slit, Gsp_007744 (mRNA) Girardia sp.

Overview
Nameslit
Unique NameGsp_007744
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length4900
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of slit vs. RefSeq Human
Match: gi|11321571|ref|NP_003053.1| (slit homolog 3 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 716.842 bits (1849), Expect = 0
Identity = 490/1583 (30.95%), Postives = 755/1583 (47.69%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-------------------------SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGN-YECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEG--YSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGD--ILSTVITSDMEIPSIN-QYSTKFQIPVTRKKLNNACR----RPGICKNQG---ICEPIRG--------------SKKKFRC---------------ICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCIS 4629
CP C C SV+C VP + RL+L N I I K DF L L+VL L +N+++ IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL +NQ+Q I F +T +K L L+ N I I + S + + ++ LR+ N L C+CHLAWL+ +++ R + + +C AP L V + E+ C + C N C C CSN+ IV C GK L IP +LP +VE+ L N+I + G ++YK LK+I+++ N + DI P AF GL+ LTSL L NK+ I K F GL SL L L+ N+I CL + F+ ++ L++L L +NKL T+ + F PL ++ L++ NP CDC L W+ DY++ A C PR + + +++ F+C+ D + + EC + CP KC C IV+CSN L +PS + L ++ N ++ L + PNL K+++S N+I+++ F + + E+ L N+L+ C++N+TF L+ +R L L DN I I +F ++L + L NPF+CNC++ W+ +W R GN P CQ P LK PI + + F CDGN C+ +CP +C C T V CS+ L+ +P +P D TELYL+ N L + L L + LS N I+ L + + +L TL+LS+N+L+CI AF L++L+VL L ND+S++P +FNDL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+ C+ PCK+NG C+ Y+C C Y + GK+C IN C PC++GG C D+ + + C CPLGF G +C +N DDC + C N CVD N+Y C C + G+ CD +C ++N C+++ C L + + C C G+ GK C + DDC + C+H A+CVD N Y C C G+ G +CE P M+ ++ S C +EC N C+ Q+ CRC PGF+G C+ L ++ F K+S++E+ + + P+ NISL T+ +G+LLY+G D L + LYQGHVR+ Y D + P YS+ VND + + + + + L + ++ +L + + +++ +++GG P SA+ + F GCI + IN + DF +S+ V PGC + + +E S+ + + P+ ++ + C G C G +C+ G + F+C +C+ GF G+ C++ C G I SC + K C G C +CCQPT+ K F+C G + +V C C++
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ----FTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPS--CNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSR-FSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGNE----------------------ESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPR-ELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHP-----------------PPMV-------LLQTSPCDQYECQNGAQCI----VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENP-CLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLA 1521

HSP 2 Score: 209.92 bits (533), Expect = 1.26366e-53
Identity = 144/470 (30.64%), Postives = 229/470 (48.72%), Query Frame = 1
Query:  160 ICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFF-KLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-SISKLKNLKELRIKKNKLTCNCHLAWLN-WFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIV 1560
+CP C+CE V+C ++ +P L E T L L N ++V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ +TF L+ ++ L L N+I I+ + + L +L + + N CNCHLAWL W K R P C PF L +IP+ ++ +F C N E+ CQ + + C +QC C + +V+C K L +P+ +P +V EL L N++T + + LS + L I+L+ N + + F + L++L L+ N+L+ C+P AF G++ L +L L N ++++ +FN L L L + NPL+CDC L W+ +++K IA C P M L + T+ FQC D C+ C TCT D V
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR-----CQKPFFLKEIPIQDVAIQDFTCDG----NEESSCQLSPR-CPEQCTCM-ETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPR-ELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLR------------------------CIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACL-SSPCKNNGTCTQDPV 936

HSP 3 Score: 184.882 bits (468), Expect = 5.4272e-46
Identity = 131/479 (27.35%), Postives = 211/479 (44.05%), Query Frame = 1
Query: 1513 PKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLT-----------------------------------------------PIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICS 2736
P V+CP KCTC++ V+C GL A+P I + + L + NN+ ++T P P L +LD+S NQI+ + F T + + L++N + CI + F+ L DL L L++N I+ I+V SF + ++ L L+ N +C+C++ W+S+W R T+G L C +P L+G + + +K ++C S S + S CP C C VDC L EIP +P E+ L++N +K + +F LK + +S N I+++ + LK+L +LVL + NK+ C+ + F+DL+NL +L L N + TI F L ++ + L QNPF CDC++KWL + D ++ + C+SP ++ K I K F CS
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFTL--CMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSI-------------------SCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS 486
BLAST of slit vs. RefSeq Human
Match: gi|429836873|ref|NP_001258875.1| (slit homolog 3 protein isoform 1 precursor [Homo sapiens])

HSP 1 Score: 714.531 bits (1843), Expect = 0
Identity = 490/1589 (30.84%), Postives = 755/1589 (47.51%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-------------------------SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDF------ICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGN-YECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEG--YSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGD--ILSTVITSDMEIPSIN-QYSTKFQIPVTRKKLNNACR----RPGICKNQG---ICEPIRG--------------SKKKFRC---------------ICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCIS 4629
CP C C SV+C VP + RL+L N I I K DF L L+VL L +N+++ IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL +NQ+Q I F +T +K L L+ N I I + S + + ++ LR+ N L C+CHLAWL+ +++ R + + +C AP L V + E+ C + C N C C CSN+ IV C GK L IP +LP +VE+ L N+I + G ++YK LK+I+++ N + DI P AF GL+ LTSL L NK+ I K F GL SL L L+ N+I CL + F+ ++ L++L L +NKL T+ + F PL ++ L++ NP CDC L W+ DY++ A C PR + + +++ F+C+ D + + EC + CP KC C IV+CSN L +PS + L ++ N ++ L + PNL K+++S N+I+++ F + + E+ L N+L+ C++N+TF L+ +R L L DN I I +F ++L + L NPF+CNC++ W+ +W R GN P CQ P LK PI + + F CDGN C+ +CP +C C T V CS+ L+ +P +P D TELYL+ N L + L L + LS N I+ L + + +L TL+LS+N+L+CI AF L++L+VL L ND+S++P +FNDL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+ C+ PCK+NG C+ Y+C C Y + GK+C IN C PC++GG C D+ + + C CPLGF G +C +N DDC + C N CVD N+Y C C + G+ CD +C ++N C+++ C L + + C C G+ GK C + DDC + C+H A+CVD N Y C C G+ G +CE P M+ ++ S C +EC N C+ Q+ CRC PGF+G C+ L ++ F K+S++E+ + + P+ NISL T+ +G+LLY+G D L + LYQGHVR+ Y D + P YS+ VND + + + + + L + ++ +L + + +++ +++GG P SA+ + F GCI + IN + DF +S+ V PGC + + +E S+ + + P+ ++ + C G C G +C+ G + F+C +C+ GF G+ C++ C G I SC + K C G C +CCQPT+ K F+C G + +V C C++
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ----FTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPS--CNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSR-FSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGNE----------------------ESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPR-ELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHP-----------------PPMV-------LLQTSPCDQYECQNGAQCI----VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENP-CLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLA 1528

HSP 2 Score: 206.453 bits (524), Expect = 1.32815e-52
Identity = 136/438 (31.05%), Postives = 220/438 (50.23%), Query Frame = 1
Query:  160 ICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFF-KLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-SISKLKNLKELRIKKNKLTCNCHLAWLN-WFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQC 1464
+CP C+CE V+C ++ +P L E T L L N ++V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ +TF L+ ++ L L N+I I+ + + L +L + + N CNCHLAWL W K R P C PF L +IP+ ++ +F C N E+ CQ + + C +QC C + +V+C K L +P+ +P +V EL L N++T + + LS + L I+L+ N + + F + L++L L+ N+L+ C+P AF G++ L +L L N ++++ +FN L L L + NPL+CDC L W+ +++K IA C P M L + T+ FQC
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR-----CQKPFFLKEIPIQDVAIQDFTCDG----NEESSCQLSPR-CPEQCTCM-ETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPR-ELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLR------------------------CIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQC 905

HSP 3 Score: 185.267 bits (469), Expect = 4.80413e-46
Identity = 131/479 (27.35%), Postives = 211/479 (44.05%), Query Frame = 1
Query: 1513 PKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLT-----------------------------------------------PIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICS 2736
P V+CP KCTC++ V+C GL A+P I + + L + NN+ ++T P P L +LD+S NQI+ + F T + + L++N + CI + F+ L DL L L++N I+ I+V SF + ++ L L+ N +C+C++ W+S+W R T+G L C +P L+G + + +K ++C S S + S CP C C VDC L EIP +P E+ L++N +K + +F LK + +S N I+++ + LK+L +LVL + NK+ C+ + F+DL+NL +L L N + TI F L ++ + L QNPF CDC++KWL + D ++ + C+SP ++ K I K F CS
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFTL--CMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSI-------------------SCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS 486
BLAST of slit vs. RefSeq Human
Match: gi|574281850|ref|NP_001276064.1| (slit homolog 2 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 703.745 bits (1815), Expect = 0
Identity = 471/1454 (32.39%), Postives = 726/1454 (49.93%), Query Frame = 1
Query:  157 EICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQ------------------------CINENTFNKLTMLKYLLLEGNKIFWIS-ESISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKV-CSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDE--CKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGIC--KNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCE--QPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKRT 4341
+ CP C C +V+C +VP + T RL+L GN I I K+DF L +L+VLQL N+I++IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL +NQ+Q CI + F L L+ L L N I +S S + + L+ R+ N L C+CHLAWL+ +++ RP + C P L V + EF C+ E++ + + + C C CSN+ IV C GK L+ IP +LP + E+ L N I ++ G S YK L++I+L+ N + ++ P AF GL+ L SL L NK+ + K+ F GL SL L L+ N+I CL DAF+ + L++L L +NKL T+ + TF+PL ++ +++ NP CDC L W+ DY+ A C PR + + +++ F+C+ D + + + C ++CP KC C V+CSN LN +P I T L +++N L + P L K++ S N+I ++ F ++ + EI L SN+L+ C+ N++F L+ +R L L DN+I + +F +L L L NPF+CNC + W+ EW R GN P CQ P LK PI + + F CD G+D+ C + +CP +C C T V CS+ LK +P IP D TELYLD N TL N L + LS N I+ L+ + + L TL+LS+N+L+CI F LK+L++L L ND+S +P AFNDL+ L+++A+G NP +CDCN++WL+ + ++ + GI+ CA P +M K + + F C D I AKC+ C+ PCK++G C+ Y+C C Y F G++C+ I+AC PC++GG C K + G + C+C GF G C +N+DDC + C N CVD N+Y+C C + G+ C+ K +C D+NPC++D C P +KC C+ G+ G+ C+ + DDC+ N CK+ A C D N Y C+C GY G +CE P P + P C +C N C+ + + C+C PG+ G C+ L S+ F +K S+++I P ++ + P+ NI+L T+ SG+LLY+G D+ ++ V LY+G VR SY+ G YS+ +ND + + + ++L++ ++G + + ++ + D+ +++GG P K +++ + + F GCI +L IN + DF K + + PGC P +K +C G C+P S+ F C C+ G++G C +RT
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGL----YTQCMGPSHLRGHNVAEVQKREFVCSDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGD-CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCD-----------------------DGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSP--------------------------CDNFDCQNGAQCI----VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE-------------------------PCHKK----------VCA-HGTCQP--SSQAGFTCECQEGWMGPLCDQRT 1367

HSP 2 Score: 53.5286 bits (127), Expect = 6.87568e-06
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2758 ITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKIN-ACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNID---DCVAHQCINGEC--VDLRNSYSCKCQNGFRGKYCDIKFS 3123
I C+ C K+ C H G C + + C+CQ + G C+ + N C G C +G C I+ F +Y C C G G C D C A +C +G+C L Y C+C +G+ G CD + S
Sbjct: 1325 ILPGCEPCHKKVCAH-GTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHG-TCLPINAF-SYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPY-CECSSGYTGDSCDREIS 1448
BLAST of slit vs. RefSeq Human
Match: gi|574281382|ref|NP_001276065.1| (slit homolog 2 protein isoform 3 precursor [Homo sapiens])

