|ref|NP_001188457.1| (neuroendocrine convertase 2 isoform 3 [Homo sapiens])

HSP 1 Score: 684.871 bits (1766), Expect = 0
Identity = 368/603 (61.03%), Postives = 432/603 (71.64%), Query Frame = 2
Query:  137 IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPY 1945
+ TN + V LH G D A +VA E GF + R + + ++H + S +H + L P VK A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + TDAC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 10 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 580
BLAST of pc2 vs. RefSeq Human
Match: gi|320118928|ref|NP_001188458.1| (neuroendocrine convertase 2 isoform 2 preproprotein [Homo sapiens])

HSP 1 Score: 667.152 bits (1720), Expect = 0
Identity = 364/617 (59.00%), Postives = 427/617 (69.21%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPY 1945
LF + ++ + + TN + V LH G D A +VA E GF + + VK A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + TDAC+ + V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 15 FLFCVMVFASAERPVFTNHFLVELH-KGGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYRDINE----------------------IDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKE-NFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 564
BLAST of pc2 vs. RefSeq Human
Match: gi|20336242|ref|NP_000430.3| (neuroendocrine convertase 1 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 421.009 bits (1081), Expect = 1.79599e-134
Identity = 249/604 (41.23%), Postives = 360/604 (59.60%), Query Frame = 2
Query:  146 NQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKEN-MKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQINKRYR-FNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRP 1942
N+W + PG + A+ +A+E G+ LL N +++ HK P S +++ K L V A+Q R KR ++++ + L DP+++++WY+++T + LDL+V+ W +GITGKGV ++DDG+++ H D+ NY+ E+SYDF+ ND PFPRY N HGTRCAGEI+ + +N CGVGVAYNSK+ G+RMLD +TD IEA+++ ++ ++DIYSASWGP DDG+TV+GP +A GV +GR+GKGSI+VWAS G D+C+CDGY S++TISI+SA+ G + Y E CSSTLA+++S+G D + + DL+ CT H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+ W NGAGL N FG+G+L+A +V +A + W +VPE+ C+ + R +I+EI T AC+ + + LEHVQ +++ SRRGD+ + LTS GT++++L+ R + D S GF W FM+ HTWGENP G W L I + ++G W L+LHGT ++P
Sbjct: 33 NEWAAEI--PGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSA---------------------------LRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQE-NAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 598
BLAST of pc2 vs. RefSeq Human
Match: gi|4505579|ref|NP_002560.1| (furin preproprotein [Homo sapiens])

