beta-catenin, Gsp_006976 (mRNA) Girardia sp.

Overview
Namebeta-catenin
Unique NameGsp_006976
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length3445
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of beta-catenin vs. RefSeq Human
Match: gi|578805678|ref|XP_006713048.1| (PREDICTED: catenin beta-1 isoform X3 [Homo sapiens])

HSP 1 Score: 441.425 bits (1134), Expect = 3.67074e-138
Identity = 293/752 (38.96%), Postives = 407/752 (54.12%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDI----CMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETN--RNAEFAIDI------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D+ WQQ YL DSGI+S + + S G + + D ++ + EW+ + + DI M ++ EGM S +D TN R AE + + D A AIP+L KL+NDED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ +DI EP IC LRH++SRH+EAE AQ ++ GL ++++ L H SH W LIKA +GLIRNLA+ P N P+RE+G ++ L+ RA D +T+ + +EEI+E GALH+LA+D + +I R +N ++ + LL++ +E+IQRV AG+L E++ ++ I T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ--FDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|4503131|ref|NP_001895.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 442.58 bits (1137), Expect = 7.40549e-138
Identity = 295/753 (39.18%), Postives = 410/753 (54.45%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDI----CMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETN--RNAEFAIDI------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D+ WQQ YL DSGI+S + + S G + + D ++ + EW+ + + DI M ++ EGM S +D TN R AE + + D A AIP+L KL+NDED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++ L H SH W LIKA +GLIRNLA+ P N P+RE+G ++ L+ RA D +T+ + +EEI+E GALH+LA+D + +I R +N ++ + LL++ +E+IQRV AG+L E++ ++ I T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ--FDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148227672|ref|NP_001091680.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 442.58 bits (1137), Expect = 7.40549e-138
Identity = 295/753 (39.18%), Postives = 410/753 (54.45%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDI----CMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETN--RNAEFAIDI------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D+ WQQ YL DSGI+S + + S G + + D ++ + EW+ + + DI M ++ EGM S +D TN R AE + + D A AIP+L KL+NDED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++ L H SH W LIKA +GLIRNLA+ P N P+RE+G ++ L+ RA D +T+ + +EEI+E GALH+LA+D + +I R +N ++ + LL++ +E+IQRV AG+L E++ ++ I T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ--FDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148233338|ref|NP_001091679.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 442.58 bits (1137), Expect = 7.40549e-138
Identity = 295/753 (39.18%), Postives = 410/753 (54.45%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDI----CMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETN--RNAEFAIDI------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D+ WQQ YL DSGI+S + + S G + + D ++ + EW+ + + DI M ++ EGM S +D TN R AE + + D A AIP+L KL+NDED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++ L H SH W LIKA +GLIRNLA+ P N P+RE+G ++ L+ RA D +T+ + +EEI+E GALH+LA+D + +I R +N ++ + LL++ +E+IQRV AG+L E++ ++ I T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ--FDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|530371928|ref|XP_005264943.1| (PREDICTED: catenin beta-1 isoform X1 [Homo sapiens])

HSP 1 Score: 442.58 bits (1137), Expect = 7.40549e-138
Identity = 295/753 (39.18%), Postives = 410/753 (54.45%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDI----CMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETN--RNAEFAIDI------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D+ WQQ YL DSGI+S + + S G + + D ++ + EW+ + + DI M ++ EGM S +D TN R AE + + D A AIP+L KL+NDED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++ L H SH W LIKA +GLIRNLA+ P N P+RE+G ++ L+ RA D +T+ + +EEI+E GALH+LA+D + +I R +N ++ + LL++ +E+IQRV AG+L E++ ++ I T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ--FDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. uniprot
Match: gi|399056|sp|Q02453|ARM_MUSDO (RecName: Full=Armadillo segment polarity protein [Musca domestica])

HSP 1 Score: 466.077 bits (1198), Expect = 6.50247e-146
Identity = 302/786 (38.42%), Postives = 427/786 (54.33%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL+DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L S P S RL+ NCLWTLRNLSDAAT+++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH+++RH ++E AQ ++ GL ++++++ H P W LIKA IGL+RNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 5 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLVDSGIHSGAVTQAPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLAEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAITNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----------------------SNP--SPRLVQNCLWTLRNLSDAATKVDGLEPLLQSLVQVLAST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTTRHADSEMAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAAIGLVRNLALCPANAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTGSQQPAAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 673
BLAST of beta-catenin vs. uniprot
Match: gi|461856|sp|P35224|CTNB_URECA (RecName: Full=Catenin beta; AltName: Full=Beta-catenin [Urechis caupo])