HSP 1 Score: 699.893 bits (1805), Expect = 0
Identity = 471/1453 (32.42%), Postives = 724/1453 (49.83%), Query Frame = 1
Query:  157 EICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQ------------------------CINENTFNKLTMLKYLLLEGNKIFWIS-ESISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDE--CKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGIC--KNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCE--QPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKRT 4341
+ CP C C +V+C +VP + T RL+L GN I I K+DF L +L+VLQL N+I++IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL +NQ+Q CI + F L L+ L L N I +S S + + L+ R+ N L C+CHLAWL+ +++ RP + C P L V + EF C+ ++ + C C C CSN+ IV C GK L+ IP +LP + E+ L N I ++ G S YK L++I+L+ N + ++ P AF GL+ L SL L NK+ + K+ F GL SL L L+ N+I CL DAF+ + L++L L +NKL T+ + TF+PL ++ +++ NP CDC L W+ DY+ A C PR + + +++ F+C+ D + + + C ++CP KC C V+CSN LN +P I T L +++N L + P L K++ S N+I ++ F ++ + EI L SN+L+ C+ N++F L+ +R L L DN+I + +F +L L L NPF+CNC + W+ EW R GN P CQ P LK PI + + F CD G+D+ C + +CP +C C T V CS+ LK +P IP D TELYLD N TL N L + LS N I+ L+ + + L TL+LS+N+L+CI F LK+L++L L ND+S +P AFNDL+ L+++A+G NP +CDCN++WL+ + ++ + GI+ CA P +M K + + F C D I AKC+ C+ PCK++G C+ Y+C C Y F G++C+ I+AC PC++GG C K + G + C+C GF G C +N+DDC + C N CVD N+Y+C C + G+ C+ K +C D+NPC++D C P +KC C+ G+ G+ C+ + DDC+ N CK+ A C D N Y C+C GY G +CE P P + P C +C N C+ + + C+C PG+ G C+ L S+ F +K S+++I P ++ + P+ NI+L T+ SG+LLY+G D+ ++ V LY+G VR SY+ G YS+ +ND + + + ++L++ ++G + + ++ + D+ +++GG P K +++ + + F GCI +L IN + DF K + + PGC P +K +C G C+P S+ F C C+ G++G C +RT
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGL----YTQCMGPSHLRGHNVAEVQKREFVCSGH-QSFMAPSCSVLH--CPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGD-CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCD-----------------------DGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSP--------------------------CDNFDCQNGAQCI----VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE-------------------------PCHKK----------VCA-HGTCQP--SSQAGFTCECQEGWMGPLCDQRT 1363

HSP 2 Score: 53.5286 bits (127), Expect = 6.98963e-06
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2758 ITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKIN-ACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNID---DCVAHQCINGEC--VDLRNSYSCKCQNGFRGKYCDIKFS 3123
I C+ C K+ C H G C + + C+CQ + G C+ + N C G C +G C I+ F +Y C C G G C D C A +C +G+C L Y C+C +G+ G CD + S
Sbjct: 1321 ILPGCEPCHKKVCAH-GTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHG-TCLPINAF-SYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPY-CECSSGYTGDSCDREIS 1444
BLAST of slit vs. RefSeq Human
Match: gi|530376407|ref|XP_005248268.1| (PREDICTED: slit homolog 2 protein isoform X1 [Homo sapiens])

HSP 1 Score: 699.123 bits (1803), Expect = 0
Identity = 472/1461 (32.31%), Postives = 728/1461 (49.83%), Query Frame = 1
Query:  157 EICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQ------------------------CINENTFNKLTMLKYLLLEGNKIFWIS-ESISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKV-CSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNE---FDSKYETHNE----ECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDE--CKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGIC--KNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCE--QPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKRT 4341
+ CP C C +V+C +VP + T RL+L GN I I K+DF L +L+VLQL N+I++IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL +NQ+Q CI + F L L+ L L N I +S S + + L+ R+ N L C+CHLAWL+ +++ RP + C P L V + EF C+ E++ + + + C C CSN+ IV C GK L+ IP +LP + E+ L N I ++ G S YK L++I+L+ N + ++ P AF GL+ L SL L NK+ + K+ F GL SL L L+ N+I CL DAF+ + L++L L +NKL T+ + TF+PL ++ +++ NP CDC L W+ DY+ A C PR + + +++ F+C+ + F E + +C ++CP KC C V+CSN LN +P I T L +++N L + P L K++ S N+I ++ F ++ + EI L SN+L+ C+ N++F L+ +R L L DN+I + +F +L L L NPF+CNC + W+ EW R GN P CQ P LK PI + + F CD G+D+ C + +CP +C C T V CS+ LK +P IP D TELYLD N TL N L + LS N I+ L+ + + L TL+LS+N+L+CI F LK+L++L L ND+S +P AFNDL+ L+++A+G NP +CDCN++WL+ + ++ + GI+ CA P +M K + + F C D I AKC+ C+ PCK++G C+ Y+C C Y F G++C+ I+AC PC++GG C K + G + C+C GF G C +N+DDC + C N CVD N+Y+C C + G+ C+ K +C D+NPC++D C P +KC C+ G+ G+ C+ + DDC+ N CK+ A C D N Y C+C GY G +CE P P + P C +C N C+ + + C+C PG+ G C+ L S+ F +K S+++I P ++ + P+ NI+L T+ SG+LLY+G D+ ++ V LY+G VR SY+ G YS+ +ND + + + ++L++ ++G + + ++ + D+ +++GG P K +++ + + F GCI +L IN + DF K + + PGC P +K +C + G C+P S+ F C C+ G++G C +RT
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGL----YTQCMGPSHLRGHNVAEVQKREFVCSDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCD-----------------------DGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSP--------------------------CDNFDCQNGAQCI----VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE-------------------------PCHKK----------VCAH-GTCQP--SSQAGFTCECQEGWMGPLCDQRT 1375

HSP 2 Score: 53.5286 bits (127), Expect = 6.9397e-06
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2758 ITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKIN-ACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNID---DCVAHQCINGEC--VDLRNSYSCKCQNGFRGKYCDIKFS 3123
I C+ C K+ C H G C + + C+CQ + G C+ + N C G C +G C I+ F +Y C C G G C D C A +C +G+C L Y C+C +G+ G CD + S
Sbjct: 1333 ILPGCEPCHKKVCAH-GTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHG-TCLPINAF-SYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPY-CECSSGYTGDSCDREIS 1456
BLAST of slit vs. uniprot
Match: gi|33302576|sp|P24014|SLIT_DROME (RecName: Full=Protein slit; Short=dSlit; Contains: RecName: Full=Protein slit N-product; Contains: RecName: Full=Protein slit C-product; Flags: Precursor)

HSP 1 Score: 758.829 bits (1958), Expect = 0
Identity = 492/1529 (32.18%), Postives = 756/1529 (49.44%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLD------------------------LRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESI-SKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAH-QCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYIN--SNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKR-------TSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNC 4635
CP C C +V+C HR +VP + RL L GN + VI ++DF +L L++LQL++N+I +IE +F +LV+L +LRLN N ++ +P+ + + L +LD L +NQ+ C++E+ F L L+ L L N + + +I L L+ LR+ N C+CHL+WL+ F++ + P C +P +L V L EF+C+ + +N C C C+ DGIV C K L+++P LP + EL L N IT L S ++ L++I+L+ N + I A GL+QLT+L L NK+K + F GL SL L L+ NEI C+ DAF + L +L L +N + +L TF+ + ++ +++ NP CDC L W+ DY+ A C P+ M + SL+ F+C+ +D + EC CP C C V+C+ GL +P I T L+++ N L +++ P+L+KL++ NQ+ ++ + F ++ + E+ L NK+K I+N+ F L+ L+TL L DN+I+C++ SF++ +L L L NPF+CNC++ W +EW R G R C +PS ++ I L F C S+ C CP C C T V CS QLKEIP IP +T+ELYL+ N+++ ++ ++L L L LS N IT L+ L L TL++S+NKLQC+ + A L NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+ C ++PC++ +C + YQC CQ +HGK+CE I+AC+G PCRN C ++ G + C C G+ G +C NIDDC+ +C N C+D SY C+CQ GF G++CD K +C + NPC N C + Y C C G+ G C NIDDC+ + C++ CVD NDY+C C Y GKYCE P + S C HEC +G+C + ++ CRC PG++G C+YL S+ F H NS +E+ P P+ N+++ F + +G+L+Y G D +L V L+ G +R+SY++G+ V YS MV D K + + + +N T+ RV L IN SN Y+ L T +F+GG P Q A + I + F GC++ + IN K +DF R + PGC + + + + + L N CRR C P ++ ++C CK+G G+ C + T T + + + T + C+S + +Y CVG C N +CC K++ C RKY +++++ + C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL----APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENS--CPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCS--WDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKCSSE----------------------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQT----------------------SPCQNHEC-KHGVCFQPN-AQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTL----RVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRR------GSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 181.03 bits (458), Expect = 1.95893e-44
Identity = 132/492 (26.83%), Postives = 216/492 (43.90%), Query Frame = 1
Query: 1510 VPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLN-----------------------------------------------KLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKC 2772
+ + CP C+CT V+CS+ GL ++P I + L + NNL K P V + +L++LD+S N I + VF + L + L++N++ C++ FK L +L L L++N + + + F L+ L L+ NPF C+C++ W+S + R+ R CQSPS LKG + L ++ F C G EC CP C+C VDC + L +P +P DTTEL L++N + L SF + L+ + LS N I+ + + L+ LK L TLVL NK++ CI +DAF+DL +L +L L N++ ++ F+ + ++ + L +NPF CDCN++WL + H ++ + C SP++M + I + F CS + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR---CQSPSQLKGQNVADLHDQEFKCSG-------------------LTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 3 Score: 106.301 bits (264), Expect = 1.46062e-21
Identity = 68/253 (26.88%), Postives = 107/253 (42.29%), Query Frame = 1
Query: 2185 KCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCK 2799
+CP C C VDCS L +P +I D L L N+L + ET F+ L L+ L L+ N I + +N L +LE L L+ N+L+ C+ + AFK L L++L L +N+++++P F L L + L NPF CDC++ WL++F + C SP ++K +++ +F CS TE A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324
BLAST of slit vs. uniprot
Match: gi|341942041|sp|Q9WVB4|SLIT3_MOUSE (RecName: Full=Slit homolog 3 protein; Short=Slit-3; Short=Slit3; Flags: Precursor)