HSP 1 Score: 416.001 bits (1068), Expect = 4.08576e-132
Identity = 251/600 (41.83%), Postives = 345/600 (57.50%), Query Frame = 2
Query:  134 KIVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXX-XXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGT 1930
K+ TN W VR+ PG +AN VA++ GF L + + + H+ V S P H L P V+ +Q R KR + + PTDP F ++WY+ GV DLNV +AWAQG TG G+ +I+DDGI+ HPDL+ NY+ +S+D + DP P PRYT N HGTRCAGE++A +NG+CGVGVAYN++I G+RMLD +TD +EA ++ + ++I IYSASWGP DDG+TVDGP A GV++GR G GSI+VWASG+GG D S++T+SI+SAT G Y E+CSSTLA+T+S+G + + T DL +CT H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK ++W NG G + +H +GYG+LDAG MV +A+ W V + CI + + ++ K L + AC + H + LEH QA +++ +RRGD+ + L SPMGT S +L+ RP D S GF W FMTTH+W E+P G+W L I +T + + G +++ LVL+GT
Sbjct: 28 KVFTNTWAVRI--PGGPAVANSVARKHGFLNLGQIFG--DYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKR-------------------------------DVYQEPTDPKFPQQWYL------SGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPK--DIGKRLEVRKTVTACLGEPNH-ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPSGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573
BLAST of pc2 vs. uniprot
Match: gi|13124785|sp|P16519|NEC2_HUMAN (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 686.411 bits (1770), Expect = 0
Identity = 370/617 (59.97%), Postives = 438/617 (70.99%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPY 1945
LF + ++ + + TN + V LH G D A +VA E GF + R + + ++H + S +H + L P VK A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + TDAC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 15 FLFCVMVFASAERPVFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. uniprot
Match: gi|75061998|sp|Q5REC2|NEC2_PONAB (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 686.411 bits (1770), Expect = 0
Identity = 370/617 (59.97%), Postives = 438/617 (70.99%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPY 1945
LF + ++ + + TN + V LH G D A +VA E GF + R + + ++H + S +H + L P VK A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + TDAC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 15 FLFCVMVFASAERPVFTNHFLVELH-KGGEDEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. uniprot
Match: gi|128004|sp|P28841|NEC2_RAT (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 684.871 bits (1766), Expect = 0
Identity = 370/645 (57.36%), Postives = 448/645 (69.46%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2029
LLF + ++ + + TN + V LH G + A +VA E GF + R + + ++H + S +H + L P +K A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + T+AC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY + + KL + K+Q +
Sbjct: 14 LLFCVMVFASAERPVFTNHFLVELHKDGEEE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624
BLAST of pc2 vs. uniprot
Match: gi|128003|sp|P21661|NEC2_MOUSE (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 684.485 bits (1765), Expect = 0
Identity = 370/645 (57.36%), Postives = 447/645 (69.30%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2029
LF + ++ + + TN + V LH G + A +VA E GF + R + + ++H + S +H + L P +K A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N ICGVGVAYNSK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + T+AC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY + + KL + K+Q +
Sbjct: 14 FLFCVMVFASAERPVFTNHFLVELHKDGEEE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624
BLAST of pc2 vs. uniprot
Match: gi|417351|sp|Q03333|NEC2_PIG (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 682.174 bits (1759), Expect = 0
Identity = 368/617 (59.64%), Postives = 438/617 (70.99%), Query Frame = 2
Query:   98 LLFLIQIYTIYGK-IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPY 1945
LLF + ++ + + TN + V LH G + A +VA E GF + R + + ++H + S +H + L P VK A Q EGF RKKRG++ I + I NM DPLF+K+WY+ NTGQADG LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + T L+L + TDAC+ V YLEHVQA I+V A+RRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G EW L+LHG+Q+ PY
Sbjct: 15 LLFCVTVFASAERPVFTNHFLVELHKGGEEE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYRDINE----------------------IDINM---NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGAVKEWTLMLHGSQSAPY 599
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|17136192|ref|NP_477318.1| (amontillado [Drosophila melanogaster])

HSP 1 Score: 701.819 bits (1810), Expect = 0
Identity = 383/631 (60.70%), Postives = 452/631 (71.63%), Query Frame = 2
Query:  137 IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSP-NEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGR-GKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRF 2023
+ T+ + VR + A+ VA + GF L + + +E+ + H+ +PH S S H + L SHP V A Q GF R KRG +P +P I+ + G+ I E PTDP F +WY++NTGQ G LDLNV +AWAQGITGK VTTAIMDDG+DY+HPDL NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNGICGVGVAY+SKIAG+RMLDQPYMTDLIEA +M ++ I IYSASWGPTDDG+TVDGPRN TMRAIV+GVN+GR G G+IYVWASGDGG DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG + GV T DLYG+CT HSGTSAAAPEAAGVFALALEAN + WRD+QHLTVLTSKRN L D R +WT+NG GLEFNHLFG+GVLDAG MV ++K+W +VP R+HC AG++ + + ++L EI TDACK T VNYLEHVQA IS ASRRGD+ +FLTSPMGT SMILS R DDD GFTKWPFMTTH+WGE P+G W+L F++ G EW LVLHGT+ PY L S KL +VK+ H +
Sbjct: 39 VFTSSFLVRFRRGVDNSFAHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA-------VPAIHGMKFDLKVGEGNRIDEE---PTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKG-TDTEVNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQ-TRHGNLLEWSLVLHGTKEAPYRTLHPSSPH--SKLAIVKKAHEDKKM 653
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|281360987|ref|NP_001162774.1| (furin 2, isoform I [Drosophila melanogaster])

