innexin, Gsp_009731 (mRNA) Girardia sp.

Overview
Nameinnexin
Unique NameGsp_009731
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1746
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of innexin vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 237.654 bits (605), Expect = 2.6072e-70
Identity = 138/393 (35.11%), Postives = 227/393 (57.76%), Query Frame = 2
Query:  311 YATKFKWVDFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGT--IPIQGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFD 1483
+A+ K + F +D DKL++ +T+I+ + ++++ K Y+ I C++P + + + Y ++YCWV T +P+ +P + + EN +I YYQWVPFVLA++ +LFY+P I+W+++++ SG ++ L++MA +++ + +A N+E L V H V +L L C+ + SG +T Y+ +K+LY +N GQIFL+ FL G++ +G VLN+++NG+EW E+ FPRVT C + ++ +G + + QC L INM NEKI++FLWFW ++ T S WIYI PS Q+NF+ K+L E Y D ++ F FLR+DGVF+LRM + +AG+L ++ LWN Y + + D
Sbjct: 8 FASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN----RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVK-----HQVMSGNRLKLLNLIICT-RSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHD 385
BLAST of innexin vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 223.787 bits (569), Expect = 1.21931e-63
Identity = 131/374 (35.03%), Postives = 220/374 (58.82%), Query Frame = 2
Query:  350 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGT--IPIQGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLEN---LLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDE---DDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWN 1447
+DF DKL++ +T+IL L+++ K Y+ I C++P + + Y ++YCWV T +P+Q +P++I N +I YYQWVPF+LAI+ +LFY+P I+W+ + Y SG +L+GL++MA + K TV +A ++++ L + R+ + S S L+ G+ G +T Y+ IKVLY N Q FL+ + L G ++G+ +L ++++ EW +T +FPRVT C + ++ +G + + QC L INM NEKI++FLWFW + T + + WI I+ PS ++F++K+L++ + + DDV ++ F FLRKDGVF+LRM S +AG+L++++++ LW
Sbjct: 139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYSRRN----RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSC-----FSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499
BLAST of innexin vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 189.889 bits (481), Expect = 4.08663e-52
Identity = 133/411 (32.36%), Postives = 217/411 (52.80%), Query Frame = 2
Query:  344 GMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGT--IPIQGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRE-TVNQVALN-LENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIRE-------QYSDEDDVV-------------IKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQMEPLND 1504
G +D D+L++ + IL + LVI+ K Y I C++ H S + ++Y++SYCW+ T IP+ +P D T E +I YYQWVPF+L + ++F LP I W++ ++ SG +++ LI A + R+ V + N ++NL + + IA++ R SG+ ++ Y F K+LY +N Q F++ L + FG+ VL++I G+ W ET FPRVT C + ++++ N Y QCAL IN++NEK++ FLW W +I+ T SFI WI S +V+++ KF++I E Q ++D V + SF FL+ DG+ +LRM S +AGD+I +V LW Y+E++ ++ F++ E + D
Sbjct: 19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRF------LSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWRE-FEEHEEMKD 414
BLAST of innexin vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 186.422 bits (472), Expect = 1.1748e-50
Identity = 133/414 (32.13%), Postives = 219/414 (52.90%), Query Frame = 2