HSP 1 Score: 734.561 bits (1895), Expect = 0
Identity = 497/1586 (31.34%), Postives = 762/1586 (48.05%), Query Frame = 1
Query:  154 SEICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-------------------------SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNE--TSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGN-YECVCPLGFRGPKCTLNIDDCVAHQCIN-GECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEG--YSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGD--ILSTVITSDMEIPSIN-QYSTKFQIPVTRKKLNNACR----RPGICKNQG---ICEPIRG-----------------------------SKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKC 4623
+ CP C C SV+C VP + RL+L N I I K DF L L+VL L +N+++ IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL +NQ+Q I F +T +K L L+ N I I + S + + ++ LR+ N L C+CHLAWL+ +++ R I + +C AP L V + E+ C C N C C+CSN+ IV C GK L+ IP +LP +VE+ L N+I + G ++YK LK+I+++ N + DI P AF GL+ LTSL L NK+ I K F GL SL L L+ N+I CL + F+ ++ L++L L +NKL T+ + F PL ++ L++ NP CDC L W+ DY++ A C PR + + +++ F+C+ D + + EC + CP KC C IV+CSN L +PS + T L ++ N+++ L + PNL K+++S N+I+++ F + + E+ L N+L+ C++N+TF L+ +R L L DN I I +F ++L + L NPF+CNC+M W+ W R GN P CQ P LK PI + + F CDGN C+ +CP +C C T V CS+ L +P +P D TELYL+ N L + + ++F+ L + LS N I+ L + + + +L TL+LS+N+L+CI AF L++L+VL L ND+S++P +FNDL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+ C+ PCK+NG CS Y+C C Y + GK+C IN C PC +GG C +N + + C CPLGF G +C +N DDC + C N CVD N+Y+C C + G+ CD YC ++N C+++ C SL + ++C C G+ GK C N DDC + C+H A+CVD N Y C+C G+ G +CE P M+ ++ S C +EC N C+ Q+ CRC PGF+G C+ L ++ F K+S++E+ + + P+ NISL T+ +G+LLY+G D L + LYQGHVR+ Y D + P YS+ VND + + + ++ + L + ++ +L + + ++ +++GG P SA+ + F GCI + IN + DF +S+ V PGC + + +E S+ + + P+ ++ + C R G C G +C+ G + + C+C+ GF G C++ C G I SC + K C G C S+CCQP + K F+C G + +V C C
Sbjct: 31 AAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQ----FTLCMAPVHLRGFSVADVQKKEYVCPGPHSE--APACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYR-NRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGNE----------------------ESSCQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQLTLID---LSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEHP-----------------PPMV-------LLQTSPCDQYECQNGAQCI----VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK--LQKQPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCRHGTCMATGDSYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQCHISDRGEPYCLCQPGFSGHHCEQENP-CMGEIVREAIRRQKDYASCATASKVPIMECRGGC---------------------GSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 187.963 bits (476), Expect = 1.61679e-46
Identity = 130/479 (27.14%), Postives = 212/479 (44.26%), Query Frame = 1
Query: 1513 PKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLT-----------------------------------------------PIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICS 2736
P +CP KCTC++ V+C GL A+P I + + L + NN+ ++T P P L +LD+S NQI+ + F T + + L++N + CI + F+ L DL L L++N I+ I+V SF + ++ L L+ N +C+C++ W+S+W R T+G L C +P L+G + + +K ++C G S + + S CP C C VDC L EIP +P E+ L++N +K++ +F LK + +S N I+++ + LK+L +LVL + NK+ C+ + F+DL+NL +L L N + TI F L ++ + L QNPF CDC++KWL + D ++ + C+SP ++ K I K F CS
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TIGQFTL--CMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSL-------------------SCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS 486
BLAST of slit vs. uniprot
Match: gi|45477220|sp|O88280|SLIT3_RAT (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 726.472 bits (1874), Expect = 0
Identity = 495/1586 (31.21%), Postives = 764/1586 (48.17%), Query Frame = 1
Query:  154 SEICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-------------------------SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNE--TSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGN-YECVCPLGFRGPKCTLNIDDCVAHQCIN-GECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEG--YSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGD--ILSTVITSDMEIPSIN-QYSTKFQIPVTRKKLNNACR----RPGICKNQG---ICEPIRGSK--------------KKFRC---------------ICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKC 4623
+ CP C C SV+C VP + RL+L N I I K DF L L+VL L +N+++ IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL +NQ+Q I F +T +K L L+ N I I + S + + ++ LR+ N L C+CHLAWL+ +++ R I + +C AP L V + E+ C C N C C+CSN+ IV C GK L+ IP +LP +VE+ L N+I + G +YK LK+I+++ N + DI P AF GL+ LTSL L NK+ I K F GL SL L L+ N+I CL + F+ ++ L++L L +NKL T+ + F PL ++ L++ NP CDC L W+ DY++ A C PR + + +++ F+C+ D + + EC + CP KC C IV+CSN L+ +PS + T L ++ N++ L + PNL K+++S N+I+++ F + + E+ L N+L+ C+NN+TF L+ +R L L DN I I +F ++L + L NPF+CNC+M W+ W R GN P CQ P LK PI + + F C+GN + C+ +CP +C C T V CS+ L +P +P D TELYL+ N L + + ++F+ L + LS N I+ L + + + +L TL+LS+N+L+CI AF L++L+VL L ND+S++P +FNDL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+ C+ PCK+NG CS Y+C C Y + GK+C IN C PC++GG C ++ + + C CPLGF G +C +N DDC + C N CVD N+Y+C C + G+ CD YC ++N C+++ C SL + ++C C G+ GK C + DDC + C+H A+CVD N Y C+C G+ G +CE P M+ ++ S C +EC N C+ Q+ CRC PGF+G C+ L ++ F K+S++E+ + + P+ NISL T+ +G+LLY+G D L + LYQGHVR+ Y D + P YS+ VND + + + ++ + L + ++ +L + + +++ +++GG P SA+ + F GCI + IN + DF +S+ V PGC + + +E S+ + + P+ ++ + C G C G +C+ G + F+C +C+ GF G C++ C G I SC + K C G C S+CCQP + K F+C G + +V C C
Sbjct: 31 AAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQ----FTLCMAPVHLRGFSVADVQKKEYVCPGPHSE--APACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYR-NRFSSECFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCEGNE----------------------ENSCQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQLTLID---LSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEHP-----------------PPMV-------LLQTSPCDQYECQNGAQCI----VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSHGTCVATGNSYVCKCAEGYEGPLCDQKNDSANACSAFKCHHGQCHISDRGEPYCLCQPGFSGNHCEQENP-CLGEIVREAIRRQKDYASCATASKVPIMVCRGGC---------------------GSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 187.578 bits (475), Expect = 1.99983e-46
Identity = 130/479 (27.14%), Postives = 212/479 (44.26%), Query Frame = 1
Query: 1513 PKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLT-----------------------------------------------PIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICS 2736
P +CP KCTC++ V+C GL A+P I + + L + NN+ ++T P P L +LD+S NQI+ + F T + + L++N + CI + F+ L DL L L++N I+ I+V SF + ++ L L+ N +C+C++ W+S+W R T+G L C +P L+G + + +K ++C G S + + S CP C C VDC L EIP +P E+ L++N +K++ +F LK + +S N I+++ + LK+L +LVL + NK+ C+ + F+DL+NL +L L N + TI F L ++ + L QNPF CDC++KWL + D ++ + C+SP ++ K I K F CS
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TIGQFTL--CMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSL-------------------SCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS 486
BLAST of slit vs. uniprot
Match: gi|311033528|sp|O75094|SLIT3_HUMAN (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 716.072 bits (1847), Expect = 0
Identity = 490/1583 (30.95%), Postives = 755/1583 (47.69%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-------------------------SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLK------------------------CINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGN-YECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYC-DDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEG--YSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGD--ILSTVITSDMEIPSIN-QYSTKFQIPVTRKKLNNACR----RPGICKNQG---ICEPIRG--------------SKKKFRC---------------ICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCIS 4629
CP C C SV+C VP + RL+L N I I K DF L L+VL L +N+++ IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL +NQ+Q I F +T +K L L+ N I I + S + + ++ LR+ N L C+CHLAWL+ +++ R + + +C AP L V + E+ C + C N C C CSN+ IV C GK L IP +LP +VE+ L N+I + G ++YK LK+I+++ N + DI P AF GL+ LTSL L NK+ I K F GL SL L L+ N+I CL + F+ ++ L++L L +NKL T+ + F PL ++ L++ NP CDC L W+ DY++ A C PR + + +++ F+C+ D + + EC + CP KC C IV+CSN L +PS + L ++ N ++ L + PNL K+++S N+I+++ F + + E+ L N+L+ C++N+TF L+ +R L L DN I I +F ++L + L NPF+CNC++ W+ +W R GN P CQ P LK PI + + F CDGN C+ +CP +C C T V CS+ L+ +P +P D TELYL+ N L + L L + LS N I+ L + + +L TL+LS+N+L+CI AF L++L+VL L ND+S++P +FNDL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+ C+ PCK+NG C+ Y+C C Y + GK+C IN C PC++GG C D+ + + C CPLGF G +C +N DDC + C N CVD N+Y C C + G+ CD +C ++N C+++ C L + + C C G+ GK C + DDC + C+H A+CVD N Y C C G+ G +CE P M+ ++ S C +EC N C+ Q+ CRC PGF+G C+ L ++ F K+S++E+ + + P+ NISL T+ +G+LLY+G D L + LYQGHVR+ Y D + P YS+ VND + + + + + L + ++ +L + + +++ +++GG P SA+ + F GCI + IN + DF +S+ V PGC + + +E S+ + + P+ ++ + C G C G +C+ G + F+C +C+ GF G+ C++ C G I SC + K C G C +CCQPT+ K F+C G + +V C C++
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ----FTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPS--CNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSR-FSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGNE----------------------ESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPR-ELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHP-----------------PPMV-------LLQTSPCDQYECQNGAQCI----VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENP-CLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLA 1521

HSP 2 Score: 209.92 bits (533), Expect = 3.43505e-53
Identity = 144/470 (30.64%), Postives = 229/470 (48.72%), Query Frame = 1
Query:  160 ICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFF-KLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-SISKLKNLKELRIKKNKLTCNCHLAWLN-WFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIV 1560
+CP C+CE V+C ++ +P L E T L L N ++V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ +TF L+ ++ L L N+I I+ + + L +L + + N CNCHLAWL W K R P C PF L +IP+ ++ +F C N E+ CQ + + C +QC C + +V+C K L +P+ +P +V EL L N++T + + LS + L I+L+ N + + F + L++L L+ N+L+ C+P AF G++ L +L L N ++++ +FN L L L + NPL+CDC L W+ +++K IA C P M L + T+ FQC D C+ C TCT D V
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR-----CQKPFFLKEIPIQDVAIQDFTCDG----NEESSCQLSPR-CPEQCTCM-ETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPR-ELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLR------------------------CIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACL-SSPCKNNGTCTQDPV 936

HSP 3 Score: 184.882 bits (468), Expect = 1.5262e-45
Identity = 131/479 (27.35%), Postives = 211/479 (44.05%), Query Frame = 1
Query: 1513 PKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLT-----------------------------------------------PIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICS 2736
P V+CP KCTC++ V+C GL A+P I + + L + NN+ ++T P P L +LD+S NQI+ + F T + + L++N + CI + F+ L DL L L++N I+ I+V SF + ++ L L+ N +C+C++ W+S+W R T+G L C +P L+G + + +K ++C S S + S CP C C VDC L EIP +P E+ L++N +K + +F LK + +S N I+++ + LK+L +LVL + NK+ C+ + F+DL+NL +L L N + TI F L ++ + L QNPF CDC++KWL + D ++ + C+SP ++ K I K F CS
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRR-TVGQFTL--CMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSI-------------------SCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS 486
BLAST of slit vs. uniprot
Match: gi|145559530|sp|O75093|SLIT1_HUMAN (RecName: Full=Slit homolog 1 protein; Short=Slit-1; AltName: Full=Multiple epidermal growth factor-like domains protein 4; Short=Multiple EGF-like domains protein 4; Flags: Precursor)

HSP 1 Score: 699.123 bits (1803), Expect = 0
Identity = 484/1592 (30.40%), Postives = 747/1592 (46.92%), Query Frame = 1
Query:  154 SEICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-------------------------SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNE---FDSKYETH--NEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFK------------------------XXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDE--CKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNF-GNYECVCPLGFRGPKCTLNIDDCVAHQCINGE-CVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGC----------GDILSTVITSDM----------------EIPSINQYSTKFQ-IPVTRKKLNNACR---RPGICKNQG-ICEPIRG-----------SKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKC 4623
+ CP C C +V+C +P + T RL L GN I I K+DF L L+VLQL N+I ++E GAFD++ L +LRLNRN + LP+ LF L +LDL +N +Q I F T LK L L+ N+I I E S + + L+ R+ N L C+CHLAWL+ +++ RP I CS P L + V + EF C+ + + C + C C CSN GIV C GK L+ IP +LP + E+ L N I + G S Y+ L++I+L+ N + +I P AF GL+ L SL L NK+ + + F GL +L L L+ N+I C+ DAF+ ++ L +L L +NK+ +L + TF L ++ L++ NP CDC L W+ D+++ A C PR + + +++ F+C+ + F E + N EC V CP KC C +++V CS+ L +P I ST L +++N ++ L + +L K+++S N++ +++ F + ++E+HL +N+L+ I + F+ L+ LRTL L +N I+CI DSF +L L L NPF+CNC + W+ W R GN P CQ+P L+ P+ + F C+ G +E C +CP +C C T V CS+ L+ +P IP + TELYLD N TL +L+ + LS N I+ L+ + T + L TL+LS+N LQCI AF+ L++L++L L ND+ST+ F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P+ M+ K + + F C A + AKCD C+ PC++ G C Y+C C + G++CE +++C PC NGG C + + C CP GF GP C +N DDCV H C NG CVD +Y+C+C + GK C+ C D+NPC+++ C P+ +C C G+ G C++N DDC+ + C++ A+C+D N Y CLC GY G+ CE P P K S C EC N CV+ + + C+C PGF G C+ L S+ F ++++++ T P+ NI+L T +G+LLY G D ++ V LYQGHVR+SY+ G YS +ND + + + + + + ++G T+ + + + + +++GG P + +A + I + F GCI +L IN + DF+K + V PGC G M + P Q +P+ + C+ +C G + EP RG K C+C GF G+ C++ S C G +F C++ + C G+C CCQ + K F+C G + +V P C C
Sbjct: 31 ASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL----FTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGN---PRCQNPDFLRQIPLQDVAFPDFRCE-----------------------EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPAPK-------------------------SPCEGTECQNGANCVD----QGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDN--FGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCEQE-SECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQG--------------------CCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530

HSP 2 Score: 199.904 bits (507), Expect = 4.17172e-50
Identity = 135/446 (30.27%), Postives = 226/446 (50.67%), Query Frame = 1
Query:  133 INDPSDESEICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFF-KLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISE-SISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQC 1464
+N + +CP+ C+CE VEC +P + + T L L N I+++ + F KL +LK + LSNN+++ IE GAF+ ++ +L L N ++ + G+F L L+ L LR+N++ CI+ ++F L ++ L L N+I +S + L++L L + N CNC LAWL +++ R + + C P L IP+ ++ +F+C ++ E C + C ++C C D +V+C K L +P+ +P NV EL L N T++ G LS +K L+ ++L+ N + + +F + QLT+L L+ N L +C+P AF+G++ L +L L N ++TL+ F + L L I NPL CDC L W+ ++K IA C P++M+G L + F+C
Sbjct: 503 LNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIV----TGNPRCQNPDFLRQIPLQDVAFPDFRC---EEGQEEGGCLPRPQ-CPQECACL-DTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLV-PGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNAL------------------------QCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFEC 914
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136484|ref|NP_476729.1| (slit, isoform B [Drosophila melanogaster])

HSP 1 Score: 771.541 bits (1991), Expect = 0
Identity = 489/1498 (32.64%), Postives = 750/1498 (50.07%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESI-SKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAH-QCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYIN--SNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNC 4635
CP C C +V+C HR +VP + RL L GN + VI ++DF +L L++LQL++N+I +IE +F +LV+L +L ++ N+I + +F L+ L L +NQ+ C++E+ F L L+ L L N + + +I L L+ LR+ N C+CHL+WL+ F++ + P C +P +L V L EF+C+ + +N C C C+ DGIV C K L+++P LP + EL L N IT L S ++ L++I+L+ N + I A GL+QLT+L L NK+K + F GL SL L L+ NEI C+ DAF + L +L L +N + +L TF+ + ++ +++ NP CDC L W+ DY+ A C P+ M + SL+ F+C+ +D + EC CP C C V+C+ GL +P I T L+++ N L +++ P+L+KL++ NQ+ ++ + F ++ + E+ L NK+K I+N+ F L+ L+TL L DN+I+C++ SF++ +L L L NPF+CNC++ W +EW R G R C +PS ++ I L F C S+ C CP C C T V CS QLKEIP IP +T+ELYL+ N+++ ++ ++L L L LS N IT L+ L L TL++S+NKLQC+ + A L NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+ C ++PC++ +C + YQC CQ +HGK+CE I+AC+G PCRN C ++ G + C C G+ G +C NIDDC+ +C N C+D SY C+CQ GF G++CD K +C + NPC N C + Y C C G+ G C NIDDC+ + C++ CVD NDY+C C Y GKYCE P + S C HEC +G+C + ++ CRC PG++G C+YL S+ F H NS +E+ P P+ N+++ F + +G+L+Y G D +L V L+ G +R+SY++G+ V YS MV D K + + + +N T+ RV L IN SN Y+ L T +F+GG P Q A + I + F GC++ + IN K +DF R + PGC + + + + + L N CRR C P ++ ++C CK+G G+ C + S C + + D C+S + +Y CVG C N +CC K++ C RKY +++++ + C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL----APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENS--CPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCS--WDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKCSSE----------------------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQT----------------------SPCQNHEC-KHGVCFQPN-AQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTL----RVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRR------GSRCVPNSNARDGYQCKCKHGQRGRYCDQAASTCRKEQVREYYTEND----CRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1468