HSP 1 Score: 466.077 bits (1198), Expect = 6.93013e-146
Identity = 308/763 (40.37%), Postives = 426/763 (55.83%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINS-AIEXXXXXXXXXXGYDDMDSE------------DQNKNIKEWKYSS----NTNINDGLSNDI-CMLTPDTPGSSSCLRHGGE---GMADVSLSACYDNKEETNRNAEFAI------DIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDKL----LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D T WQQNQY+ DSGI S A SVSSKHG DDMD+ DQ + + + N +N S + + P+T L G + D E ++ + A+ D A AIP+L KL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ AM E R AG ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SY YEKLLWT +RVLKVLSVC++NKP I+ G S P + H SQRL+ NCLWTLRNLSDAAT+ + + LL++LVQ+L A N D N++TCAAGILSNLTCNNQ NK+T ++GG+EA++RTI +DI EP +C LRH++SRH EAE AQ ++ LH+ GL +L++++ H P W LIKA++GLIRNLA+ P N P+RE G ++ L+ RA D + S + + +EEI+E + GALH++A++ R+ I R +N + + A LL++ +++IQRV AG+L E++A++ G E+ I Q T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 33 DAKQQTMLWQQNQYMGDSGIQSGATTQAPPSVSSKHGLDDMDTGEGMDTSRMMFDFDQGFSTQAFTQEQVDEMNQQLNQTRSQRVRAAMFPET------LEEGVQIPSTQLDPGQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATRAIPELTKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHRQGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLLLQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLKVLSVCASNKPAIVEAG--------------------SAGPSM------HLGHQSQRLVQNCLWTLRNLSDAATKSSDIEGLLQMLVQLL--ASN---------DINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTI----------------LQAGDREDITEPAVCALRHLTSRHGEAEMAQNAVRLHY-GLPVLVKLL-------------HPP-----------SRWPLIKAVVGLIRNLALCPANHAPLREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAYVDGVRMEEIVEGTVGALHIMAREAHNRAVI-------RGLN---------CISLFAQLLYSPIDNIQRVAAGVLCELAADKEGAEM-IEQEGTTAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 693
BLAST of beta-catenin vs. uniprot
Match: gi|221222436|sp|Q29I35|ARM_DROPS (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 465.692 bits (1197), Expect = 1.31693e-145
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRA----------------LIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. uniprot
Match: gi|114162|sp|P18824|ARM_DROME (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 466.077 bits (1198), Expect = 1.45274e-145
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. uniprot
Match: gi|117608|sp|P26233|CTNB_XENLA (RecName: Full=Catenin beta; AltName: Full=Beta-catenin [Xenopus laevis])

HSP 1 Score: 447.973 bits (1151), Expect = 1.74998e-139
Identity = 300/753 (39.84%), Postives = 415/753 (55.11%), Query Frame = 3
Query:  228 DKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDI----CMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETN--RNAEFAIDI------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
D+ WQQ YL DSGI+S + + S+S K +D D D N+ + EW+ + + DI M ++ EGM S +D+ TN R AE + + D A AIP+L KL+NDED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++ L H SH W LIKA +GLIRNLA+ P N P+RE+G ++ L+ RA D +T+ + +EEI+E GALH+LA+D I +I R +N ++ + LL++ +E+IQRV AG+L +V+ ++ I T L+E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDEDV-DTNQVLYEWEQGFSQSFTQDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ--FDSAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDS-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSIGGTQQQFVEGVRMEEIVEGCTGALHILARD-------IHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCDVAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45551205|ref|NP_726775.2| (armadillo, isoform C [Drosophila melanogaster])

HSP 1 Score: 465.307 bits (1196), Expect = 8.66051e-148
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRA----------------LIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|17136376|ref|NP_476666.1| (armadillo, isoform A [Drosophila melanogaster])

HSP 1 Score: 466.077 bits (1198), Expect = 1.67698e-146
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|19549863|ref|NP_599100.1| (armadillo, isoform B [Drosophila melanogaster])

HSP 1 Score: 466.077 bits (1198), Expect = 1.67698e-146
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|24639204|ref|NP_476665.2| (armadillo, isoform D [Drosophila melanogaster])

HSP 1 Score: 466.077 bits (1198), Expect = 1.67698e-146
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45553932|ref|NP_996328.1| (armadillo, isoform E [Drosophila melanogaster])

HSP 1 Score: 466.077 bits (1198), Expect = 1.67698e-146
Identity = 302/786 (38.42%), Postives = 426/786 (54.20%), Query Frame = 3
Query:  189 NIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSA---------------IEXXXXXXXXXXGY---------DDMD---SEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGS-------SSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRY 2414
N N P ++ K T WQQN YL DSGI+S +E G+ DDM+ S+ +++ ++ + + +G+ P P + S L+H A V+L D+ E R AIP+LIKL+NDED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++I EP +C LRH++SRH ++E AQ ++ GL ++++++ H P W LIKA+IGLIRNLA+ P N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ R+ I QS + + LLFN +E+IQRV AG+L E++A++ G E II Q T L++++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPET--LEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15031548 (SmedSxlregen_c67076_g1_i1|m.10982|m.22691)