Query:  344 GMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGT--IPIQGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMA-NSVSNKTGDAKRETVNQVALN-LENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSF---GYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIRE-------QYSDEDDVV-------------IKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQMEPLND 1504
G +D D+L++ + IL + LVI+ K Y I C++ H S + ++Y++SYCW+ T IP+ +P D T E +I YYQWVPF+L + ++F LP I W++ ++ SG +++ LI A + + +++ V + N ++NL + + IA++ R SG+ L+ + F K+LY +N Q ++ L K S F G+ VLN+I G+ W ET FPRVT C + ++++ N Y QCAL IN++NEK++ FLW W +I+ T SFI WI S +V+++ KF++I E Q ++D V + +F FL+ DGV +LRM S +AGD+I +V LW ++E++ ++ F++ E + D
Sbjct: 35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRF------LSGQCLSILHSFTKLLYSMNVVAQFLILNACL----KSSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWRE-FEEHEEMKD 430
BLAST of innexin vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 184.882 bits (468), Expect = 1.86468e-50
Identity = 121/406 (29.80%), Postives = 217/406 (53.45%), Query Frame = 2
Query:  350 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGT--IPIQGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCS--GKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQMEPLNDGQYSDASTLPVKNENMY 1555
+D D+LS+ + ++L +++++ K Y+ ++I C++P+ G ++ Y + YC++ T IP + +P D+ D + + I YYQWVP VLAIQ +FYLP IW + Y G D +I A ++ ++ + + + VN++ + ++L K ++ ++C GK G + Y+ IK++Y+ N F Q ++ FL G++ +G+ ++ G+EW ++ +FPRVT C +++ + + Y QC L INM NEKIY+F+WFW + V+ T I+ + IY L+ SS+ N+++ L ++ +I SF L++DGV ++R +AG ++T +I EL+ + E + Q N D + G +S ST P E +
Sbjct: 21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSK------------NEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDF-SVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGE-NLQHNRD----FHHG-HSTKSTSPGLEEGHH 399
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 100.523 bits (249), Expect = 1.38124e-22
Identity = 98/357 (27.45%), Postives = 157/357 (43.98%), Query Frame = 2
Query:  425 KSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRL----------PQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANS--VSNKT-GDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETL-----IFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTEL 1441
+ Y+ + I C + P G + +YCW++ T + RL P + E D+ YYQWV FVL Q ILFY+PR +W+ + G L+ L+ NS V+++ D K+ V+ NL N H+ R + C + L +N GQI+ + +FLD + S++G VL E +E + +FP+VT C G ++ C LP+N++NEKIY+FLWFW II+ + IS I I ++ P + L+ ++ E S+E ++V G F+L N LI +++++L
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNL----------NRHN------FYAFRFFVC----------------EALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE--SEEVELVANKCNIG-----DWFLLYQLGKNIDPLIYKEVISDL 349
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 100.523 bits (249), Expect = 1.38124e-22
Identity = 98/357 (27.45%), Postives = 157/357 (43.98%), Query Frame = 2
Query:  425 KSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRL----------PQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANS--VSNKT-GDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETL-----IFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTEL 1441