HSP 2 Score: 186.808 bits (473), Expect = 3.66827e-47
Identity = 132/468 (28.21%), Postives = 217/468 (46.37%), Query Frame = 1
Query: 1510 VPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNL--------NKLTPIY---------------SVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKC 2772
+ + CP C+CT V+CS+ GL ++P I + L + NNL +LT + S + +L +LD+S N I + VF + L + L++N++ C++ FK L +L L L++N + + + F L+ L L+ NPF C+C++ W+S + R+ R CQSPS LKG + L ++ F C G EC CP C+C VDC + L +P +P DTTEL L++N + L SF + L+ + LS N I+ + + L+ LK L TLVL NK++ CI +DAF+DL +L +L L N++ ++ F+ + ++ + L +NPF CDCN++WL + H ++ + C SP++M + I + F CS + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR---CQSPSQLKGQNVADLHDQEFKCSG-------------------LTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 3 Score: 117.087 bits (292), Expect = 8.69694e-26
Identity = 68/229 (29.69%), Postives = 109/229 (47.60%), Query Frame = 1
Query: 2185 KCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNET------------------------SFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCK 2799
+CP C C VDCS L +P +I D L L N+L + ET SF++LV L+ L +S N IT + + V ++L +L L N++ C+ + AFK L L++L L +N+++++P F L L + L NPF CDC++ WL++F + C SP ++K +++ +F CS TE A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136482|ref|NP_476728.1| (slit, isoform A [Drosophila melanogaster])

HSP 1 Score: 766.148 bits (1977), Expect = 0
Identity = 489/1505 (32.49%), Postives = 752/1505 (49.97%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESI-SKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAH-QCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYIN--SNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKR-------TSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNC 4635
CP C C +V+C HR +VP + RL L GN + VI ++DF +L L++LQL++N+I +IE +F +LV+L +L ++ N+I + +F L+ L L +NQ+ C++E+ F L L+ L L N + + +I L L+ LR+ N C+CHL+WL+ F++ + P C +P +L V L EF+C+ + +N C C C+ DGIV C K L+++P LP + EL L N IT L S ++ L++I+L+ N + I A GL+QLT+L L NK+K + F GL SL L L+ NEI C+ DAF + L +L L +N + +L TF+ + ++ +++ NP CDC L W+ DY+ A C P+ M + SL+ F+C+ +D + EC CP C C V+C+ GL +P I T L+++ N L +++ P+L+KL++ NQ+ ++ + F ++ + E+ L NK+K I+N+ F L+ L+TL L DN+I+C++ SF++ +L L L NPF+CNC++ W +EW R G R C +PS ++ I L F C S+ C CP C C T V CS QLKEIP IP +T+ELYL+ N+++ ++ ++L L L LS N IT L+ L L TL++S+NKLQC+ + A L NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+ C ++PC++ +C + YQC CQ +HGK+CE I+AC+G PCRN C ++ G + C C G+ G +C NIDDC+ +C N C+D SY C+CQ GF G++CD K +C + NPC N C + Y C C G+ G C NIDDC+ + C++ CVD NDY+C C Y GKYCE P + S C HEC +G+C + ++ CRC PG++G C+YL S+ F H NS +E+ P P+ N+++ F + +G+L+Y G D +L V L+ G +R+SY++G+ V YS MV D K + + + +N T+ RV L IN SN Y+ L T +F+GG P Q A + I + F GC++ + IN K +DF R + PGC + + + + + L N CRR C P ++ ++C CK+G G+ C + T T + + + T + C+S + +Y CVG C N +CC K++ C RKY +++++ + C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL----APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENS--CPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCS--WDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKCSSE----------------------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQT----------------------SPCQNHEC-KHGVCFQPN-AQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTL----RVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRR------GSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 2 Score: 187.193 bits (474), Expect = 3.17914e-47
Identity = 132/468 (28.21%), Postives = 217/468 (46.37%), Query Frame = 1
Query: 1510 VPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNL--------NKLTPIY---------------SVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKC 2772
+ + CP C+CT V+CS+ GL ++P I + L + NNL +LT + S + +L +LD+S N I + VF + L + L++N++ C++ FK L +L L L++N + + + F L+ L L+ NPF C+C++ W+S + R+ R CQSPS LKG + L ++ F C G EC CP C+C VDC + L +P +P DTTEL L++N + L SF + L+ + LS N I+ + + L+ LK L TLVL NK++ CI +DAF+DL +L +L L N++ ++ F+ + ++ + L +NPF CDCN++WL + H ++ + C SP++M + I + F CS + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR---CQSPSQLKGQNVADLHDQEFKCSG-------------------LTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 3 Score: 117.472 bits (293), Expect = 7.06797e-26
Identity = 68/229 (29.69%), Postives = 109/229 (47.60%), Query Frame = 1
Query: 2185 KCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNET------------------------SFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCK 2799
+CP C C VDCS L +P +I D L L N+L + ET SF++LV L+ L +S N IT + + V ++L +L L N++ C+ + AFK L L++L L +N+++++P F L L + L NPF CDC++ WL++F + C SP ++K +++ +F CS TE A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077130|ref|NP_001097333.1| (slit, isoform D [Drosophila melanogaster])

HSP 1 Score: 766.148 bits (1977), Expect = 0
Identity = 489/1505 (32.49%), Postives = 752/1505 (49.97%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESI-SKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAH-QCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYIN--SNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKR-------TSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNC 4635
CP C C +V+C HR +VP + RL L GN + VI ++DF +L L++LQL++N+I +IE +F +LV+L +L ++ N+I + +F L+ L L +NQ+ C++E+ F L L+ L L N + + +I L L+ LR+ N C+CHL+WL+ F++ + P C +P +L V L EF+C+ + +N C C C+ DGIV C K L+++P LP + EL L N IT L S ++ L++I+L+ N + I A GL+QLT+L L NK+K + F GL SL L L+ NEI C+ DAF + L +L L +N + +L TF+ + ++ +++ NP CDC L W+ DY+ A C P+ M + SL+ F+C+ +D + EC CP C C V+C+ GL +P I T L+++ N L +++ P+L+KL++ NQ+ ++ + F ++ + E+ L NK+K I+N+ F L+ L+TL L DN+I+C++ SF++ +L L L NPF+CNC++ W +EW R G R C +PS ++ I L F C S+ C CP C C T V CS QLKEIP IP +T+ELYL+ N+++ ++ ++L L L LS N IT L+ L L TL++S+NKLQC+ + A L NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+ C ++PC++ +C + YQC CQ +HGK+CE I+AC+G PCRN C ++ G + C C G+ G +C NIDDC+ +C N C+D SY C+CQ GF G++CD K +C + NPC N C + Y C C G+ G C NIDDC+ + C++ CVD NDY+C C Y GKYCE P + S C HEC +G+C + ++ CRC PG++G C+YL S+ F H NS +E+ P P+ N+++ F + +G+L+Y G D +L V L+ G +R+SY++G+ V YS MV D K + + + +N T+ RV L IN SN Y+ L T +F+GG P Q A + I + F GC++ + IN K +DF R + PGC + + + + + L N CRR C P ++ ++C CK+G G+ C + T T + + + T + C+S + +Y CVG C N +CC K++ C RKY +++++ + C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL----APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENS--CPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCS--WDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKCSSE----------------------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQT----------------------SPCQNHEC-KHGVCFQPN-AQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTL----RVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRR------GSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 2 Score: 187.193 bits (474), Expect = 3.17914e-47
Identity = 132/468 (28.21%), Postives = 217/468 (46.37%), Query Frame = 1
Query: 1510 VPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNL--------NKLTPIY---------------SVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKC 2772
+ + CP C+CT V+CS+ GL ++P I + L + NNL +LT + S + +L +LD+S N I + VF + L + L++N++ C++ FK L +L L L++N + + + F L+ L L+ NPF C+C++ W+S + R+ R CQSPS LKG + L ++ F C G EC CP C+C VDC + L +P +P DTTEL L++N + L SF + L+ + LS N I+ + + L+ LK L TLVL NK++ CI +DAF+DL +L +L L N++ ++ F+ + ++ + L +NPF CDCN++WL + H ++ + C SP++M + I + F CS + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR---CQSPSQLKGQNVADLHDQEFKCSG-------------------LTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 3 Score: 117.472 bits (293), Expect = 7.06797e-26
Identity = 68/229 (29.69%), Postives = 109/229 (47.60%), Query Frame = 1
Query: 2185 KCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNET------------------------SFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCK 2799
+CP C C VDCS L +P +I D L L N+L + ET SF++LV L+ L +S N IT + + V ++L +L L N++ C+ + AFK L L++L L +N+++++P F L L + L NPF CDC++ WL++F + C SP ++K +++ +F CS TE A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136480|ref|NP_476727.1| (slit, isoform C [Drosophila melanogaster])

HSP 1 Score: 758.829 bits (1958), Expect = 0
Identity = 492/1529 (32.18%), Postives = 756/1529 (49.44%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLD------------------------LRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESI-SKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAH-QCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYIN--SNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKR-------TSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNC 4635
CP C C +V+C HR +VP + RL L GN + VI ++DF +L L++LQL++N+I +IE +F +LV+L +LRLN N ++ +P+ + + L +LD L +NQ+ C++E+ F L L+ L L N + + +I L L+ LR+ N C+CHL+WL+ F++ + P C +P +L V L EF+C+ + +N C C C+ DGIV C K L+++P LP + EL L N IT L S ++ L++I+L+ N + I A GL+QLT+L L NK+K + F GL SL L L+ NEI C+ DAF + L +L L +N + +L TF+ + ++ +++ NP CDC L W+ DY+ A C P+ M + SL+ F+C+ +D + EC CP C C V+C+ GL +P I T L+++ N L +++ P+L+KL++ NQ+ ++ + F ++ + E+ L NK+K I+N+ F L+ L+TL L DN+I+C++ SF++ +L L L NPF+CNC++ W +EW R G R C +PS ++ I L F C S+ C CP C C T V CS QLKEIP IP +T+ELYL+ N+++ ++ ++L L L LS N IT L+ L L TL++S+NKLQC+ + A L NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+ C ++PC++ +C + YQC CQ +HGK+CE I+AC+G PCRN C ++ G + C C G+ G +C NIDDC+ +C N C+D SY C+CQ GF G++CD K +C + NPC N C + Y C C G+ G C NIDDC+ + C++ CVD NDY+C C Y GKYCE P + S C HEC +G+C + ++ CRC PG++G C+YL S+ F H NS +E+ P P+ N+++ F + +G+L+Y G D +L V L+ G +R+SY++G+ V YS MV D K + + + +N T+ RV L IN SN Y+ L T +F+GG P Q A + I + F GC++ + IN K +DF R + PGC + + + + + L N CRR C P ++ ++C CK+G G+ C + T T + + + T + C+S + +Y CVG C N +CC K++ C RKY +++++ + C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL----APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENS--CPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCS--WDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKCSSE----------------------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQT----------------------SPCQNHEC-KHGVCFQPN-AQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTL----RVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRR------GSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 181.03 bits (458), Expect = 2.2613e-45
Identity = 132/492 (26.83%), Postives = 216/492 (43.90%), Query Frame = 1
Query: 1510 VPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLN-----------------------------------------------KLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKC 2772
+ + CP C+CT V+CS+ GL ++P I + L + NNL K P V + +L++LD+S N I + VF + L + L++N++ C++ FK L +L L L++N + + + F L+ L L+ NPF C+C++ W+S + R+ R CQSPS LKG + L ++ F C G EC CP C+C VDC + L +P +P DTTEL L++N + L SF + L+ + LS N I+ + + L+ LK L TLVL NK++ CI +DAF+DL +L +L L N++ ++ F+ + ++ + L +NPF CDCN++WL + H ++ + C SP++M + I + F CS + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR---CQSPSQLKGQNVADLHDQEFKCSG-------------------LTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 3 Score: 106.301 bits (264), Expect = 1.68607e-22
Identity = 68/253 (26.88%), Postives = 107/253 (42.29%), Query Frame = 1
Query: 2185 KCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCK 2799
+CP C C VDCS L +P +I D L L N+L + ET F+ L L+ L L+ N I + +N L +LE L L+ N+L+ C+ + AFK L L++L L +N+++++P F L L + L NPF CDC++ WL++F + C SP ++K +++ +F CS TE A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077132|ref|NP_001097334.1| (slit, isoform E [Drosophila melanogaster])