HSP 1 Score: 428.328 bits (1100), Expect = 7.8789e-131
Identity = 270/628 (42.99%), Postives = 380/628 (60.51%), Query Frame = 2
Query:  137 IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQS-PNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN--VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQ-GIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKL 1987
I TN++ V + P +A+ +A + GF + R I S N +++ H V S S H L S VK +Q +R+KR QD +I+ R + ++ + P DPLF ++WY+ N G DG LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAYN+ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEAN + WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + N+ + + L +D + C + T + V YLEHVQ I+++ RG++ + LTSPMGTTS +L RP+D + F WPF++ H WGE G+W L ++ + ++Q GI S+W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGP---YQDLPTYKSISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYL-NGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 843
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642484|ref|NP_727963.1| (furin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 420.624 bits (1080), Expect = 4.70187e-128
Identity = 272/651 (41.78%), Postives = 387/651 (59.45%), Query Frame = 2
Query:  137 IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQS-PNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRG--------FKP--IKKQ------DRIPLPTINKKGIP-----GRGKTENIKENMKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN--VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQ-GIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKL 1987
I TN++ V + P +A+ +A + GF + R I S N +++ H V S S H L S VK +Q +R+KR + P + +Q D P + + + I R + ++ + P DPLF ++WY+ +N G DG LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAYN+ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEAN + WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + N+ + + L +D + C + T + V YLEHVQ I+++ RG++ + LTSPMGTTS +L RP+D + F WPF++ H WGE G+W L ++ + ++Q GI S+W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642486|ref|NP_727964.1| (furin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 420.624 bits (1080), Expect = 4.70187e-128
Identity = 272/651 (41.78%), Postives = 387/651 (59.45%), Query Frame = 2
Query:  137 IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQS-PNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRG--------FKP--IKKQ------DRIPLPTINKKGIP-----GRGKTENIKENMKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN--VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQ-GIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKL 1987
I TN++ V + P +A+ +A + GF + R I S N +++ H V S S H L S VK +Q +R+KR + P + +Q D P + + + I R + ++ + P DPLF ++WY+ +N G DG LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAYN+ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEAN + WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + N+ + + L +D + C + T + V YLEHVQ I+++ RG++ + LTSPMGTTS +L RP+D + F WPF++ H WGE G+W L ++ + ++Q GI S+W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642488|ref|NP_727965.1| (furin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 420.624 bits (1080), Expect = 4.70187e-128
Identity = 272/651 (41.78%), Postives = 387/651 (59.45%), Query Frame = 2
Query:  137 IVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQS-PNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRG--------FKP--IKKQ------DRIPLPTINKKGIP-----GRGKTENIKENMKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN--VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQ-GIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKL 1987
I TN++ V + P +A+ +A + GF + R I S N +++ H V S S H L S VK +Q +R+KR + P + +Q D P + + + I R + ++ + P DPLF ++WY+ +N G DG LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAYN+ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEAN + WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + N+ + + L +D + C + T + V YLEHVQ I+++ RG++ + LTSPMGTTS +L RP+D + F WPF++ H WGE G+W L ++ + ++Q GI S+W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15019018 (SmedSxldir_c108536_g2_i2|m.79117|m.1373)

HSP 1 Score: 1197.96 bits (3098), Expect = 0
Identity = 603/645 (93.49%), Postives = 628/645 (97.36%), Query Frame = 2
Query:   98 LLFLIQIYTIYGKIVTNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ* 2032
LLFL + Y + GKIVTNQWHV LHDP T + ANKVAQETGFS+LRNH+ SPNEFV+HHK VPHVSS+PSW+ HKVLL+H LVK AKQVEGF+R+KRG+KPIKKQ R+PLPTINKKGIPG G+++NIK ++KLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAY+SKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI+KRYRFNVTKALILEIDTDACKSD GHRVNYLEHVQAF+SVK+SRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKW+LT+MFDTKDPLSQGIFSEWVLVLHGTQ+RPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
Sbjct: 7 LLFLCE-YVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ* 650
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15036165 (SmedSxlregen_c89995_g1_i1|m.42695|m.12874)