HSP 1 Score: 1696.02 bits (4391), Expect = 0
Identity = 870/956 (91.00%), Postives = 914/956 (95.61%), Query Frame = 3
Query:  171 MMNESMNIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSAIEXXXXXXXXXXGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSCLRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYTA-XXXXXXXXXXXXXXXXXXXXXXANQVSNPGYLNSILNSPIMHNQPSCVGHRHNSVTQCGDQNISTNET-CQINDVDVSDYHMTFSNTLQPQNRYSYASNYLDPNYSLLNQTVNPEISMRQHFKQLGPINISNECINQDIQKTFTNPSFKNPTSHQMPLTGNLCPSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSPINK* 3032
MMNESMNIVNSP DEFINDKTN+TR+WQQNQYLIDSGINSA+ESHSHSVSSKHGYDDMDSEDQ+KN+ EWKY SNTN NDGLSNDICMLTPDTPGS+SCLRHGGEGMADVSLSACYDNK+E NRN +F IDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNT +E +P VLP EN+ESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFN+FQRQS HIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPN PNK NQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRE+GFGWPMIVLINRAQIDLLNK +CA+ISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLIN+PQQIG QS+V+VIASLLFNHLESIQRVTAGLLVEVSAER+GLELIISQIVITNKL+EMVHSNNEAISTYASAILIRATEEKNKRY A + +PQNP+NLRNNLSISLPANQ +N GYLNSILNSPIMHNQP CV HRHNSVTQCGDQNI+TNET C INDVDV+DYHM FSNTLQPQNRY Y N++DPNYSL+NQT N EI+MR HFKQ+G INISNEC+NQD+QK ++N SFK+P+SH + ++GNLC SN+NSKK+MMDVCML+ADWIETCS+FSQGHSQKSWSPINK*
Sbjct: 1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMR-HFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK* 955
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15006664 (SmedAsxldir_c108529_g1_i1|m.90628|m.5971)

HSP 1 Score: 164.851 bits (416), Expect = 7.61742e-42
Identity = 159/583 (27.27%), Postives = 283/583 (48.54%), Query Frame = 3
Query:  675 SKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILH---FQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAM-SPCNFVPIREKGFGWPMIVLINRAQ--IDLLNKTACASISPKDKL-------LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSAERMGLELIISQIVITNKLSEMVHSNNEAISTYASAIL 2381
S + +D + K+++SC NK AE + ++ ++S+ + G I N IP L+ LL + ++ I+TL NL+ + + ++ +R+S I K+V + +N++K LT+ +CL L FN+ +K +L G ++ I++ Y YEKLL+ A+++LKVLSVC+ANKP+++ G M+AL ++L S RL+ + LW++RNLSD ++ + + LL+ L+++L + D + C+ G L NLT N NK+ F + GGV+A+ + I + +++ EP + LRH++ + A+ A I+ L +LIR PD ++P LIKAI+GL+RNL+M SP + + G + + R I L++ + +S +L L++++E++ AL LAKD + +++I++ ++ QS V ++ ++ + + R GLL E+ E I+ +LSE++HS N+AISTYA+ ++
Sbjct: 115 SDIEVVDGL--KKKIVSCK----NKNTKAECI----SSVQHISKGEQGATNIVNVNFIPILLDLLSSNDLKIVECVISTLDNLMYFVNQSRDIIRNSHGIEKLVEQMDRNDVKLLTVVLNCLHKLTFNNYEAKKTMLLSHGSEKVVQILRQYTYEKLLFAASKLLKVLSVCNANKPILVETGAMEALHSLLRSG-------------------------SPRLVLSSLWSIRNLSDYSSHIADMQKLLQKLIELLGSD-----------DEHTSICSMGCLCNLTSGNTENKLAFIEYGGVQAVCQLICERVG----------------QEEVVEPGVAALRHVTHNNHLAQQAIDIIIQSPLLSNLSVLIR-----GQPD--------KMLP------------LIKAIVGLLRNLSMISPQCRRSLIDLGITNSLCEIFYRTSKGISDLSQQRNSIVSVSSELSFIEGVRLDDLLELTLAALQALAKD----------NLAKKIISYENRL-LQSVVQMV--MIKENSVPLHRACLGLLAEM-VEYADCARILEGEGFNTRLSELIHSTNKAISTYAAIVM 596
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15040734 (dd_smedV4_9667_0_1|m.42039|m.41887)