HSP 1 Score: 758.829 bits (1958), Expect = 0
Identity = 492/1529 (32.18%), Postives = 756/1529 (49.44%), Query Frame = 1
Query:  163 CPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLD------------------------LRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESI-SKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAH-QCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCD-DINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYF-HKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYIN--SNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKR-------TSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNC 4635
CP C C +V+C HR +VP + RL L GN + VI ++DF +L L++LQL++N+I +IE +F +LV+L +LRLN N ++ +P+ + + L +LD L +NQ+ C++E+ F L L+ L L N + + +I L L+ LR+ N C+CHL+WL+ F++ + P C +P +L V L EF+C+ + +N C C C+ DGIV C K L+++P LP + EL L N IT L S ++ L++I+L+ N + I A GL+QLT+L L NK+K + F GL SL L L+ NEI C+ DAF + L +L L +N + +L TF+ + ++ +++ NP CDC L W+ DY+ A C P+ M + SL+ F+C+ +D + EC CP C C V+C+ GL +P I T L+++ N L +++ P+L+KL++ NQ+ ++ + F ++ + E+ L NK+K I+N+ F L+ L+TL L DN+I+C++ SF++ +L L L NPF+CNC++ W +EW R G R C +PS ++ I L F C S+ C CP C C T V CS QLKEIP IP +T+ELYL+ N+++ ++ ++L L L LS N IT L+ L L TL++S+NKLQC+ + A L NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+ C ++PC++ +C + YQC CQ +HGK+CE I+AC+G PCRN C ++ G + C C G+ G +C NIDDC+ +C N C+D SY C+CQ GF G++CD K +C + NPC N C + Y C C G+ G C NIDDC+ + C++ CVD NDY+C C Y GKYCE P + S C HEC +G+C + ++ CRC PG++G C+YL S+ F H NS +E+ P P+ N+++ F + +G+L+Y G D +L V L+ G +R+SY++G+ V YS MV D K + + + +N T+ RV L IN SN Y+ L T +F+GG P Q A + I + F GC++ + IN K +DF R + PGC + + + + + L N CRR C P ++ ++C CK+G G+ C + T T + + + T + C+S + +Y CVG C N +CC K++ C RKY +++++ + C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL----APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENS--CPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCS--WDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKCSSE----------------------NSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQT----------------------SPCQNHEC-KHGVCFQPN-AQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTL----RVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRR------GSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN---------------------QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 181.03 bits (458), Expect = 2.2613e-45
Identity = 132/492 (26.83%), Postives = 216/492 (43.90%), Query Frame = 1
Query: 1510 VPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLN-----------------------------------------------KLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKC 2772
+ + CP C+CT V+CS+ GL ++P I + L + NNL K P V + +L++LD+S N I + VF + L + L++N++ C++ FK L +L L L++N + + + F L+ L L+ NPF C+C++ W+S + R+ R CQSPS LKG + L ++ F C G EC CP C+C VDC + L +P +P DTTEL L++N + L SF + L+ + LS N I+ + + L+ LK L TLVL NK++ CI +DAF+DL +L +L L N++ ++ F+ + ++ + L +NPF CDCN++WL + H ++ + C SP++M + I + F CS + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR---CQSPSQLKGQNVADLHDQEFKCSG-------------------LTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 3 Score: 106.301 bits (264), Expect = 1.68607e-22
Identity = 68/253 (26.88%), Postives = 107/253 (42.29%), Query Frame = 1
Query: 2185 KCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQ------------------------------------------------CIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCK 2799
+CP C C VDCS L +P +I D L L N+L + ET F+ L L+ L L+ N I + +N L +LE L L+ N+L+ C+ + AFK L L++L L +N+++++P F L L + L NPF CDC++ WL++F + C SP ++K +++ +F CS TE A + + PC+
Sbjct: 72 RCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324
BLAST of slit vs. Smed Unigenes AA
Match: SMU15036778 (dd_smedV4_12111_0_1|m.4973|m.1592)

HSP 1 Score: 2421.35 bits (6274), Expect = 0
Identity = 1234/1536 (80.34%), Postives = 1381/1536 (89.91%), Query Frame = 1
Query:   49 MLIIFKDITYKFYXXXXXXXYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNNRITSIEPGAFDXXXXXXXXXXXXXXXQYLPDGLFSKLSKLQKLDLRDNQLQCINENTFNKLTMLKYLLLEGNKIFWISESISKLKNLKELRIKKNKLTCNCHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASEDKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELDLSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLNANKLKTIRKNAXXXXXXXXXXXXHGNEIECLPADAFEGVKKLHILHLSENKLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIASCHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCTSDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKLDMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQLSDNEINCIVVDSFKXXXXXXXXXXXXXPFHCNCNMKWMSEWSRNHHSTLGNHRLPTCQSPSLLKGTPITHLDEKYFLCDGNXXXXXXXXXXXXXXXXXXXXXXGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDRNDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNKLQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFHCDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGE-CVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPT--SKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGNISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYSMGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGIFIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSINVKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKNQGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLDSCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYSTHKIQFKCRKGRKYFRDVNLPKNCKCISNCQSD* 4647
M+ IFKDIT+KF L+LL +LYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVP+ILQEKTTRLNLLGNRINVIRKSDF KL LKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPD LFSKL+KLQKLDLRDNQLQCIN+N FNKL MLKYLLLEGNKIFWISE+ISKLK+LKELRI KNKL CNCHLAWLNWF+K + +I KP SV+CS PFRLS IP+ +LS YEFQCASEDK NLEN+C +KKVCSK+CNCS+DGIVKCVGK+LSNIPQDLP NVVELDL DNNITILQQGYLSKYK LKKI LT NGMVDIEPGAFLGL QLTS+YLN N LKTIRKNAF GL SLMFL+L N+IECLP D E K+LH+LHLSENKLT+LK+ETF P + LR+LY+V+NPLNCDCR++WIVDYIK KE N P+A+C PRN+QG LR+LQ Y+FQCN EF+SKYETH+EECVPKVSCPLKCTC+SD+VNCSN+GL +LP SIFPSTKTLIMSHNNL KL PIYS+HEAPNLMKLD+SFNQIE L+ DVF+RS+KL EI+LNSN+LKCINNETFKNL +L LQLS+N I+CIV DSFKNNLNLKYLMLN+N FHC+C +KWMSEWSRNH++ LGNHRLPTCQSP +LK TPITHLD+KYFLCDGNAS+ S +SC E +S + CCSIG++EC + KKCP KCKCE TKVDCSD+QLKEIP+EIP DTTELYLDRN L++LNETSFKNL+ LKTLVLSYNGITELNKNVLTPLK+LETLVLSFNKLQCIHQDAFK+L NLKVLILQSNDVSTIP+QAFNDL NLNNIALGQNPFHCDCNIKWLNQFF D+FLDNGISLCASPEKMKLKSI+HSKPTDFICSEETEDAYITAKCD CMKRPCKHNGKCSLITHHNYQCDC YPFHGKNC+ +INACFGQPCRNGGICKNIDN+GNYECVCP+GFRGPKCT+N+DDCV + C+NG C DL NSYSCKCQ+GFRGKYCDIKF YC+DINPC+N G CQ LPNNDYKCVCSKGWEGK+C +N DDCKYN+CKHE++CVDLHNDYKC+CRPGY+GK+CE PAWKPT +SRR IN+S M + ENE+ISESVCAYHECLNNGIC+NGDQ+KNQKSYC+CKPG+SGHLCQYLNS+YF KNS+IEI+PPSRGFLMP+GNISLNF+TNS+SGL+LYQG +QTYLVVNLYQGH+RISYNLGDKVVGPEGYSMGMVNDS+L LHIEIVGENLTMYLNGRVHCTLKSKY+NSNRYMALDTGIFIGGAP+KILQSA+ K+HI+TDSEFIGC+ESLLIN+K+IDFSKYL +SINV PGCG ++STV+ SD++IPSI Q + T+KK NN C+RPGICKNQG+CE + GSKKKFRCICKNGFVG++CKKR SMCHGTFTE+ I DPD+ +CKSIE+FQYR C GTCS ++MQSDV K F+HKPID SSSRCCQPTKYSTH+IQFKC GR Y R NLPKNCKC++NC +D*
Sbjct: 1 MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETNTPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTCCSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQSE-MTYENLENEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANCLND* 1535
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006140 (SmedAsxldir_c107649_g2_i1|m.84323|m.17798)

HSP 1 Score: 132.494 bits (332), Expect = 8.57507e-31
Identity = 108/359 (30.08%), Postives = 155/359 (43.18%), Query Frame = 1
Query: 2728 ICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGE-CVDLRNSYSCKCQNGFRGKYCDIKFSYCDDI----------------------NPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGS-ENEIISE---------------SVCAYHECLNNGIC-----VNGDQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGNISLNFLTN 3672
+C Y + + C+ PCK+NG C+ + ++Y+C+C F GKNCE I AC QPC+NGG+C+ +D Y C C G+ G C + C + C+NG C + + C C F GK C+ YC + N C G C S + C C G+EG C +IDDCK N CK+ C+D N+++C+C G+ GK CE+ T + +N + HS N+ I E S+C + CLN G C +NG Q C C G+ G +CQ+L HI+ P R L + +N N
Sbjct: 453 LCQPGYTGKYCDKEINECVPNPCKNNGVCT-DSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDT--GYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEE----RTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ-------CHCNQGWIGTVCQFL---------HIDFQPCRRKNLCKNEGVCINVGYN 787

HSP 2 Score: 117.472 bits (293), Expect = 3.6138e-26
Identity = 101/317 (31.86%), Postives = 139/317 (43.85%), Query Frame = 1
Query: 2770 CDGCMKRP-CKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACF-GQPCRNGGICKNI-DNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGIC----------------------------------------QSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCE-------QPAWK-PTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQY 3567
CD CMK P CKH G C + C C+ + G+ C+ +N C PC+NGGIC+N+ Y+C+CP GF G C ID C + C G C+ + + C+C + GK CD S CD N C+N G C QS DYKC+C G+ GK C++ I++C N CK+ C D NDYKC C + GK CE QP + V Y + ++G+ EI ++ C+ + CLN C + NQ YC C F G C++
Sbjct: 275 CDECMKYPGCKH-GTC---VDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQ-NSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTG-YTGTNCEIY-KTGCSPNPCLNGAYCY----TINQDFYCHCNKEFWGKRCEH 578

HSP 3 Score: 114.775 bits (286), Expect = 2.2556e-25
Identity = 99/313 (31.63%), Postives = 145/313 (46.33%), Query Frame = 1
Query: 2707 HSKPTDFICSEETEDAYITAK------CDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCIN-GECV----DLRNSYSCKCQNGFRGKYCDI-KFSYCDDINPCKNDGICQSLPN-NDYKCVCSKGWEGKEC---NQNIDDCKY-NTCKHEAKCVDL-HNDYKCLCRPGYVGKYCEQPAWKPTSKPVSR-----RYINESAVMIHSG--SENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYL 3570
HS+P + +E E AY G C G C + C C F G +CE I+ C PC+NGGIC ID+ N+EC+C GF G C D C+ C+N G C+ +L N + C+C+N + G+ C + K S CD NPC N G C L N ++C C++GW G C + + C+ N CK+E C+++ +ND+ C C+PG+ GK+C+ + P +N + G N ++ CA C ICV+ + CRC G G LC ++
Sbjct: 578 HSRP--YCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC--IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDS-NPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVD----RIDDFECRCPEGRDGKLCDHV 881

HSP 4 Score: 101.679 bits (252), Expect = 2.37102e-21
Identity = 76/219 (34.70%), Postives = 115/219 (52.51%), Query Frame = 1
Query: 2773 DGCMKRPCKHNGKC---SLITHHNYQCDCQYPFHGKNCE-NKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCT-LNIDDCVAHQ---CIN-GECVDL-RNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINE 3399
D C+K PC + G C S ++++ C+C+ + G+ C K + C PC NGG C + ++C C G+ G C L+ID + C N G C+++ N ++C C+ GF GK+CDI + C+ NPC N G C N+ Y+C+C+KG+ G C N D+C C + A CVD +D++C C G GK C+ + +P S Y N
Sbjct: 681 DYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNP-NPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNR 897

HSP 5 Score: 59.3066 bits (142), Expect = 2.05422e-08
Identity = 53/190 (27.89%), Postives = 75/190 (39.47%), Query Frame = 1
Query: 2785 KRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGE-CVDLRNSYSCK----------------------------------------CQNGF--RGK----------YCDIKFSYCDDINPCKNDGICQSLPNNDYKC 3195
K CK+ G C + ++++ C C+ F GK+C+ N C PC NGG C ID +Y C+C GF G C LN D+C + C G CVD + + C+ CQN RGK + ++ + DD CK +C S P N +C
Sbjct: 772 KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKC--IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRC 959
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006317 (SmedAsxldir_c107934_g5_i1|m.86273|m.14433)

HSP 1 Score: 130.954 bits (328), Expect = 4.1494e-30
Identity = 80/244 (32.79%), Postives = 115/244 (47.13%), Query Frame = 1
Query: 2728 ICSEETEDAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCING-ECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSL-------------------------------------PNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCE 3345
IC E + D C K C + G C + +C+C F G NCE +N C +PC+N C +++N +Y C CP G G C +NID+C + C+NG C D ++C+C GF G C+ K C + PCK + IC ++ NN+ KC+C G+EG+ C I++C N C+H ++C DL NDY C+C PG+ GK CE
Sbjct: 316 ICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGG-KCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCE 556