HSP 1 Score: 382.489 bits (981), Expect = 9.63966e-122
Identity = 247/620 (39.84%), Postives = 349/620 (56.29%), Query Frame = 2
Query:  143 TNQWHVRLHDPGTHDLANKVAQETGFSLLRNHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRY-----TDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDA-GVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHC--IAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIM-FDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSSSLEK 1972
T+ W V+++ GT D A +A GF L N I P+ + + H+ V S PS + L P V +Q +R KR + DP + K WY+ K+ +N++SAW +G G+ V +I+DDGI+ HPDL +NY+ +SYD SND P PRY T N HGTRCAG+++A +N ICGVGVAY + I G+RMLD ++D +E+ ++ +IDIYSASWGP DDG+TVDGP A +G+ KGR G GSI+VWAS G D+CNCDGY S++T+ +N+ + G+ Y E CSSTLA T+S+G S+D + T D+ +CT HSGTSA+AP AAG+ ALAL AN + WRDMQHL V+T++ R +W+ N AG E++H FG+G++DAG MV +A W VPE+ C +A +L I TDAC ++ RV YLEHVQA IS+++++RG++ ++L SP +TS +L+ R ++D ++ GF WPFM+ H WGE G W+LTI +D + L W L+L+GT P + +S+ K
Sbjct: 27 TDTWAVQIN--GTVDDARILAATYGFVFL-NEIM-PSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKR----------------------------------HIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGE-VSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSG----SMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITAR----KANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKR-RNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN-----WSLILYGTDTLPSHRQNSTHTK 588
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15033125 (SmedSxlregen_c82367_g1_i3|m.22377|m.8734)

HSP 1 Score: 353.984 bits (907), Expect = 7.35226e-106
Identity = 233/627 (37.16%), Postives = 345/627 (55.02%), Query Frame = 2
Query:  137 IVTNQWHVR-----------LHDPGTHDLANKVAQETGFSLLRNHIQSPNEF-VYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFS--SNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRG---FTKWPFMTTHTWGENPRGKWRLTI-MFDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSS 1960
I+ NQ+H + PG + A VA + GF +L++ ++ ++F V+ ++ + +S S H L V A+Q R KR F IK+ +K +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVG+AYNS+I +RMLD +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP A +G+ GR G G+IYVWASG+GG D AS S+ ++ Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AAG+ AL +EANSN+ WRD+Q++ VLTS N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K+ + L + TD C ++VNY+EHV ++ + +RGD+ + L SP GT S IL +RP D RG F WP M+ WGE G+W + I + TK S G++S + L ++GT+ P +S+
Sbjct: 13 ILLNQFHFTFATKEHINEYVIQCPGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYR---YDNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQ--------------------------IKF-SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15002657 (Asxlregen_comp67843_c0_seq3|m.34885|m.51170)

HSP 1 Score: 353.599 bits (906), Expect = 1.09924e-105
Identity = 233/627 (37.16%), Postives = 345/627 (55.02%), Query Frame = 2
Query:  137 IVTNQWHVR-----------LHDPGTHDLANKVAQETGFSLLRNHIQSPNEF-VYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKKRGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFS--SNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRG---FTKWPFMTTHTWGENPRGKWRLTI-MFDTKDPLSQGIFSEWVLVLHGTQNRPYDKLSS 1960
I+ NQ+H + PG + A VA + GF +L++ ++ ++F V+ ++ + +S S H L V A+Q R KR F IK+ +K +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVG+AYNS+I +RMLD +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP A +G+ GR G G+IYVWASG+GG D AS S+ ++ Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AAG+ AL +EANSN+ WRD+Q++ VLTS N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K+ + L + TD C ++VNY+EHV ++ + +RGD+ + L SP GT S IL +RP D RG F WP M+ WGE G+W + I + TK S G++S + L ++GT+ P +S+
Sbjct: 13 ILLNQFHFTFATKEHINEYVIQCPGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYR---YDNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIKQ--------------------------IKF-SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15000885 (Asxlregen_comp60502_c0_seq1|m.9253|m.45850)