HSP 1 Score: 66.2402 bits (160), Expect = 7.90652e-11
Identity = 95/399 (23.81%), Postives = 172/399 (43.11%), Query Frame = 3
Query:  762 EAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQK------NNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLI--HIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLW-----TLRNLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASIL--HFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNL 1913
+ + +++G + +S+ G +++ + N L+ +L +++V+FY+ITTLHN+LL V + CI ++ + K K L IC DCL L++++ K++I +H + +I +++ + EKLL ++LK+LS + K I L L+ + K +++ +W TLRNLSD + D KV +L F S + ++ CA GIL+N +C+ NK K +++IL+T+ ++ + + E L H+ S HE + L L II + D+ S I+ L+ I+WS+++A +GL+R+L
Sbjct: 156 QMLYWVSGCFHYISRTPFGCEMLLKNNS-DILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVKIQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFAILVLNLFKSKSK--------------------------MNSNVWLVMFLTLRNLSDILFQPKSD-FWKVYHDVLYQICLRFDEISCLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTLS-----------VTTDKFKLWSGETLEAMYRCLHHLCSNHERSLYVINKCLMSDMNFLTNASHIIILNSSKDI----SFANILSQS-LTDIPISWSILRAWLGLVRHL 510
The following BLAST results are available for this feature:
BLAST of beta-catenin vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|578805678|ref|XP_006713048.1|3.670740e-13838.96PREDICTED: catenin beta-1 isoform X3 [Homo sapiens... [more]
gi|4503131|ref|NP_001895.1|7.405490e-13839.18catenin beta-1 [Homo sapiens][more]
gi|148227672|ref|NP_001091680.1|7.405490e-13839.18catenin beta-1 [Homo sapiens][more]
gi|148233338|ref|NP_001091679.1|7.405490e-13839.18catenin beta-1 [Homo sapiens][more]
gi|530371928|ref|XP_005264943.1|7.405490e-13839.18PREDICTED: catenin beta-1 isoform X1 [Homo sapiens... [more]
back to top
BLAST of beta-catenin vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|399056|sp|Q02453|ARM_MUSDO6.502470e-14638.42RecName: Full=Armadillo segment polarity protein [... [more]
gi|461856|sp|P35224|CTNB_URECA6.930130e-14640.37RecName: Full=Catenin beta; AltName: Full=Beta-cat... [more]
gi|221222436|sp|Q29I35|ARM_DROPS1.316930e-14538.42RecName: Full=Armadillo segment polarity protein[more]
gi|114162|sp|P18824|ARM_DROME1.452740e-14538.42RecName: Full=Armadillo segment polarity protein[more]
gi|117608|sp|P26233|CTNB_XENLA1.749980e-13939.84RecName: Full=Catenin beta; AltName: Full=Beta-cat... [more]
back to top
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|45551205|ref|NP_726775.2|8.660510e-14838.42armadillo, isoform C [Drosophila melanogaster][more]
gi|17136376|ref|NP_476666.1|1.676980e-14638.42armadillo, isoform A [Drosophila melanogaster][more]
gi|19549863|ref|NP_599100.1|1.676980e-14638.42armadillo, isoform B [Drosophila melanogaster][more]
gi|24639204|ref|NP_476665.2|1.676980e-14638.42armadillo, isoform D [Drosophila melanogaster][more]
gi|45553932|ref|NP_996328.1|1.676980e-14638.42armadillo, isoform E [Drosophila melanogaster][more]
back to top
BLAST of beta-catenin vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 3
Match NameE-valueIdentityDescription
SMU150315480.000000e+091.00SmedSxlregen_c67076_g1_i1|m.10982|m.22691[more]
SMU150066647.617420e-4227.27SmedAsxldir_c108529_g1_i1|m.90628|m.5971[more]
SMU150407347.906520e-1123.81dd_smedV4_9667_0_1|m.42039|m.41887[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_006976 ID=Gsp_006976|Name=beta-catenin|organism=Girardia sp.|type=mRNA|length=3445bp
TTTTATTTTGCTTTCTTTCGTTAATAATAAATATTTATTAATTTAAATTT