HSP 2 Score: 130.954 bits (328), Expect = 4.29179e-30
Identity = 93/268 (34.70%), Postives = 130/268 (48.51%), Query Frame = 1
Query: 2785 KRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGE-CVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYI-----NESAVMIHSG--SENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQ 3564
+ P NG + T +YQC C+ F+G+ CEN I C C+NGG C +D G+Y CVCP + G C C C NG C D Y C C N + GK CD + C INPCKN+G C+S+ DYKC+C +G+EGK C +ID+C+ +C + C+++ KC C PG+ G CE + +KP N+ G +N I+ C + CLN C + + C+C GF G C+
Sbjct: 181 ETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC--LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCK-INPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC----EDRVGGFTCQCLQGFVGLRCE 441

HSP 3 Score: 125.946 bits (315), Expect = 1.171e-28
Identity = 91/298 (30.54%), Postives = 135/298 (45.30%), Query Frame = 1
Query: 2782 MKRPCKHNGKC-SLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEA----------------KCVDLHNDYKCLCRPGYVGKYCE------QPAWKPTSKP--------------VSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQ 3564
+ + CKH+G C + ++C CQ + G CE I+ C QPC NGG C D G Y C C GF+G C +N ++C ++ C G+C+D N++SC C G G++C+ YC + C+N GIC+++ D++C C KG+ GK C +I++CKYN + +C+D + C C+ + GKYCE + K + P V R Y G E I+ C + C NNGIC + C C G G C+
Sbjct: 911 INKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECG--DGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKME-CQNGGICKNVI-GDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCE 1204

HSP 4 Score: 120.939 bits (302), Expect = 4.21738e-27
Identity = 93/306 (30.39%), Postives = 128/306 (41.83%), Query Frame = 1
Query: 2779 CMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCE---------------------------------------NKINAC--FGQP-CRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCIN-GECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDL-HNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQ 3564
C PC++ G C + H Y+C C + G NCE N I+ C + P C NGG C I+ G+Y+C C GF G +C +I DC C N G C+D SY C C N + G C+ K + C ++ PCKN GIC+ + DY+C+C W GK C+ + CK N CK+ C + + DYKC+C+ G+ GK+CE S C C N G C+N + C C PGF G+ C+
Sbjct: 99 CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLC-ELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCE-------------------------------TSIDNCQKISCFNGGSCINMIEG----GKCNCLPGFEGNNCE 365

HSP 5 Score: 114.775 bits (286), Expect = 3.10751e-25
Identity = 84/273 (30.77%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 2836 YQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCI-NGECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGIC------QSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAV---------------------MIHSGSENEIISESV--CAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQ 3564
++C C F G+ CE +IN C PC N C ID+ +Y+C+C GF G C +N +DC C+ +G+CVD N + CKC + G C+ CD NPC N G C Q+ P Y C C +G+ G C +D C+ N C C + +KC C Y+G+ CE + ++ NES + SG ++ CA C+N G C +G +C+C+PGF G CQ
Sbjct: 719 FRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDS-NPCLNKGSCINRKVNQNTPG--YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDG----TGMYFCKCQPGFQGVNCQ 982

HSP 6 Score: 109.768 bits (273), Expect = 1.10806e-23
Identity = 87/289 (30.10%), Postives = 124/289 (42.91%), Query Frame = 1
Query: 2806 GKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCING-----------------ECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDIN-----PCKNDGIC------QSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKC----VDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNS 3576
GKC + +N+ C C G+ CE ++ C C+NGGICKN+ G++EC CP GF G C +I++C + N EC+D ++ C C+ F GKYC+ + YC+ PC N+GIC + N ++ C+C G+ G+ C N C+ N CK+ C +D +KC C G G +CE Y+NE C +C NNG CVNG K+ C C G G C+ S
Sbjct: 996 GKC-IDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCE------------IDYVNE------------------CLSTKCYNNGSCVNGF----GKAICHCNKGSCGEKCEITGS 1247

HSP 7 Score: 107.842 bits (268), Expect = 3.76101e-23
Identity = 83/304 (27.30%), Postives = 142/304 (46.71%), Query Frame = 1
Query: 2779 CMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLG---FRGPKCTLNIDDCVAHQ--------------------CIN-GECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSG------------SENEIIS-----ESVCAYHECLNNGICVNGDQSKNQKSY-CRCKPGFSGHLCQ 3564
C PC NG+C + + ++C C P+ G C NK++ C C N IC + + +Y C C + G KC ++D+C + C+N +C++ S+ CKC + + G+ C+ + C + +N C +L + ++C C G+ G+ C I++C++N C ++AKC+D NDY+C+C+ G+ GK CE ++ ES+ + H +EN I + + C + CLN G C+N ++N Y C C+ GF+G C+
Sbjct: 562 CAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPC-RNGATCDNLADG-FRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE----------INDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE 852

HSP 8 Score: 53.5286 bits (127), Expect = 1.4449e-06
Identity = 38/124 (30.65%), Postives = 64/124 (51.61%), Query Frame = 1
Query: 2791 PCKHNGKC------SLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICK--NIDNFGNYECVCPLGFRGPKCTLN-IDDCVAHQCIN-GECVDLRNSYSCKCQNGFRGKYCDIKFSYCD 3132
PC +NG C + ++N+ C C + G+ C+ C C+N GIC+ ID+ +++C CP G G C ++ +++C++ +C N G CV+ C C G G+ C+I S C+
Sbjct: 1127 PCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACN 1250
BLAST of slit vs. Smed Unigenes AA
Match: SMU15037114 (dd_smedV4_13823_0_1|m.8312|m.39635)

HSP 1 Score: 121.709 bits (304), Expect = 1.81047e-27
Identity = 93/344 (27.03%), Postives = 146/344 (42.44%), Query Frame = 1
Query: 2590 PFHCDCNIKWLNQF--FHDKFLDNGISLCASP-EKMKLKSIFHSKPTDFICSEETEDAYITAKCDGCMKRPCKHNGKCSL-ITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCING-ECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNT-CKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICV-----------NGDQSK--NQKSYCRCKPGFSGHLCQ 3564
P C+C KW F + N ++C + E + +I ++ IC + A+ C+ C + GKC + + + Y CDC F+G C+ +C PC C D ++C CP GF G C ++ D+C + C+NG C+D + + C C GF G C + + C ++ C N C N C C+ GW G+ CNQNI++C N C + C+D Y+C C+ + G++C P + R+ C + C N+GIC+ N + K C+C PGF+G LC+
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERK----------------------CLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 643

HSP 2 Score: 119.783 bits (299), Expect = 6.32749e-27
Identity = 73/218 (33.49%), Postives = 104/218 (47.71%), Query Frame = 1
Query: 2776 GCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCING-ECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNI---------DDCKYNTCKHEAKC--------VDLHND---------YKCLCRPGYVGKYCEQ 3348
C PC N +C ++C C F G+NCE + C +PC NGG+C ID + CVCP+GF G +C +N +DC C+NG +C+D N C+C G+ G+ C+ + C PC N+GIC P + Y+C C W G+ CN I C N C++ C V++ N+ Y C C PG+ G CE+
Sbjct: 430 SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMC--IDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS-YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 644
BLAST of slit vs. Smed Unigenes AA
Match: SMU15036138 (SmedSxlregen_c89796_g1_i1|m.42552|m.12127)

HSP 1 Score: 100.908 bits (250), Expect = 2.12844e-21
Identity = 90/298 (30.20%), Postives = 132/298 (44.30%), Query Frame = 1
Query: 2755 YITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCIN-GECV--DLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKC-------VDLHN-DYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMI----------HSGSENEIISESVCAY-HECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQYLNSLY 3582
++ CD + PC +N C + + +++C C FHGK CE + C PC N G C I G + C+CP + G C LNI C +C N G C D+ + CKC GF G C+ + C+ N C +G C N+ +C C + G+ C + + DC+ N C + C DL + CLC G+ G++CE + S + N A +I +G E C +C N G+CV+G++ K C+C P G CQY N Y
Sbjct: 280 FVKTTCD--LLSPCFNNATCVNLEYDSFKCQCLRGFHGKRCEIP-DHCVDNPCLNDGTC--ISKKGRFYCMCPGEYSGRNCELNISKC--PKCENGGSCFTPDMGKNNFCKCLPGFIGHRCETPATKCETENQCLFEGSCFLNIKNEKQCFCPSIFNGRFC-EKLSDCR-NRCLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEFAHFCVQSLSPCK---NRGACLILNYDKYYCECQTGFHGEKCEMKNCIKDADCQNGGVCVSGERVK-----CKCSPSNIGEFCQYKNECY 560

HSP 2 Score: 69.707 bits (169), Expect = 1.03953e-11
Identity = 52/181 (28.73%), Postives = 80/181 (44.20%), Query Frame = 1
Query: 3025 HQCIN-GECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQPAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNGDQSKNQKSYCRCKPGFSGHLCQ 3564
+QC + G C N +C C + + G YC + CD ++PC N+ C +L + +KC C +G+ GK C + D C N C ++ C+ + C+C Y G+ CE ++ S C +C N G C D KN ++C+C PGF GH C+
Sbjct: 250 YQCSDRGFCEKDGNKINCLCVSPYYGPYCQFVKTTCDLLSPCFNNATCVNLEYDSFKCQCLRGFHGKRC-EIPDHCVDNPCLNDGTCISKKGRFYCMCPGEYSGRNCE-------------------------------LNISKCP--KCENGGSCFTPDMGKN--NFCKCLPGFIGHRCE 394

HSP 3 Score: 66.6254 bits (161), Expect = 9.9817e-11
Identity = 68/202 (33.66%), Postives = 93/202 (46.04%), Query Frame = 1
Query: 2794 CKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICK----NIDNFGNYE--CVCPLGFRGPKCTLNIDDCVAHQCIN--------GECVDLR-NSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCVCSKGWEGKECNQNIDDCKYNT-CKHEAKC-VDLHNDY-KCLCRPGYVGKYCE 3345
C G C L + QC C F+G+ CE K++ C + C NGG C N + E C+CP GF G C AH C+ G C+ L + Y C+CQ GF G+ C++K C C+N G+C S KC CS G+ C Q ++C N C KC D+ + KC C G++GK C+
Sbjct: 406 CLFEGSCFLNIKNEKQCFCPSIFNGRFCE-KLSDCRNR-CLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEF------AHFCVQSLSPCKNRGACLILNYDKYYCECQTGFHGEKCEMK--NCIKDADCQNGGVCVS--GERVKCKCSPSNIGEFC-QYKNECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACD 594

HSP 4 Score: 56.225 bits (134), Expect = 1.6135e-07
Identity = 51/160 (31.87%), Postives = 72/160 (45.00%), Query Frame = 1
Query: 2794 CKHNGKCSLITHHNYQ-------CDCQYPFHGKNCENKINACFGQ--PCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQ-CINGECVDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDY-KCVCSKGWEGKECNQNI 3240
C + G CSL+ + C C Y F+G+ CE + C PC+N G C I N+ Y C C GF G KC + +C+ C NG CKC G++C K + C C +G C++ + KC C++GW GK C+ I
Sbjct: 443 CLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEFA-HFCVQSLSPCKNRGACL-ILNYDKYYCECQTGFHGEKCEMK--NCIKDADCQNGGVCVSGERVKCKCSPSNIGEFCQYK-NECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACDIQI 597