+ Y+ + I C + P G + +YCW++ T + RL P + E D+ YYQWV FVL Q ILFY+PR +W+ + G L+ L+ NS V+++ D K+ V+ NL N H+ R + C + L +N GQI+ + +FLD + S++G VL E +E + +FP+VT C G ++ C LP+N++NEKIY+FLWFW II+ + IS I I ++ P + L+ ++ E S+E ++V G F+L N LI +++++L
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNL----------NRHN------FYAFRFFVC----------------EALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE--SEEVELVANKCNIG-----DWFLLYQLGKNIDPLIYKEVISDL 349
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 100.523 bits (249), Expect = 1.38124e-22
Identity = 98/357 (27.45%), Postives = 157/357 (43.98%), Query Frame = 2
Query:  425 KSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRL----------PQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANS--VSNKT-GDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETL-----IFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTEL 1441
+ Y+ + I C + P G + +YCW++ T + RL P + E D+ YYQWV FVL Q ILFY+PR +W+ + G L+ L+ NS V+++ D K+ V+ NL N H+ R + C + L +N GQI+ + +FLD + S++G VL E +E + +FP+VT C G ++ C LP+N++NEKIY+FLWFW II+ + IS I I ++ P + L+ ++ E S+E ++V G F+L N LI +++++L
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNL----------NRHN------FYAFRFFVC----------------EALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE--SEEVELVANKCNIG-----DWFLLYQLGKNIDPLIYKEVISDL 349
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 100.523 bits (249), Expect = 1.38124e-22
Identity = 98/357 (27.45%), Postives = 157/357 (43.98%), Query Frame = 2
Query:  425 KSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRL----------PQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANS--VSNKT-GDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETL-----IFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTEL 1441
+ Y+ + I C + P G + +YCW++ T + RL P + E D+ YYQWV FVL Q ILFY+PR +W+ + G L+ L+ NS V+++ D K+ V+ NL N H+ R + C + L +N GQI+ + +FLD + S++G VL E +E + +FP+VT C G ++ C LP+N++NEKIY+FLWFW II+ + IS I I ++ P + L+ ++ E S+E ++V G F+L N LI +++++L
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNL----------NRHN------FYAFRFFVC----------------EALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE--SEEVELVANKCNIG-----DWFLLYQLGKNIDPLIYKEVISDL 349
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|17864322|ref|NP_524730.1| (innexin 3, isoform A [Drosophila melanogaster])

HSP 1 Score: 90.1225 bits (222), Expect = 4.60506e-19
Identity = 88/358 (24.58%), Postives = 149/358 (41.62%), Query Frame = 2
Query:  458 IPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDI----------TDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVL--NNIINGKEWNETL-IFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQME 1492
IP+H + ++CW+ T I G+ + I ++ +Y+ +YYQWVPFVL QG++FY+P +W+ NM +G I M + L ++ V I K +F + + + Y F ++L IN IF++ FL G S+G VL +N+ K ++ + IFPR+T C G + C L +N+LNEKIYIFLWFW II+ + ++ + + ++ P+++ +K+ R E +++ L IL S N +D++ +L + T +E
Sbjct: 66 IPMH--------VINTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQEKRYH--SYYQWVPFVLFFQGLMFYVPHWVWK----NME----DGKIRM------------------ITDGLRGMVSVPDDYRRDRQDRILK------YFVNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFL--GGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTRETIIKR--SYRSAQRKEIAGLVRR-----LEIGDFLILHFLSQNLSTRSYSDMLQQLCGLLGASRTPSAPSTLE 372