HSP 1 Score: 315.849 bits (808), Expect = 1.35857e-96
Identity = 192/489 (39.26%), Postives = 280/489 (57.26%), Query Frame = 2
Query:  485 MKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFS-NGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFNVTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDPLSQ-GIFSEWVLVLHGTQNRP 1942
+++ DP + EWY+ ++ K D+ V W ITG+GV AI+DDG+++ HPDL NY+ SS D + ND P P T N HGTRCA EI+ +N ICGVG+AYN KI G+RMLD P + +IEA ++ ++ ++IDIYS+SWGP DDG+T++ P + G GR GKG+I+VWAS G D C+CDGY +S++ IS+NS T+D + + E C ST+ +T+S + ++ +SL A D+ G+CT HSGTSA+AP A+G+FAL LE N N+ WRD++HL TS+ + W N AG N FG+G+L+A MV+ A+ W NVP C + + N A I+ + CK +V ++E + +++ RG + + L SP G + +L+ R D S G WPF + H WGENP GKW + + D + G ++ L +GT+ P
Sbjct: 142 LEMFNDPKWPDEWYLFDSRFNSDQKSYDMRVTPVWYMNITGRGVKVAILDDGLEHTHPDLIDNYDPFSSTDLNDNDDDPSPDLTPGTSNEHGTRCASEIAMSANNKICGVGIAYNCKIGGIRMLDGP-VNGIIEAKSLGFNNNHIDIYSSSWGPLDDGKTMEQPSKLVQEVLRRGALSGRNGKGNIFVWASGNGGLYQDSCSCDGYVSSLYVISVNSITDDNKFPYFAEKCPSTMCATYSASSESKYSLIAA----DVKGKCTKKHSGTSASAPYASGIFALVLEMNPNLTWRDIKHLIAWTSE---YNWIKNNLGWKKNAAGFWVNEKFGFGLLNAYKMVKKAQNWKNVPPMTTCRVKVKSSKKISNKLPATIIAYG-NHCK----EKVAFIESIIILMNITYEVRGALLIKLQSPYGMNTTLLTTR-NLDKSKDGIINWPFHSVHNWGENPTGKWVVYVEDKINDDEDRSGEVTDCTLEFYGTKTTP 616
The following BLAST results are available for this feature:
BLAST of pc2 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|20336244|ref|NP_002585.2|0.000000e+059.97neuroendocrine convertase 2 isoform 1 preproprotei... [more]
gi|320118926|ref|NP_001188457.1|0.000000e+061.03neuroendocrine convertase 2 isoform 3 [Homo sapien... [more]
gi|320118928|ref|NP_001188458.1|0.000000e+059.00neuroendocrine convertase 2 isoform 2 preproprotei... [more]
gi|20336242|ref|NP_000430.3|1.795990e-13441.23neuroendocrine convertase 1 isoform 1 preproprotei... [more]
gi|4505579|ref|NP_002560.1|4.085760e-13241.83furin preproprotein [Homo sapiens][more]
back to top
BLAST of pc2 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|13124785|sp|P16519|NEC2_HUMAN0.000000e+059.97RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|75061998|sp|Q5REC2|NEC2_PONAB0.000000e+059.97RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128004|sp|P28841|NEC2_RAT0.000000e+057.36RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128003|sp|P21661|NEC2_MOUSE0.000000e+057.36RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|417351|sp|Q03333|NEC2_PIG0.000000e+059.64RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
back to top
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136192|ref|NP_477318.1|0.000000e+060.70amontillado [Drosophila melanogaster][more]
gi|281360987|ref|NP_001162774.1|7.878900e-13142.99furin 2, isoform I [Drosophila melanogaster][more]
gi|24642484|ref|NP_727963.1|4.701870e-12841.78furin 2, isoform A [Drosophila melanogaster][more]
gi|24642486|ref|NP_727964.1|4.701870e-12841.78furin 2, isoform B [Drosophila melanogaster][more]