HSP 5 Score: 55.0694 bits (131), Expect = 3.1138e-07
Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 1
Query: 2791 PCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINACFGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQC-INGEC-VDLRNSY-SCKCQNGFRGKYCDIK 3117
PCK+ G C ++ + Y C+CQ FHG+ CE K N C+NGG+C + + +C C G C + QC NG+C D+ + CKC G+ GK CDI+
Sbjct: 489 PCKNRGACLILNYDKYYCECQTGFHGEKCEMK-NCIKDADCQNGGVCVSGERV---KCKCSPSNIGEFCQYKNECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACDIQ 596
The following BLAST results are available for this feature:
BLAST of slit vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|11321571|ref|NP_003053.1|1.263660e-5330.95slit homolog 3 protein isoform 2 precursor [Homo s... [more]
gi|429836873|ref|NP_001258875.1|1.328150e-5230.84slit homolog 3 protein isoform 1 precursor [Homo s... [more]
gi|574281850|ref|NP_001276064.1|6.875680e-632.39slit homolog 2 protein isoform 2 precursor [Homo s... [more]
gi|574281382|ref|NP_001276065.1|6.989630e-632.42slit homolog 2 protein isoform 3 precursor [Homo s... [more]
gi|530376407|ref|XP_005248268.1|6.939700e-632.31PREDICTED: slit homolog 2 protein isoform X1 [Homo... [more]
back to top
BLAST of slit vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|33302576|sp|P24014|SLIT_DROME1.958930e-4432.18RecName: Full=Protein slit; Short=dSlit; Contains:... [more]
gi|341942041|sp|Q9WVB4|SLIT3_MOUSE1.616790e-4631.34RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|45477220|sp|O88280|SLIT3_RAT1.999830e-4631.21RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|311033528|sp|O75094|SLIT3_HUMAN3.435050e-5330.95RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|145559530|sp|O75093|SLIT1_HUMAN4.171720e-5030.40RecName: Full=Slit homolog 1 protein; Short=Slit-1... [more]
back to top
BLAST of slit vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136484|ref|NP_476729.1|3.668270e-4732.64slit, isoform B [Drosophila melanogaster][more]
gi|17136482|ref|NP_476728.1|3.179140e-4732.49slit, isoform A [Drosophila melanogaster][more]
gi|161077130|ref|NP_001097333.1|3.179140e-4732.49slit, isoform D [Drosophila melanogaster][more]
gi|17136480|ref|NP_476727.1|2.261300e-4532.18slit, isoform C [Drosophila melanogaster][more]
gi|161077132|ref|NP_001097334.1|2.261300e-4532.18slit, isoform E [Drosophila melanogaster][more]
back to top
BLAST of slit vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150367780.000000e+080.34dd_smedV4_12111_0_1|m.4973|m.1592[more]
SMU150061408.575070e-3130.08SmedAsxldir_c107649_g2_i1|m.84323|m.17798[more]
SMU150063174.149400e-3032.79SmedAsxldir_c107934_g5_i1|m.86273|m.14433[more]
SMU150371141.810470e-2727.03dd_smedV4_13823_0_1|m.8312|m.39635[more]
SMU150361382.128440e-2130.20SmedSxlregen_c89796_g1_i1|m.42552|m.12127[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_007744 ID=Gsp_007744|Name=slit|organism=Girardia sp.|type=mRNA|length=4900bp
TTTTCTTAATATTAACTTAAAAATATTAAATTTTCTTTAGTGGAAAATAT
GCTTATTATTTTCAAGGATATTACATATAAATTTTATTTACTTTTATTAT
TAACACTTTATTGTTTTTCATCAACAATATGGATCAATGATCCGTCTGAC
GAATCAGAGATTTGTCCAAATGGATGTCAATGTGAAAACTATTCAGTAGA
ATGTAAACATCGTTTATTTCCAAATGTTCCAATAATTTTACAAGAAAAAA
CCACAAGATTAAATCTCCTTGGTAATCGAATAAATGTGATTAGAAAATCA
GACTTTTTCAAATTGATCTATTTAAAAGTTTTACAACTGTCAAACAACAG
AATAACATCAATCGAACCAGGAGCCTTTGATAATTTGGTCAATCTGATCA
AACTGCGCCTAAACAGAAATCTTATTCAATATCTACCAGATGGACTGTTT
TCCAAGCTCAGCAAATTACAAAAATTAGATCTTCGAGATAATCAATTACA
ATGTATCAATGAAAACACATTCAATAAACTCACTATGCTCAAATATTTAC
TTCTAGAAGGCAACAAAATTTTTTGGATATCAGAATCAATATCGAAATTA
AAAAATTTAAAAGAATTGAGAATAAAGAAAAATAAATTGACTTGCAACTG
TCACCTCGCCTGGCTCAATTGGTTTATGAAACATCGACCAGATATATTTA
AACCAGATGTTCCTTCAGTTGTGTGTTCAGCACCATTTAGATTATCCGAC
ATACCTGTATACACTCTTAGTCCATATGAATTCCAGTGTGCAAGTGAAGA
TAAAACGAATTTAGAAAACATTTGTCAGCAAAATAAAAAGGTTTGTTCGA
AACAATGCAACTGTTCTAATGATGGAATTGTCAAATGTGTTGGTAAACAA
CTTTCAAATATTCCTCAAGATCTACCAGTAAATGTTGTTGAATTAGATCT
CAGTGATAATAATATCACAATTCTCCAGCAAGGCTATTTGTCTAAATATA
AAACCTTAAAGAAAATAAATTTGACCGGGAATGGAATGGTCGACATTGAA
CCCGGCGCATTCCTTGGATTACAGCAATTGACATCACTCTATCTTAATGC
AAACAAATTGAAAACCATCAGAAAAAATGCTTTCAGTGGACTGTCATCAC
TTATGTTTCTATTTCTACACGGCAATGAGATTGAATGTTTACCAGCTGAT
GCTTTCGAGGGTGTGAAAAAGCTTCATATACTACATCTATCAGAAAACAA
ATTGACGACCTTGAAAAGAGAAACATTCAATCCATTGATTAAACTTAGAT
TTTTATATATTGTAAATAATCCTTTAAATTGTGACTGCAGACTTGCATGG
ATTGTAGATTATATAAAAGGTAAAGAAAATAATGAACCAATTGCTTCATG
TCACTACCCGAGAAATATGCAGGGCCTAGCATTGAGATCATTGCAAACAT
ACAGTTTTCAATGTAACAACGAATTCGATTCGAAATACGAAACGCACAAT
GAAGAGTGCGTTCCAAAAGTTAGTTGTCCATTAAAATGCACTTGTACATC
AGATATTGTGAATTGTTCAAATACTGGTTTGAACGCTCTTCCTTCAAGCA
TTTTCCCATCAACTAAAACATTGATCATGTCACATAATAATCTGAACAAA
TTAACACCGATATATTCAGTTCACGAAGCACCGAATCTAATGAAATTGGA
TATGTCATTCAATCAAATTGAGAAACTTGATGCCGATGTGTTTTCCAGAA
GCACAAAATTAACAGAAATACATTTGAATTCAAACAAACTGAAATGTATC
AACAATGAAACTTTCAAAAATCTGAATGATTTACGAACTTTGCAACTGAG
TGACAATGAAATAAACTGTATAGTGGTGGATTCATTCAAAAACAATCTCA
ATTTAAAATATTTAATGCTCAATAGAAATCCATTCCACTGTAACTGTAAT
ATGAAATGGATGTCTGAATGGTCTAGAAATCACCACAGCACTCTTGGAAA
TCATCGACTGCCAACTTGTCAGTCTCCAAGTTTATTAAAAGGAACACCAA
TTACGCATTTAGATGAAAAATATTTTCTTTGCGATGGAAATGCTTCAATT
GATCAATCGTCTGAATCTTGCAGTGAAATTAGTTCTGCTGAAGCGTGTTG
TTCAATCGGAAGTGATGAATGTAAACAAATCAAAAAATGTCCATTGAAAT
GTAAATGCGAAATTACAAAAGTGGATTGTAGTGATATGCAATTGAAAGAA
ATTCCTCATGAAATACCATTAGATACAACTGAACTATATCTGGACAGAAA
TGATCTCAAAACTCTTAATGAAACATCATTTAAAAATTTAGTTTTTCTAA
AAACTCTAGTGCTAAGTTACAATGGCATAACGGAACTCAATAAGAATGTG
TTGACACCACTGAAAAATTTGGAAACACTAGTCCTTAGTTTTAATAAATT
GCAATGTATTCATCAGGATGCTTTCAAGGACTTAAAGAATCTAAAAGTAT
TAATACTGCAAAGCAACGATGTCTCAACAATTCCCTTTCAAGCTTTCAAT
GATTTGAACAATTTAAATAATATTGCTCTTGGACAAAATCCATTTCATTG
TGATTGTAATATCAAATGGCTTAATCAATTCTTCCATGACAAATTTCTTG
ATAATGGAATATCATTGTGTGCAAGTCCGGAAAAAATGAAATTGAAATCA
ATTTTTCATTCAAAACCAACTGATTTCATTTGTTCCGAAGAAACAGAAGA
TGCCTACATTACAGCAAAATGTGACGGATGCATGAAACGGCCTTGTAAAC
ATAATGGAAAATGTTCATTGATCACTCATCATAATTACCAATGCGATTGT
CAGTATCCTTTTCATGGAAAAAATTGTGAAAATAAAATAAATGCCTGTTT
TGGGCAACCGTGTCGAAACGGTGGAATTTGCAAAAATATTGATAATTTTG
GAAATTATGAATGTGTTTGTCCACTTGGGTTTCGTGGTCCTAAATGTACA
TTAAATATTGATGATTGCGTGGCTCATCAATGTATTAATGGAGAATGCGT
TGATCTAAGAAATAGCTACAGTTGTAAATGTCAAAATGGATTCAGAGGAA
AATATTGCGATATAAAATTTTCATATTGTGATGACATTAATCCTTGTAAA
AATGACGGAATTTGCCAATCACTTCCGAATAATGACTACAAATGTGTTTG
CTCAAAAGGATGGGAAGGCAAAGAATGTAACCAGAATATTGATGATTGTA
AATATAATACTTGCAAACATGAAGCAAAATGTGTCGATTTACATAATGAT
TATAAATGTTTATGTAGACCGGGTTATGTGGGAAAGTATTGTGAACAGCC
AGCATGGAAGCCGACATCAAAACCAGTATCACGAAGATATATTAATGAAA
GCGCCGTAATGATACACAGTGGTTCTGAAAACGAAATTATTTCAGAATCT
GTTTGTGCTTACCATGAATGCTTGAATAATGGAATATGTGTAAATGGAGA
TCAAAGTAAAAATCAAAAATCGTATTGTAGATGTAAACCAGGTTTCTCTG
GTCATTTATGCCAGTATTTGAATAGTTTATATTTTCATAAAAATTCCCAT
ATTGAAATTACTCCACCATCAAGAGGATTCTTAATGCCAAAAGGGAATAT
ATCTTTAAATTTTCTGACAAATTCTACTTCAGGTCTATTACTTTATCAAG
GATTCGATCAAACATATTTGGTAGTAAATCTTTATCAAGGTCATGTGAGG
ATAAGTTATAACCTTGGTGATAAAGTTGTTGGCCCGGAAGGCTATTCAAT
GGGCATGGTAAATGATAGCAAATTACAGAAGCTTCACATAGAAATAGTCG
GTGAAAATCTGACAATGTATTTAAATGGCCGAGTTCATTGTACATTGAAA
TCGAAATATATCAATTCTAATAGATATATGGCACTTGATACAGGAATTTT
TATTGGTGGAGCTCCAAATAAAATACTGCAATCTGCAATGACAAAATATC
ATATTGACACTGATTCAGAATTTATCGGTTGTATTGAATCGTTACTAATT
AATCAAAAGAGAATAGATTTCTCGAAATATTTATCTAGATCAATTAATGT
AAAACCGGGATGTGGAGATATATTGTCAACTGTAATTACATCAGATATGG
AAATACCATCAATCAATCAATATAGCACTAAATTTCAAATTCCAGTCACA
AGAAAAAAATTAAATAACGCTTGCAGGCGACCTGGAATTTGTAAAAATCA
AGGAATTTGTGAACCCATTCGCGGAAGCAAGAAGAAATTTAGATGTATTT
GTAAAAATGGATTCGTTGGTAAACGATGCAAAAAAAGAACATCAATGTGT
CATGGAACATTCACTGAAAACTTTATTGATGATCCTGACACTCTTGACAG
CTGTAAATCGATAGAAAAGTTTCAGTATCGATCATGTGTTGGAACATGCA
GTAATAATAAAATGCAATCTGATGTGAATAAAGGTTTCTTTCACAAACCA
ATCGATATCAGTTCATCTCGATGCTGTCAACCAACAAAATACAGTACTCA
TAAAATCCAATTCAAATGCAGAAAAGGACGAAAGTATTTTCGTGATGTAA
ATCTACCGAAAAATTGCAAATGTATCTCAAACTGCCAAAGTGATTAACTT
TTGGAAAGATTTACCTTGAAAATTTACCTTTTTTTCAAAAGGAAAAAACA
AACCGAAAAATATTATTTGTTGTTTTCTTTTTTTACAGTTTTCTTTTTAC
TCTAAATATTTGATTTATATTTTTCATCAGGATTTACAAGAAATTATTTG
TTTTCTCTAAATAATCTCATGAATTTCATATCTGTTTAACAATTTATTGG
CTTTATTTTTGTCAAATTTGTTTTTCTGCTTCATGCATCTTTGATTGTTT