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 687.567 bits (1773), Expect = 0
Identity = 341/421 (81.00%), Postives = 382/421 (90.74%), Query Frame = 2
Query:  287 MVLSEFIDYATKFKWVDFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQME-PLNDGQYSDASTLPVKNE 1546
MVLSEFIDYATK+KW DFVGMEDFADKLSFSISTSILLLLTLVITVKSYLL SIACYIPIHPSGKDFDD+LKSYCWVHGTIPI+G LP DI WE MD++NRINYYQWVPFVLA+QGILFYLPRIIWQMITYN+SGTDLEGL+EMANS SN+TG AK ETV+Q+A+NLENLLF HRKINLHS +++KLS +SW CS KRSGRQL AQYMFIKVLYVINAFGQ+FLMQYFLDFGHKG+SFGYVVL NI+ G+EWN+T+IFPRVTYCY+KNIQH+ +KN+YLAQC LPINMLNEKIYIFLWFWT+IVVFFT IS QWIY LT+ SSQV+FLKKFL+IREQY+DED V+KSFF+GFLRKDGVFILRMFSINAGDLIT DIVT LWNIYKEKH ++NF + P ++ YSDASTLP+K++
Sbjct: 1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDD 421
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 383.645 bits (984), Expect = 9.4721e-127
Identity = 196/425 (46.12%), Postives = 277/425 (65.18%), Query Frame = 2
Query:  287 MVLSEFIDYATKFKWVDFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIP-IQGR-LPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCS-GKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQMEPLNDGQYSDASTLPVKNENM 1552
MV EF++ +FK +VG+EDFADKLSF S ++L+L +V+T+KSYL +ACY P G +F++YL++YCWVHGTI + G +PQ+ DW D RINYYQWVPF+L +Q I+FY+P+IIWQ+I YN SGT+LE ++ AN+ +N +++ + ++A +E++LF HR + + + FC K G L Y+ IK LY +N GQ+F+M+ FL F + SSFGY VL+N+I+GKEW++T IFPRVTYCYV+NI+H+G+ N Y+AQCALP+NMLNEKIY+FLWFW ++V T IS W Y + S + F+K+FL + + Y D +I +F + FLR DGVF++RM INAGD+IT DIV L IYKE + +F D S ++N+N+
Sbjct: 1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKAL--DKSGDLIRNKNL 423
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 377.096 bits (967), Expect = 1.41795e-124
Identity = 192/405 (47.41%), Postives = 274/405 (67.65%), Query Frame = 2
Query:  293 LSEFIDYATKFKWVDFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGR--LPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLR---SWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHK--GSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ 1486
+ F+ T F+ +VG+ED ADK SF S IL++ +++++ K Y+ I+CYIP+ SG D D Y+K+YCWVHGTIP LPQ +W D +INYYQWVPFVL +QG+LFYLPR+IW+ I YN+SG DLEGL+ A SN+ G+ ++ET+ QVA LE+L F+ R++ H+ K LR S C G+R+G + Y+ IK+LY+ NA QI LMQ FL +G ++FG+ +L +I++GK+WN+ L+FPRV++C++ +I + KN ++AQCALPINMLNEKIYIFLWFWT+ V+F T IS W+Y +T + +F+K+FLKI+ Y+ + +I F + FLR DG+FIL + S+NAGDLI TDIV+ELW IY + + + +F +
Sbjct: 1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDL-FLQRRVLGHT-----KFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 374.785 bits (961), Expect = 1.21956e-123
Identity = 191/405 (47.16%), Postives = 274/405 (67.65%), Query Frame = 2
Query:  293 LSEFIDYATKFKWVDFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGR--LPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLR---SWFCSGKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFG--HKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ 1486
+ I + F +VG+ED ADK SF S IL++ T++++ K Y+ IACYIPI +G+ +DY+++YCW HGTIP + LPQ+ DW D R+NYYQWVPFVL +QG+LFYLPR+IW+ I YN+SG DLEGL+ A SN+ G+ ++ET+ QVA LE+L F+ R++ H+ K LR S C G+R+G + Y+ IK+LY+ NA QI LMQ FL +G ++FG+ +L +I++GK+WN+ L+FPRV++C++ +I + KN ++AQCALPINMLNEKIYIFLWFWT+ V+F T IS W+Y +T + +F+K+FLKI+ Y+ + +I F + FLR DG+FIL + S+NAGDLI TDIV+ELW IY + + + +F +