ATCTTTACATATTATCGCAATTTTCAATGAAATAAAATTTTTAAAGGAAG
TATAACACTAAGCTAATCTAACATTTATAGCTCATTTGAAGTTTAATTTC
ATTGAATTATTGATATGTAAATGATGAACGAAAGTATGAATATTGTCAAT
TCTCCTCAGACAGATGAGTTTATCAATGATAAAACTAATTATACAAGATC
ATGGCAACAAAATCAGTATCTCATTGATTCTGGAATAAATTCAGCTATCG
AAAGTCATAGTCATAGTGTGAGTAGTAAACATGGATATGATGATATGGAT
TCAGAAGATCAAAATAAAAATATTAAAGAATGGAAATATTCTTCAAATAC
TAACATTAATGACGGATTATCAAATGATATATGCATGTTAACTCCAGATA
CTCCTGGAAGTTCTAGCTGTTTAAGGCATGGTGGAGAAGGTATGGCCGAT
GTTAGTCTGTCAGCATGCTATGACAATAAGGAAGAAACTAACAGAAATGC
TGAATTTGCAATCGATATTGATAAAATAGAAGCCGAAAGTGCGATCCCTG
ACTTAATAAAACTTATTAATGACGAAGACGATGCAGTCGTTATAAATGAA
GCTACTATGATGGTTTTTCAGTTGAGTAAAACTGATGCGATTGATGCAAT
TATAAATTCAAAAGAAATGATATCTTGCATGATTGAAGCTATGAATAAAG
CTGAACACGCCGAAGCTGTGAGATTTTTAGCTGGAGCCATATATAATATG
TCTCAGAAGAAAAATGGATTAAAGATTATTTTTGAAGCAAATGTCATACC
GTGCTTAGTAAAATTGCTTGGATTTTCTATGGAATCAGTTTTATTTTACG
CAATAACAACTTTACATAATTTATTGTTGTATCAAGATGGTGGGAAAGAA
GCAGTTCGATCAAGTGGTTGTATTCCTAAAATGGTAGCTTTATTACAAAA
AAATAACATCAAATTCTTAACGATATGTACTGATTGCTTGCAAATTTTAG
CTTTTAATCATCAACCAAGTAAATTAGAAATACTGAAGCATGGAGGTCCT
TTACATTTAATCCACATTATTAAAAGTTATGACTATGAAAAACTTTTGTG
GACTGCAACAAGAGTTTTAAAAGTTTTAAGTGTTTGTTCTGCGAATAAAC
CTGTTATAATAAGAGAAGGTGGAATGGATGCTTTAACAAACATCTTGTAT
CATACGATACAAAAGAATACAACCATCGAATCTTTTCCGCCAGTATTACC
AACAGAAAATAATGAATCATATCCACATTTTAGCCAGAGGCTTTTACACA
ATTGCTTATGGACTCTAAGAAATTTGTCTGATGCTGCTACAAGATTAAAT
TTTGATCATTTGCTTAAAGTTTTGGTTCAAATTCTTATGAATGCTTTTAA
TACATTTCAAAGACAAAGTACTCATATAGATACAAATGTGATAACTTGTG
CTGCGGGAATATTATCGAATTTGACTTGCAACAATCAATATAATAAAATT
ACATTTTTCAAATTAGGAGGAGTTGAAGCTATTTTGAGAACTATTGAATG
GAATTTAGCATTGACAAATCCTAATGTACCTAATAAAATAAATCAGAATA
ATTATTTTCCAGATGATATTTTTGAGCCATGCATATGTACTTTAAGGCAT
ATTTCAAGTCGTCATGAAGAAGCTGAAGCAGCCCAAGCGTCAATATTGCA
TTTTCAGGGCTTACAAATTTTAATTAGAATCATCGAAATGCAACTTGGAC
CTGATCTTTTTCATATGCAATCACATCAGCCAATAATGCCTAATCTTTTT
CTATCATATTACAAAATTAATTGGAGTCTCATTAAAGCAATCATTGGTCT
CATAAGAAATTTAGCTATGTCTCCTTGTAATTTCGTACCAATTCGTGAAA
AGGGTTTCGGATGGCCAATGATTGTTTTGATTAATCGAGCCCAAATAGAT
TTGTTAAATAAAACTGCTTGTGCTAGTATTTCGCCCAAAGATAAATTATT
AGAAGAAATTATAGAAGTGTCTTGTGGAGCTTTACATATGTTAGCTAAAG
ATCCGGGAATTCGTTCACAAATTATTTCAATGAAGATTTGGCAGCGATTA
ATTAACTTTCCTCAACAGATTGGCACTCAGTCTTCTGTGTTTGTAATTGC
TAGTTTGTTGTTTAATCACTTAGAATCAATTCAAAGAGTGACTGCTGGAC
TTCTAGTAGAAGTTTCAGCCGAACGAATGGGATTGGAATTAATTATTAGT
CAAATCGTGATTACGAATAAGCTAAGTGAAATGGTTCATTCAAATAATGA
GGCAATATCAACATATGCATCGGCTATTCTAATCAGAGCAACCGAAGAGA
AAAATAAAAGATATACGGCATCTCATAATTACAATGTTCCTCAGAATCCA
AATAATTTGAGAAATAATTTATCTATATCTTTGCCTGCTAATCAAGTTAG
TAATCCAGGATACTTGAATTCTATATTAAACTCGCCTATTATGCACAATC
AGCCATCTTGTGTAGGTCACAGACATAATTCGGTTACACAATGTGGTGAT
CAAAATATTTCTACCAATGAAACATGTCAAATTAATGACGTAGATGTTTC
AGATTATCATATGACCTTTTCTAATACTCTACAGCCACAAAATAGATATT
CATACGCCTCAAATTACTTGGATCCAAATTATAGTCTTCTAAATCAAACT
GTAAATCCGGAAATCTCGATGAGACAACATTTTAAGCAACTTGGTCCCAT
TAATATTTCAAATGAATGTATTAACCAAGACATACAAAAGACATTTACAA
ATCCAAGTTTCAAGAATCCTACATCTCATCAAATGCCACTTACTGGTAAT
TTGTGTCCATCAAATGACAACTCTAAAAAGGAAATGATGGATGTATGTAT
GTTAGAAGCAGACTGGATTGAAACATGCTCTGAATTTTCGCAAGGACATT
CACAAAAGTCTTGGTCTCCAATTAATAAATAATTTAAAATATTAATTGAA
ATTAATTTTGTTTATTAGTTTTGTTTCGTTATTATTTCGTAATTAAATTT
GTGATTTCGAATTCTATGTAAAGCATTTTGATATTAAAACGTCTCATGTG
CATGTTTGTAATTTTTAATAGAATAGTTTTGTACATGAAAATAAATATTA
CTTAAAGTACGCGTGTCTCGTTGTGCCTTGACATACTAGTTTTCGATATT
TTATCGTTATACAAATTTTGTATTGAAACAGATTATATGTAATTTCGATT
TCGGGAATGTTTTAAATGTCGCTTGTAAATAATTCTATGTATTAATTTAT
GTTATCATTTATTTAACATGTTTCTTTGACAATTTTTCATAATTTAGCTT
TGCTTACTAAATATATGAAAGTGTACTTTTTTGAAATTCTCTTTA