Design Primers for slit

back to top

protein sequence

>Gsp_007744-protein ID=Gsp_007744-protein|Name=slit|organism=Girardia sp.|type=polypeptide|length=1533bp
MLIIFKDITYKFYLLLLLTLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDGLFSKLSKLQKLDLRDNQL
QCINENTFNKLTMLKYLLLEGNKIFWISESISKLKNLKELRIKKNKLTCN
CHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASE
DKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELD
LSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLN
ANKLKTIRKNAFSGLSSLMFLFLHGNEIECLPADAFEGVKKLHILHLSEN
KLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIAS
CHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCT
SDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKL
DMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQL
SDNEINCIVVDSFKNNLNLKYLMLNRNPFHCNCNMKWMSEWSRNHHSTLG
NHRLPTCQSPSLLKGTPITHLDEKYFLCDGNASIDQSSESCSEISSAEAC
CSIGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDR
NDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNK
LQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFH
CDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETE
DAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINAC
FGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGEC
VDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCV
CSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQ
PAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNG
DQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGN
ISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYS
MGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGI
FIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSIN
VKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKN
QGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLD
SCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYST
HKIQFKCRKGRKYFRDVNLPKNCKCISNCQSD*
back to top

coding sequence

>Gsp_007744.49.4647 ID=Gsp_007744.49.4647|Name=Gsp_007744.49.4647|organism=Girardia sp.|type=CDS|length=4599bp
ATGCTTATTATTTTCAAGGATATTACATATAAATTTTATTTACTTTTATT
ATTAACACTTTATTGTTTTTCATCAACAATATGGATCAATGATCCGTCTG
ACGAATCAGAGATTTGTCCAAATGGATGTCAATGTGAAAACTATTCAGTA
GAATGTAAACATCGTTTATTTCCAAATGTTCCAATAATTTTACAAGAAAA
AACCACAAGATTAAATCTCCTTGGTAATCGAATAAATGTGATTAGAAAAT
CAGACTTTTTCAAATTGATCTATTTAAAAGTTTTACAACTGTCAAACAAC
AGAATAACATCAATCGAACCAGGAGCCTTTGATAATTTGGTCAATCTGAT
CAAACTGCGCCTAAACAGAAATCTTATTCAATATCTACCAGATGGACTGT
TTTCCAAGCTCAGCAAATTACAAAAATTAGATCTTCGAGATAATCAATTA
CAATGTATCAATGAAAACACATTCAATAAACTCACTATGCTCAAATATTT
ACTTCTAGAAGGCAACAAAATTTTTTGGATATCAGAATCAATATCGAAAT
TAAAAAATTTAAAAGAATTGAGAATAAAGAAAAATAAATTGACTTGCAAC
TGTCACCTCGCCTGGCTCAATTGGTTTATGAAACATCGACCAGATATATT
TAAACCAGATGTTCCTTCAGTTGTGTGTTCAGCACCATTTAGATTATCCG
ACATACCTGTATACACTCTTAGTCCATATGAATTCCAGTGTGCAAGTGAA
GATAAAACGAATTTAGAAAACATTTGTCAGCAAAATAAAAAGGTTTGTTC
GAAACAATGCAACTGTTCTAATGATGGAATTGTCAAATGTGTTGGTAAAC
AACTTTCAAATATTCCTCAAGATCTACCAGTAAATGTTGTTGAATTAGAT
CTCAGTGATAATAATATCACAATTCTCCAGCAAGGCTATTTGTCTAAATA
TAAAACCTTAAAGAAAATAAATTTGACCGGGAATGGAATGGTCGACATTG
AACCCGGCGCATTCCTTGGATTACAGCAATTGACATCACTCTATCTTAAT
GCAAACAAATTGAAAACCATCAGAAAAAATGCTTTCAGTGGACTGTCATC
ACTTATGTTTCTATTTCTACACGGCAATGAGATTGAATGTTTACCAGCTG
ATGCTTTCGAGGGTGTGAAAAAGCTTCATATACTACATCTATCAGAAAAC
AAATTGACGACCTTGAAAAGAGAAACATTCAATCCATTGATTAAACTTAG
ATTTTTATATATTGTAAATAATCCTTTAAATTGTGACTGCAGACTTGCAT
GGATTGTAGATTATATAAAAGGTAAAGAAAATAATGAACCAATTGCTTCA
TGTCACTACCCGAGAAATATGCAGGGCCTAGCATTGAGATCATTGCAAAC
ATACAGTTTTCAATGTAACAACGAATTCGATTCGAAATACGAAACGCACA
ATGAAGAGTGCGTTCCAAAAGTTAGTTGTCCATTAAAATGCACTTGTACA
TCAGATATTGTGAATTGTTCAAATACTGGTTTGAACGCTCTTCCTTCAAG
CATTTTCCCATCAACTAAAACATTGATCATGTCACATAATAATCTGAACA
AATTAACACCGATATATTCAGTTCACGAAGCACCGAATCTAATGAAATTG
GATATGTCATTCAATCAAATTGAGAAACTTGATGCCGATGTGTTTTCCAG
AAGCACAAAATTAACAGAAATACATTTGAATTCAAACAAACTGAAATGTA
TCAACAATGAAACTTTCAAAAATCTGAATGATTTACGAACTTTGCAACTG
AGTGACAATGAAATAAACTGTATAGTGGTGGATTCATTCAAAAACAATCT
CAATTTAAAATATTTAATGCTCAATAGAAATCCATTCCACTGTAACTGTA
ATATGAAATGGATGTCTGAATGGTCTAGAAATCACCACAGCACTCTTGGA
AATCATCGACTGCCAACTTGTCAGTCTCCAAGTTTATTAAAAGGAACACC
AATTACGCATTTAGATGAAAAATATTTTCTTTGCGATGGAAATGCTTCAA
TTGATCAATCGTCTGAATCTTGCAGTGAAATTAGTTCTGCTGAAGCGTGT
TGTTCAATCGGAAGTGATGAATGTAAACAAATCAAAAAATGTCCATTGAA
ATGTAAATGCGAAATTACAAAAGTGGATTGTAGTGATATGCAATTGAAAG
AAATTCCTCATGAAATACCATTAGATACAACTGAACTATATCTGGACAGA
AATGATCTCAAAACTCTTAATGAAACATCATTTAAAAATTTAGTTTTTCT
AAAAACTCTAGTGCTAAGTTACAATGGCATAACGGAACTCAATAAGAATG
TGTTGACACCACTGAAAAATTTGGAAACACTAGTCCTTAGTTTTAATAAA
TTGCAATGTATTCATCAGGATGCTTTCAAGGACTTAAAGAATCTAAAAGT
ATTAATACTGCAAAGCAACGATGTCTCAACAATTCCCTTTCAAGCTTTCA
ATGATTTGAACAATTTAAATAATATTGCTCTTGGACAAAATCCATTTCAT
TGTGATTGTAATATCAAATGGCTTAATCAATTCTTCCATGACAAATTTCT
TGATAATGGAATATCATTGTGTGCAAGTCCGGAAAAAATGAAATTGAAAT
CAATTTTTCATTCAAAACCAACTGATTTCATTTGTTCCGAAGAAACAGAA
GATGCCTACATTACAGCAAAATGTGACGGATGCATGAAACGGCCTTGTAA
ACATAATGGAAAATGTTCATTGATCACTCATCATAATTACCAATGCGATT
GTCAGTATCCTTTTCATGGAAAAAATTGTGAAAATAAAATAAATGCCTGT
TTTGGGCAACCGTGTCGAAACGGTGGAATTTGCAAAAATATTGATAATTT
TGGAAATTATGAATGTGTTTGTCCACTTGGGTTTCGTGGTCCTAAATGTA
CATTAAATATTGATGATTGCGTGGCTCATCAATGTATTAATGGAGAATGC
GTTGATCTAAGAAATAGCTACAGTTGTAAATGTCAAAATGGATTCAGAGG
AAAATATTGCGATATAAAATTTTCATATTGTGATGACATTAATCCTTGTA
AAAATGACGGAATTTGCCAATCACTTCCGAATAATGACTACAAATGTGTT
TGCTCAAAAGGATGGGAAGGCAAAGAATGTAACCAGAATATTGATGATTG
TAAATATAATACTTGCAAACATGAAGCAAAATGTGTCGATTTACATAATG
ATTATAAATGTTTATGTAGACCGGGTTATGTGGGAAAGTATTGTGAACAG
CCAGCATGGAAGCCGACATCAAAACCAGTATCACGAAGATATATTAATGA
AAGCGCCGTAATGATACACAGTGGTTCTGAAAACGAAATTATTTCAGAAT
CTGTTTGTGCTTACCATGAATGCTTGAATAATGGAATATGTGTAAATGGA
GATCAAAGTAAAAATCAAAAATCGTATTGTAGATGTAAACCAGGTTTCTC
TGGTCATTTATGCCAGTATTTGAATAGTTTATATTTTCATAAAAATTCCC
ATATTGAAATTACTCCACCATCAAGAGGATTCTTAATGCCAAAAGGGAAT
ATATCTTTAAATTTTCTGACAAATTCTACTTCAGGTCTATTACTTTATCA
AGGATTCGATCAAACATATTTGGTAGTAAATCTTTATCAAGGTCATGTGA
GGATAAGTTATAACCTTGGTGATAAAGTTGTTGGCCCGGAAGGCTATTCA
ATGGGCATGGTAAATGATAGCAAATTACAGAAGCTTCACATAGAAATAGT
CGGTGAAAATCTGACAATGTATTTAAATGGCCGAGTTCATTGTACATTGA
AATCGAAATATATCAATTCTAATAGATATATGGCACTTGATACAGGAATT
TTTATTGGTGGAGCTCCAAATAAAATACTGCAATCTGCAATGACAAAATA
TCATATTGACACTGATTCAGAATTTATCGGTTGTATTGAATCGTTACTAA
TTAATCAAAAGAGAATAGATTTCTCGAAATATTTATCTAGATCAATTAAT
GTAAAACCGGGATGTGGAGATATATTGTCAACTGTAATTACATCAGATAT
GGAAATACCATCAATCAATCAATATAGCACTAAATTTCAAATTCCAGTCA
CAAGAAAAAAATTAAATAACGCTTGCAGGCGACCTGGAATTTGTAAAAAT
CAAGGAATTTGTGAACCCATTCGCGGAAGCAAGAAGAAATTTAGATGTAT
TTGTAAAAATGGATTCGTTGGTAAACGATGCAAAAAAAGAACATCAATGT
GTCATGGAACATTCACTGAAAACTTTATTGATGATCCTGACACTCTTGAC
AGCTGTAAATCGATAGAAAAGTTTCAGTATCGATCATGTGTTGGAACATG
CAGTAATAATAAAATGCAATCTGATGTGAATAAAGGTTTCTTTCACAAAC
CAATCGATATCAGTTCATCTCGATGCTGTCAACCAACAAAATACAGTACT
CATAAAATCCAATTCAAATGCAGAAAAGGACGAAAGTATTTTCGTGATGT
AAATCTACCGAAAAATTGCAAATGTATCTCAAACTGCCAAAGTGATTAA
back to top
Gene Groups
slit is similar in sequence to the genes of this group: GG9051
Gene NameGene ID
SMU15036778SMU15036778
slitDdo_016416
slitGsp_007744
slitPgr_016847
slitPmo_017648

Gene Group Protein Sequences

>SMU15036778

MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQL
QCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCN
CHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASE
DKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELD
LKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLN
ENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSEN
KLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETNTPVAA
CLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCS
SDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKL
DLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQL
SENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLG
NHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTC
CSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDR
NHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNK
LQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFH
CDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETE
DAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINAC
FGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGAT
CNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKC
VCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCE
IPAWKPTVLKTLISRRDINQSEMTYENLENEVISESVCAYHECLNNGICI
NGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPR
GNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEG
YSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDT
GIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKS
INVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGIC
KNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDS
QGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKY
STHEIQFKCENGRVYRRAANLPKNCKCVANCLND*
>Ddo_016416 slit
DKMQFIFKDITYKSYLILLLSLYCFSSTIWINDPSEEVEICPKGCQCENF
SVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLS
NNRISSIESGAFDNLINLIKLRLNRNLIQHLPDHLFSKLSKLQKLDLREN
QLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLH
CNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA
NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQN
NSITILRQGFLSKYKLLKKIILTQNGMVDIEPGAFIGLQQLTALYLNMNN
LRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLS
ALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCV
GPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSE
IVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDL
SNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLND
NHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSL
RLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL
DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLK
TLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCI
HQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCN
IKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYI
TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQP
CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQ
VNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTK
GWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAW
KPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNED
MNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNIS
LKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMD
VVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFI
GGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVK
PGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNN
GVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDN
CLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTH
KIQFKCDNGRFYRRSVTLPRSCKCQGNCHRI*
>Gsp_007744 slit
MLIIFKDITYKFYLLLLLTLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDGLFSKLSKLQKLDLRDNQL
QCINENTFNKLTMLKYLLLEGNKIFWISESISKLKNLKELRIKKNKLTCN
CHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASE
DKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELD
LSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLN
ANKLKTIRKNAFSGLSSLMFLFLHGNEIECLPADAFEGVKKLHILHLSEN
KLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIAS
CHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCT
SDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKL
DMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQL
SDNEINCIVVDSFKNNLNLKYLMLNRNPFHCNCNMKWMSEWSRNHHSTLG
NHRLPTCQSPSLLKGTPITHLDEKYFLCDGNASIDQSSESCSEISSAEAC
CSIGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDR
NDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNK
LQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFH
CDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETE
DAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINAC
FGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGEC
VDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCV
CSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQ
PAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNG
DQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGN
ISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYS
MGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGI
FIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSIN
VKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKN
QGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLD
SCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYST
HKIQFKCRKGRKYFRDVNLPKNCKCISNCQSD*
>Pgr_016847 slit
MQTLNINIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSM
ECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNN
RITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQL
QCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCN
CHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASD
SKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELD
LHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLN
GNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSEN
KLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVA
SCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTC
TPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTNPSPLLSLPNLIK
IDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLK
LSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITL
GAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGSSDSEN
SCCSISKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYL
DRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSF
NKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNP
FHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEE
TDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRIN
ACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENG
ASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDY
RCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKL
CDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC
VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPR
GNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG
YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS
GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRA
VNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNG
GVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCL
SLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRI
EFKCDSGRQYFRVVHFVRRCKCLPNCTSK*
>Pmo_017648 slit
MCLYFLLYHDTMYSNMIDILRKIIIIMQKINLFFALLLLFFSICQSYSNT
WYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNR
INVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQ
YLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWI
AEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCA
TPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGI
VKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNS
NEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNND
IECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLN
CNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQDE
EAESESHDEDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVI
LSYNKLKEISNSSPLLALPNLIKIDLSYNEIDHIEADIFMKNSRLKEINL
NSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNR
NPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYF
LCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKV
DCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYN
GITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDV
ATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCA
SPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLI
THHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCP
VGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKF
TYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRN
NAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAG
KSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLD
SLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLS
VNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYL
DGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYF
IGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDL
QTVSSTPVSVSDVCSEPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCN
RKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSF
FHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNCT
SK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.