Sbjct: 1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDL-FLQRRVLGHT-----KFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 356.295 bits (913), Expect = 3.09572e-116
Identity = 181/422 (42.89%), Postives = 260/422 (61.61%), Query Frame = 2
Query:  287 MVLSEFIDYATKFKWVDFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPI--QGRLPQDITDWENMDKYNRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVSNKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCS----GKRSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNIINGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFLWFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVIKSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEK---HTQQNFDQMEPLNDGQYSDAS 1525
MV EF+ +FK + G+EDFAD+L+F S IL L +++T K+Y ++CY+ PSG +FD Y+++YCWVHGTIP R+P DW D RI YYQWVPF+L +Q ILFY+P+++W++I YN GT+LE LI A S ++ +N + +E+LL+ HR + +AK + +C+ K G L + Y FIK LY IN GQ++LM+ FL F SSFGY +LN+II+GK W+ET FPRV+YCY +I+H+G N+Y+AQC LP+NMLNEKIYIFLWFW ++V T +S +QW+ + S + F KK LK+ + Y +++ + F K +LR DG+F++RM IN+GD++ +I+ LW YK K H N++ E L G+ D S
Sbjct: 1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRD---YRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKS 419
The following BLAST results are available for this feature:
BLAST of innexin vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL2.607200e-7035.11RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.219310e-6335.03RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR4.086630e-5232.36RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL1.174800e-5032.13RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|12643734|sp|Q19746|INX3_CAEEL1.864680e-5029.80RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of innexin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|1.381240e-2227.45innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|1.381240e-2227.45innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|1.381240e-2227.45innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|1.381240e-2227.45innexin 2, isoform D [Drosophila melanogaster][more]
gi|17864322|ref|NP_524730.1|4.605060e-1924.58innexin 3, isoform A [Drosophila melanogaster][more]
back to top
BLAST of innexin vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150009180.000000e+081.00Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150008379.472100e-12746.12Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150036481.417950e-12447.41SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150036491.219560e-12347.16SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150006573.095720e-11642.89Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_009731 ID=Gsp_009731|Name=innexin|organism=Girardia sp.|type=mRNA|length=1746bp
GCCAAATACACAAATTTTTGTTTTAGAAAATACATGAAATAGAACAGAGA
CTGTATTATTTAAATAATAAAATAGCTTTAAATGTATTTCATTTCGATTC
CTTGTTTCGTATAATCTACAATTTCATCAATAAAATCTTATTTAACTTGA
AATTATCGTACTTATTGATATTTGAATGTGAATGTCTAATGAAAACTTGT
GAAATATATAGAAACCAATTGCTAATTAGCTCATAAATAATTCAGTAACG
ATTTAAACAAAAGAACTGTGAAAACAATATTCAAAAATGGTGCTTTCTGA
GTTCATTGATTATGCTACAAAATTCAAATGGGTCGACTTTGTTGGAATGG