Design Primers for beta-catenin

back to top

protein sequence

>Gsp_006976-protein ID=Gsp_006976-protein|Name=beta-catenin|organism=Girardia sp.|type=polypeptide|length=954bp
MMNESMNIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSAIESHSHSV
SSKHGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSC
LRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNVPNKINQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPM
IVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSA
ERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYTA
SHNYNVPQNPNNLRNNLSISLPANQVSNPGYLNSILNSPIMHNQPSCVGH
RHNSVTQCGDQNISTNETCQINDVDVSDYHMTFSNTLQPQNRYSYASNYL
DPNYSLLNQTVNPEISMRQHFKQLGPINISNECINQDIQKTFTNPSFKNP
TSHQMPLTGNLCPSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSP
INK*
back to top

coding sequence

>Gsp_006976.171.3032 ID=Gsp_006976.171.3032|Name=Gsp_006976.171.3032|organism=Girardia sp.|type=CDS|length=2862bp
ATGATGAACGAAAGTATGAATATTGTCAATTCTCCTCAGACAGATGAGTT
TATCAATGATAAAACTAATTATACAAGATCATGGCAACAAAATCAGTATC
TCATTGATTCTGGAATAAATTCAGCTATCGAAAGTCATAGTCATAGTGTG
AGTAGTAAACATGGATATGATGATATGGATTCAGAAGATCAAAATAAAAA
TATTAAAGAATGGAAATATTCTTCAAATACTAACATTAATGACGGATTAT
CAAATGATATATGCATGTTAACTCCAGATACTCCTGGAAGTTCTAGCTGT
TTAAGGCATGGTGGAGAAGGTATGGCCGATGTTAGTCTGTCAGCATGCTA
TGACAATAAGGAAGAAACTAACAGAAATGCTGAATTTGCAATCGATATTG
ATAAAATAGAAGCCGAAAGTGCGATCCCTGACTTAATAAAACTTATTAAT
GACGAAGACGATGCAGTCGTTATAAATGAAGCTACTATGATGGTTTTTCA
GTTGAGTAAAACTGATGCGATTGATGCAATTATAAATTCAAAAGAAATGA
TATCTTGCATGATTGAAGCTATGAATAAAGCTGAACACGCCGAAGCTGTG
AGATTTTTAGCTGGAGCCATATATAATATGTCTCAGAAGAAAAATGGATT
AAAGATTATTTTTGAAGCAAATGTCATACCGTGCTTAGTAAAATTGCTTG
GATTTTCTATGGAATCAGTTTTATTTTACGCAATAACAACTTTACATAAT
TTATTGTTGTATCAAGATGGTGGGAAAGAAGCAGTTCGATCAAGTGGTTG
TATTCCTAAAATGGTAGCTTTATTACAAAAAAATAACATCAAATTCTTAA
CGATATGTACTGATTGCTTGCAAATTTTAGCTTTTAATCATCAACCAAGT
AAATTAGAAATACTGAAGCATGGAGGTCCTTTACATTTAATCCACATTAT
TAAAAGTTATGACTATGAAAAACTTTTGTGGACTGCAACAAGAGTTTTAA
AAGTTTTAAGTGTTTGTTCTGCGAATAAACCTGTTATAATAAGAGAAGGT
GGAATGGATGCTTTAACAAACATCTTGTATCATACGATACAAAAGAATAC