gi|24642488|ref|NP_727965.1|4.701870e-12841.78furin 2, isoform C [Drosophila melanogaster][more]
back to top
BLAST of pc2 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150190180.000000e+093.49SmedSxldir_c108536_g2_i2|m.79117|m.1373[more]
SMU150361659.639660e-12239.84SmedSxlregen_c89995_g1_i1|m.42695|m.12874[more]
SMU150331257.352260e-10637.16SmedSxlregen_c82367_g1_i3|m.22377|m.8734[more]
SMU150026571.099240e-10537.16Asxlregen_comp67843_c0_seq3|m.34885|m.51170[more]
SMU150008851.358570e-9639.26Asxlregen_comp60502_c0_seq1|m.9253|m.45850[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_010792 ID=Gsp_010792|Name=pc2|organism=Girardia sp.|type=mRNA|length=2205bp
ACAAACAACAAAACATACAGTTTAGAAAGCTGAAAAAAATCTTTATTAAA
ATTATTTTTTTAATTAAAAATTTCATTTTTCGATGTATCGAATATCGCTT
CTTTTTTTAATACAAATTTATACAATATATGGGAAAATTGTAACAAATCA
GTGGCATGTACGTCTTCATGATCCCGGAACTCATGATCTAGCCAATAAAG
TAGCTCAAGAAACTGGTTTCTCACTATTGAGAAACCATATACAATCTCCA
AATGAATTTGTTTACCATCATAAAGCTGTGCCCCATGTGAGTTCAATTCC
AAGTTGGAATCATCATAAAGTTTTATTATCTCATCCACTTGTTAAAGAAG
CTAAACAAGTTGAAGGTTTTATTAGAAAAAAACGAGGTTTTAAACCGATC
AAAAAGCAAGATCGTATTCCACTTCCAACAATAAACAAAAAAGGTATTCC
TGGCAGAGGAAAAACAGAGAACATTAAAGAAAATATGAAATTACCAACTG
ATCCTTTGTTTTCAAAAGAATGGTACATTCGAAACACTGGACAAGCTGAT
GGAGTAAAAGATCTTGATCTAAATGTTTTATCCGCATGGGCTCAAGGCAT
TACTGGTAAAGGTGTTACAACAGCAATTATGGATGACGGTATCGATTATC
TTCATCCAGATTTATCGAAAAATTACAATGCAGAAAGTAGTTATGATTTC
AGTAGTAACGATCCATATCCATTTCCAAGGTATACTGATGATTGGTTTAA
TAGTCATGGAACAAGATGCGCCGGTGAAATTTCAGCTGAGAGAGACAATG
GAATTTGTGGTGTTGGTGTGGCCTACAATTCTAAGATCGCCGGATTGCGT
ATGTTGGATCAACCGTATATGACAGATCTTATTGAAGCAGCAGCAATGAG
TTATGATAGAGATAATATTGATATTTATTCTGCCAGTTGGGGTCCTACAG
ATGATGGTAGAACAGTCGATGGACCAAGAAATGAGACCATGCGTGCAATT
GTAGAAGGCGTTAATAAAGGTCGTAAAGGTAAAGGAAGCATTTACGTTTG
GGCATCTGGTGATGGAGGAGCAGCCGATGATTGCAATTGCGACGGATATG
CAGCAAGCATGTGGACTATTAGTATTAATTCTGCAACCAATGATGGAGAA
ACTGCAAGCTACGATGAATCTTGTTCTTCAACCCTTGCCTCAACATTTTC
AAATGGAAAAGCATGGTTTAGTCTTGACGCAGGAGTTGGTACGGTTGATT
TATATGGACAATGCACCTTACATCATTCTGGAACTTCTGCTGCGGCCCCG
GAAGCAGCTGGAGTATTTGCTTTAGCTTTAGAAGCTAATTCTAATATTGG
TTGGAGAGACATGCAACATTTAACTGTGCTCACTAGTAAACGAAACCATT
TGCACGATCGAGATCGACGTCATAATTGGACAATTAATGGGGCCGGTTTG
GAATTTAATCATCTTTTTGGTTATGGAGTTCTTGATGCTGGTGATATGGT
TCGTGTTGCTAAAAAATGGGTAAATGTTCCTGAAAGATTTCACTGTATAG
CGGGACAAATTAATAAACGTTATCGGTTTAATGTTACTAAAGCACTGATA
CTCGAGATAGATACCGATGCTTGCAAATCAGATACTGGCCATCGAGTTAA
TTATCTAGAACATGTTCAAGCTTTTATATCAGTAAAAGCTAGTAGACGAG
GAGATATAACAATGTTTCTTACCAGCCCAATGGGCACAACATCTATGATT
CTCAGTCATCGACCAAAAGACGATGATTCTACACGAGGATTTACAAAATG
GCCATTTATGACCACGCATACATGGGGTGAAAATCCTCGTGGAAAATGGC
GATTAACAATAATGTTCGACACAAAAGATCCTCTTAGTCAAGGAATATTT
TCGGAATGGGTTCTTGTTTTGCATGGAACTCAAAATCGACCATATGATAA
ACTATCTAGTTCTTTGGAAAAGATTATACCTAAGCTCGGTGTAGTAAAGA
GACAACATGCCTCCAACAGATTTTCCCAATAGTTGAACTGACATTCGTTT
AGCATTTTATGTTTACGATAGCAGTTTTACTGCAGATTTTTGTGATTGTA
TTTTTGTAAACTTTTGTCCAGTGAGATTGTGATATCTTATTATTACTATT
ATTATTAATTTTACTATCATCTCATCGACATGATTATTAAATATATTTGT
CTTGT