AAGACTTTGCAGACAAATTGAGTTTTAGTATTTCTACATCAATTCTATTG
TTGTTAACATTAGTAATAACTGTAAAAAGTTATTTATTAAATTCTATTGC
TTGTTATATTCCAATTCATCCCAGTGGAAAAGATTTTGATGATTATCTAA
AAAGTTATTGTTGGGTTCATGGAACAATTCCAATTCAAGGTCGTTTACCA
CAAGATATTACAGATTGGGAAAATATGGATAAGTACAATAGAATAAATTA
TTATCAATGGGTTCCATTCGTATTGGCAATACAGGGTATCCTATTCTATT
TACCGAGAATTATTTGGCAAATGATTACGTATAATATGTCAGGAACTGAT
CTTGAAGGTCTTATTGAAATGGCGAATTCTGTCAGCAATAAAACAGGAGA
TGCAAAAAGAGAAACTGTTAATCAAGTTGCTTTGAACTTAGAAAATCTAT
TGTTTGTTCATCGTAAAATTAATCTGCATAGTGTACAAGTTATTGCTAAA
TTATCCAAATTGCGGTCATGGTTCTGTTCTGGTAAAAGAAGTGGTAGACA
GTTAACTGCTCAATATATGTTTATAAAGGTTCTTTATGTCATTAACGCGT
TCGGTCAGATTTTTCTTATGCAATACTTCTTAGATTTTGGACATAAGGGT
TCTAGTTTTGGTTATGTTGTTTTAAATAATATAATAAATGGTAAAGAATG
GAATGAAACATTGATATTTCCAAGAGTAACCTACTGCTATGTAAAGAATA
TTCAGCATATTGGTATGAAAAACAGTTATTTGGCACAATGTGCTTTACCA
ATTAATATGTTAAATGAGAAAATCTATATTTTCCTTTGGTTCTGGACAAT
TATAGTTGTGTTTTTTACTTGTATTAGTTTTATCCAATGGATCTATATAT
TAACAAGGCCCAGTTCACAAGTTAATTTTTTGAAGAAATTTCTGAAAATT
CGTGAACAATATTCAGATGAAGATGATGTAGTTATAAAGTCGTTCTTTAA
AGGATTTCTAAGAAAAGATGGTGTTTTTATTTTACGAATGTTTTCAATAA
ATGCGGGTGATTTGATTACAACTGATATTGTAACAGAATTATGGAATATC
TATAAAGAGAAACATACACAACAGAATTTCGATCAAATGGAACCATTAAA
TGATGGTCAATATAGCGATGCTTCGACTTTACCAGTGAAAAATGAAAATA
TGTATTATGAAGCATAAAAATAATAATTAAAAATTTTAATCATGTAAATT
TATACATCGACTCCTATTTTGTTAAACCTGATTTTTAAGCAGCGTATTAT
GCGGTCGAAGATATTTATTGTTGAACTATTTCCATCAAACTGATTCAAAA
TTGTTTAACTGATTCATTGAAAATTATTTGCTAAAATGTATATTTC

Design Primers for innexin

back to top

protein sequence

>Gsp_009731-protein ID=Gsp_009731-protein|Name=innexin|organism=Girardia sp.|type=polypeptide|length=427bp
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
back to top

coding sequence

>Gsp_009731.287.1567 ID=Gsp_009731.287.1567|Name=Gsp_009731.287.1567|organism=Girardia sp.|type=CDS|length=1281bp
ATGGTGCTTTCTGAGTTCATTGATTATGCTACAAAATTCAAATGGGTCGA
CTTTGTTGGAATGGAAGACTTTGCAGACAAATTGAGTTTTAGTATTTCTA
CATCAATTCTATTGTTGTTAACATTAGTAATAACTGTAAAAAGTTATTTA
TTAAATTCTATTGCTTGTTATATTCCAATTCATCCCAGTGGAAAAGATTT
TGATGATTATCTAAAAAGTTATTGTTGGGTTCATGGAACAATTCCAATTC
AAGGTCGTTTACCACAAGATATTACAGATTGGGAAAATATGGATAAGTAC
AATAGAATAAATTATTATCAATGGGTTCCATTCGTATTGGCAATACAGGG
TATCCTATTCTATTTACCGAGAATTATTTGGCAAATGATTACGTATAATA
TGTCAGGAACTGATCTTGAAGGTCTTATTGAAATGGCGAATTCTGTCAGC
AATAAAACAGGAGATGCAAAAAGAGAAACTGTTAATCAAGTTGCTTTGAA
CTTAGAAAATCTATTGTTTGTTCATCGTAAAATTAATCTGCATAGTGTAC
AAGTTATTGCTAAATTATCCAAATTGCGGTCATGGTTCTGTTCTGGTAAA
AGAAGTGGTAGACAGTTAACTGCTCAATATATGTTTATAAAGGTTCTTTA
TGTCATTAACGCGTTCGGTCAGATTTTTCTTATGCAATACTTCTTAGATT
TTGGACATAAGGGTTCTAGTTTTGGTTATGTTGTTTTAAATAATATAATA
AATGGTAAAGAATGGAATGAAACATTGATATTTCCAAGAGTAACCTACTG
CTATGTAAAGAATATTCAGCATATTGGTATGAAAAACAGTTATTTGGCAC
AATGTGCTTTACCAATTAATATGTTAAATGAGAAAATCTATATTTTCCTT
TGGTTCTGGACAATTATAGTTGTGTTTTTTACTTGTATTAGTTTTATCCA
ATGGATCTATATATTAACAAGGCCCAGTTCACAAGTTAATTTTTTGAAGA
AATTTCTGAAAATTCGTGAACAATATTCAGATGAAGATGATGTAGTTATA
AAGTCGTTCTTTAAAGGATTTCTAAGAAAAGATGGTGTTTTTATTTTACG
AATGTTTTCAATAAATGCGGGTGATTTGATTACAACTGATATTGTAACAG
AATTATGGAATATCTATAAAGAGAAACATACACAACAGAATTTCGATCAA
ATGGAACCATTAAATGATGGTCAATATAGCGATGCTTCGACTTTACCAGT
GAAAAATGAAAATATGTATTATGAAGCATAA
back to top
Gene Groups
innexin is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.