AACCATCGAATCTTTTCCGCCAGTATTACCAACAGAAAATAATGAATCAT
ATCCACATTTTAGCCAGAGGCTTTTACACAATTGCTTATGGACTCTAAGA
AATTTGTCTGATGCTGCTACAAGATTAAATTTTGATCATTTGCTTAAAGT
TTTGGTTCAAATTCTTATGAATGCTTTTAATACATTTCAAAGACAAAGTA
CTCATATAGATACAAATGTGATAACTTGTGCTGCGGGAATATTATCGAAT
TTGACTTGCAACAATCAATATAATAAAATTACATTTTTCAAATTAGGAGG
AGTTGAAGCTATTTTGAGAACTATTGAATGGAATTTAGCATTGACAAATC
CTAATGTACCTAATAAAATAAATCAGAATAATTATTTTCCAGATGATATT
TTTGAGCCATGCATATGTACTTTAAGGCATATTTCAAGTCGTCATGAAGA
AGCTGAAGCAGCCCAAGCGTCAATATTGCATTTTCAGGGCTTACAAATTT
TAATTAGAATCATCGAAATGCAACTTGGACCTGATCTTTTTCATATGCAA
TCACATCAGCCAATAATGCCTAATCTTTTTCTATCATATTACAAAATTAA
TTGGAGTCTCATTAAAGCAATCATTGGTCTCATAAGAAATTTAGCTATGT
CTCCTTGTAATTTCGTACCAATTCGTGAAAAGGGTTTCGGATGGCCAATG
ATTGTTTTGATTAATCGAGCCCAAATAGATTTGTTAAATAAAACTGCTTG
TGCTAGTATTTCGCCCAAAGATAAATTATTAGAAGAAATTATAGAAGTGT
CTTGTGGAGCTTTACATATGTTAGCTAAAGATCCGGGAATTCGTTCACAA
ATTATTTCAATGAAGATTTGGCAGCGATTAATTAACTTTCCTCAACAGAT
TGGCACTCAGTCTTCTGTGTTTGTAATTGCTAGTTTGTTGTTTAATCACT
TAGAATCAATTCAAAGAGTGACTGCTGGACTTCTAGTAGAAGTTTCAGCC
GAACGAATGGGATTGGAATTAATTATTAGTCAAATCGTGATTACGAATAA
GCTAAGTGAAATGGTTCATTCAAATAATGAGGCAATATCAACATATGCAT
CGGCTATTCTAATCAGAGCAACCGAAGAGAAAAATAAAAGATATACGGCA
TCTCATAATTACAATGTTCCTCAGAATCCAAATAATTTGAGAAATAATTT
ATCTATATCTTTGCCTGCTAATCAAGTTAGTAATCCAGGATACTTGAATT
CTATATTAAACTCGCCTATTATGCACAATCAGCCATCTTGTGTAGGTCAC
AGACATAATTCGGTTACACAATGTGGTGATCAAAATATTTCTACCAATGA
AACATGTCAAATTAATGACGTAGATGTTTCAGATTATCATATGACCTTTT
CTAATACTCTACAGCCACAAAATAGATATTCATACGCCTCAAATTACTTG
GATCCAAATTATAGTCTTCTAAATCAAACTGTAAATCCGGAAATCTCGAT
GAGACAACATTTTAAGCAACTTGGTCCCATTAATATTTCAAATGAATGTA
TTAACCAAGACATACAAAAGACATTTACAAATCCAAGTTTCAAGAATCCT
ACATCTCATCAAATGCCACTTACTGGTAATTTGTGTCCATCAAATGACAA
CTCTAAAAAGGAAATGATGGATGTATGTATGTTAGAAGCAGACTGGATTG
AAACATGCTCTGAATTTTCGCAAGGACATTCACAAAAGTCTTGGTCTCCA
ATTAATAAATAA
back to top
Gene Groups
beta-catenin is similar in sequence to the genes of this group: GG5233
Gene NameGene ID
SMU15031548SMU15031548
beta-cateninDdo_020132
beta-cateninGsp_006976
Pgr_020799Pgr_020799
beta-cateninPgr_027642
beta-cateninPmo_016711