Design Primers for pc2

back to top

protein sequence

>Gsp_010792-protein ID=Gsp_010792-protein|Name=pc2|organism=Girardia sp.|type=polypeptide|length=650bp
MYRISLLFLIQIYTIYGKIVTNQWHVRLHDPGTHDLANKVAQETGFSLLR
NHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKK
RGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN
VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDP
LSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
back to top

coding sequence

>Gsp_010792.83.2032 ID=Gsp_010792.83.2032|Name=Gsp_010792.83.2032|organism=Girardia sp.|type=CDS|length=1950bp
ATGTATCGAATATCGCTTCTTTTTTTAATACAAATTTATACAATATATGG
GAAAATTGTAACAAATCAGTGGCATGTACGTCTTCATGATCCCGGAACTC
ATGATCTAGCCAATAAAGTAGCTCAAGAAACTGGTTTCTCACTATTGAGA
AACCATATACAATCTCCAAATGAATTTGTTTACCATCATAAAGCTGTGCC
CCATGTGAGTTCAATTCCAAGTTGGAATCATCATAAAGTTTTATTATCTC
ATCCACTTGTTAAAGAAGCTAAACAAGTTGAAGGTTTTATTAGAAAAAAA
CGAGGTTTTAAACCGATCAAAAAGCAAGATCGTATTCCACTTCCAACAAT
AAACAAAAAAGGTATTCCTGGCAGAGGAAAAACAGAGAACATTAAAGAAA
ATATGAAATTACCAACTGATCCTTTGTTTTCAAAAGAATGGTACATTCGA
AACACTGGACAAGCTGATGGAGTAAAAGATCTTGATCTAAATGTTTTATC
CGCATGGGCTCAAGGCATTACTGGTAAAGGTGTTACAACAGCAATTATGG
ATGACGGTATCGATTATCTTCATCCAGATTTATCGAAAAATTACAATGCA
GAAAGTAGTTATGATTTCAGTAGTAACGATCCATATCCATTTCCAAGGTA
TACTGATGATTGGTTTAATAGTCATGGAACAAGATGCGCCGGTGAAATTT
CAGCTGAGAGAGACAATGGAATTTGTGGTGTTGGTGTGGCCTACAATTCT
AAGATCGCCGGATTGCGTATGTTGGATCAACCGTATATGACAGATCTTAT
TGAAGCAGCAGCAATGAGTTATGATAGAGATAATATTGATATTTATTCTG
CCAGTTGGGGTCCTACAGATGATGGTAGAACAGTCGATGGACCAAGAAAT
GAGACCATGCGTGCAATTGTAGAAGGCGTTAATAAAGGTCGTAAAGGTAA
AGGAAGCATTTACGTTTGGGCATCTGGTGATGGAGGAGCAGCCGATGATT
GCAATTGCGACGGATATGCAGCAAGCATGTGGACTATTAGTATTAATTCT
GCAACCAATGATGGAGAAACTGCAAGCTACGATGAATCTTGTTCTTCAAC
CCTTGCCTCAACATTTTCAAATGGAAAAGCATGGTTTAGTCTTGACGCAG
GAGTTGGTACGGTTGATTTATATGGACAATGCACCTTACATCATTCTGGA
ACTTCTGCTGCGGCCCCGGAAGCAGCTGGAGTATTTGCTTTAGCTTTAGA
AGCTAATTCTAATATTGGTTGGAGAGACATGCAACATTTAACTGTGCTCA
CTAGTAAACGAAACCATTTGCACGATCGAGATCGACGTCATAATTGGACA
ATTAATGGGGCCGGTTTGGAATTTAATCATCTTTTTGGTTATGGAGTTCT
TGATGCTGGTGATATGGTTCGTGTTGCTAAAAAATGGGTAAATGTTCCTG
AAAGATTTCACTGTATAGCGGGACAAATTAATAAACGTTATCGGTTTAAT
GTTACTAAAGCACTGATACTCGAGATAGATACCGATGCTTGCAAATCAGA
TACTGGCCATCGAGTTAATTATCTAGAACATGTTCAAGCTTTTATATCAG
TAAAAGCTAGTAGACGAGGAGATATAACAATGTTTCTTACCAGCCCAATG
GGCACAACATCTATGATTCTCAGTCATCGACCAAAAGACGATGATTCTAC
ACGAGGATTTACAAAATGGCCATTTATGACCACGCATACATGGGGTGAAA
ATCCTCGTGGAAAATGGCGATTAACAATAATGTTCGACACAAAAGATCCT
CTTAGTCAAGGAATATTTTCGGAATGGGTTCTTGTTTTGCATGGAACTCA
AAATCGACCATATGATAAACTATCTAGTTCTTTGGAAAAGATTATACCTA
AGCTCGGTGTAGTAAAGAGACAACATGCCTCCAACAGATTTTCCCAATAG
back to top
Gene Groups
pc2 is similar in sequence to the genes of this group: GG3186
Gene NameGene ID
SMU15019018SMU15019018
pc2Ddo_018155
pc2Gsp_010792
pc2Pgr_003685
Pgr_007588Pgr_007588
pc2Pmo_008419
Pmo_028616Pmo_028616