Gene Group Protein Sequences

>SMU15031548

MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSV
SSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSC
LRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPM
IVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSA
ERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVA
PHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVS
HRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPN
FVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKS
PSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWS
PINK*
>Ddo_020132 beta-catenin
MMNESMNIVNSPQTDDFIIDKTTFTRSWQQNQYLIDSGINSALESHSHSV
SSKHGYDEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGSSG
CLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLI
SDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEA
VRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLH
NLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQP
SKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIRE
GGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTL
RNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILS
NLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPD
DIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFH
MQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCW
PMIVLINRAQIDLLNKNACSSISPKDKLLEEIIEVSCGALHMLAKDPGIR
AQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEV
SAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY
ASSHSYNVVPQNPNNLRNNLSISLPNNQNTNPGYLSSILNSPILHNQSPC
ISHRHNTVAQCGDQTVSNEPICQLNDVEVPDYHMNYSNTLQPQNRYPYNS
NYIDPNYSLINQPGNSDLTMRHFKQLGPINISNECVNQDVQKNFSNTSFK
SPSSHSLSLSGNLCSSSDNSKKEIMDVCMLDTDWIETCSEFSQGHSQKSW
SPINK*
>Gsp_006976 beta-catenin
MMNESMNIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSAIESHSHSV
SSKHGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSC
LRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNVPNKINQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPM
IVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSA
ERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYTA
SHNYNVPQNPNNLRNNLSISLPANQVSNPGYLNSILNSPIMHNQPSCVGH
RHNSVTQCGDQNISTNETCQINDVDVSDYHMTFSNTLQPQNRYSYASNYL
DPNYSLLNQTVNPEISMRQHFKQLGPINISNECINQDIQKTFTNPSFKNP
TSHQMPLTGNLCPSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSP
INK*
>Pgr_020799 Pgr_020799
MSEQMSAMNSPLSEDLINDKTMLTRAWQQNQYLVDSGINSAFETQTHSVS
SRNCCDEMESEDHNKTDWKCLSNINVHDNFLNDVCMLTPDSSSSNLCGRQ
RVDSVSETYSTLNCHITKSGFEKKISLEIDKNEAESAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSQEMISCIIGAMNKADHAETIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLY
QEGGKEAVRLNGCIPKLVTHLQKNNIKFLTICTDCLQILAFNHQPSKIEI
LNNGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHSVQRNSTSSSCQVEVSYEFDESHPQFSQRLLHNCLWTLRNLSD
AATRINFDDLLKILVQILMGSYNSFQKQNMHIDTNAVTCAAGILSNLTCN
NPFNKMALFKVGGVEALIRVIEWNYASLANPYHQNKMNANSNFSEDILEP
CICALRHLTSRHEEAESVQASLIQYQGLSILLRIIEMQLGPDLFHMQPNQ
AVMSNLFISYYEINWNLIKAIIGLIRNMGMSQCNFGFIREKGFVWPMVVL
INRAHIDSVNKNVSSSGTSKDKLLDEIIEVACGALHLLAKDPGIRTQIIS
IKLWQRFINCPQQVGIQSGIYVIASLLYSHLESIQRVAVGLLVELSADRM
ALEMIMSHMVINNKLNEMVHSKSEAVSTYVSAILIRFSEEKNKRYAQIHN
YNVALPNSSNTRTNLAVPLTNNPPNNSTGFLNSILHSPILHNQSTCIGHR
RMPSQCEDQNYINNELLVQINDMDVADIHMNLMSPEDNNRYSYNPNYADI
TCNVVNQPSSVDMRYFKQLSSICPGNENHIRDAVVPYSNATKGRLNNQNV
SNTMNIITTITDNSKMKVSMDMNMYDVDWGETCSEFSHTNSH*
>Pgr_027642 beta-catenin
MNEQMNIVNSPLSDDINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSS
RHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQG
GEAMADVNLTSGYDANKSECDKEFGLDIDKLEAESAIPDLIKLIKDEDDA
VVINGATRMVFQLSKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAG
TIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ
EGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEIL
KNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEAL
TNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDA
ATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNN
QYNKIALFKLGGVEALIRVIEWNFASLNNPNPPNKINSNNTFSEDILEPC
ICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQP
VTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLIN
RAQIDATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIK
LWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMAL
EMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRYTPCHNYN
APLQNSACSRPNLSIALSNNQSHNSPGFLNSILHSPVMHNQPPCVSHRHI
PSQCGDQNYINSELLGQIGDMDVSDMQMNYGPPMTPQTRYPYNPGYMDSG
GGCPSSGSSSGIQADMRYFKQTGDCHLQDTQKGGPYASKSKGKDSMDLCM
AEGPDWPDSGSDFSQAHSHKP*
>Pmo_016711 beta-catenin
MNEQMNIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVS
SRHGYDEMDSEDHNKKDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQ
GGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSNEMISCIIEAMNKAEHADAIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLY
QEGGKEAVRSSSCIPKLVTLLLKNNTKFLTICTDCLQILAFNHQPSKIEI
LKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSD
AATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCN
NQFNKIALFKLGGVEALIKVIEWNFASLNNPNAQNKNNSNNAFSEDILEP
CICALRHLTSRHEEAEAVQTALVQLQGLSLLIRLLEMQLGQDLYYMQTQQ
PVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLI
NRAQIDVANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIIS
IKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERM
ALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEKK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.