Gene Group Protein Sequences

>SMU15019018

MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLR
NHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRK
RGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFN
VTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP
LSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Ddo_018155 pc2
MMFLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVLR
GHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKK
RGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRN
TGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSK
IAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNE
TMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKRNHLHDRDRRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNV
SRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMG
TTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPL
SQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRFMQ*
>Gsp_010792 pc2
MYRISLLFLIQIYTIYGKIVTNQWHVRLHDPGTHDLANKVAQETGFSLLR
NHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKK
RGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN
VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDP
LSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Pgr_003685 pc2
MKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSL
LRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLR
KKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRN
TGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSK
VVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNE
TMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAAVFALALEANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNV
SKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMG
TTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDAL
SQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ*
>Pgr_007588 Pgr_007588
MHFYLIFWLFVLSGVRESLAKIHSNQWYVRLHESGDDAAKRVASETGFVY
LRNHLQSPHEFIFTHRGIADASAAPSVSHQMNLLAHPMVKQASQMEGFLR
RKRGYKPVKKLPLQLTNINKKGIPDREKNSTDAHSQRRLPRDPLFSKEWY
ILNTGQAEGVKDLDLNVLSAWDQGVTGKGITTAIMDDGIDYLHPDLSKNY
NAENSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNDICGVGIAY
NSKVAGLRMLDQPYMTDLIEASAMSHDRDMIDIYSASWGPTDDGRTVDGP
RNETMRAIVDGVNKGRNGRGSIYVWASGDGGMSDDCNCDGYAASMWTISI
NSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLLH
SGTSAAAPEAAAVFALALEANREIGWRDMQHLSVLTSKRNHLHDRDGRHN
WTINGAGLEFNHLFGYGVLDAGDMVRVAKKWINVPERFHCIAGEISERSR
FNISKALILEINTDACKSSDGHRVNYLEHVQAFVTVRASRRGDVTLFLTS
PMGTTSMILSRRVKDGDSMQGFTKWPFMTTHTWGENPRGKWRLMAMFDTD
DALSQGVLSEWILVLHGTQERPYDKLSSSLEKILPKLAVIKRQHASKNFL
Q*
>Pmo_008419 pc2
MRVAILVSVIVVLLSHRLTATIHSNQWHVHLQQPGEHVAEQVASETGFSL
LRNHLRSPNEFIFTHRALPPASAVASLSHHMNLVAHPLVKQATQMEGFLR
KKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI
RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYN
AESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYN
SQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPR
NETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISIN
SATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHS
GTSAAAPEAAAVFALALEANGEMGWRDMQHLSVLTSKRNHLHDRDGRHNW
TINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRF
NISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSP
MGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTED
ALIQGLLSEWV
>Pmo_028616 Pmo_028616
MDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGE
ISAERDNGVCGVGIAYNSQVVGLRMLDQPYMTDLIESAAMSHERDSIDIY
SASWGPTDDGRTVDGPRNETMKAIVDGVNKGRRGKGNIYVWASGDGGVAD
DCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLD
AGVGTVDLYGQCTLHHSGTSAAAPEAAAVFALALEANTNIGWRDMQHLSV
LTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNV
PERFHCIAGQIDHKARFNVTKALILEIDTDACKSDDGHRVNYLEHVQAFV
TVKASRRGDTTMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWG
ENPRGKWRLTVMFDTEDALSQGMFSEWILLLHGTQIPPYDKLSTSLEKII
PKLAAVKRQHASKKFLE*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.