porcupine-like, Gsp_005554 (mRNA) Girardia sp.

Overview
Nameporcupine-like
Unique NameGsp_005554
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1722
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of porcupine-like vs. RefSeq Human
Match: gi|40548387|ref|NP_620154.2| (lysophospholipid acyltransferase 2 [Homo sapiens])

HSP 1 Score: 252.677 bits (644), Expect = 6.2509e-75
Identity = 145/442 (32.81%), Postives = 233/442 (52.71%), Query Frame = 2
Query:  251 PLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN----------------DKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQL-YHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYF 1516
PLSN + +P+DQ+NF+VC L ++ R +K S IR ++ T G+ + LFC+G+ + L+QS +SY +++++ + + + +G++ V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R ++ + Q++ AV+++P +++ Y F GILAGP Y +Y +I G + ++ P + L + + L + P + +Q +I++ IS R KYYFAW++ +A + G G+ G D+NG W + N IE +S K+ +D WNI T WL+ + YER F TI F +SA WHG YPGYY+ FLT L T AR +R + R F + P L+L Y ++T I T +A++Y PF LL + L F+ +Y+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYF-IEPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450
BLAST of porcupine-like vs. RefSeq Human
Match: gi|122937404|ref|NP_001073949.1| (lysophospholipid acyltransferase 1 [Homo sapiens])

HSP 1 Score: 233.032 bits (593), Expect = 8.26101e-68
Identity = 146/453 (32.23%), Postives = 231/453 (50.99%), Query Frame = 2
Query:  233 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYW-CMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDKHI-------------------PCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 1519
GST L PLS ++GIP+DQ+NF+VC L+++ R P S ++R + T FGI V+FC+G+ +L + + Y +++ S + H +++ MG++ + H+ R++ + YG T D SGP+MI TQK+T+LAF + DG L + + + A+K P +++ Y F ++AGP N +K+YI KHI P + L ++ + LL + FP C D +H R+ + + + KYYFAW++ +A + G G+ G DKNG W + N + IE+ +S K+ ++ WNI T WL+ + Y+R P + T++ F +SA WHG YPGYY FLT L T AR VR + R FL + +Y T T LA++Y PF +L + + +K YF+
Sbjct: 16 GSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVT-ASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG--LGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC---NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFP--VTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFY 459
BLAST of porcupine-like vs. RefSeq Human
Match: gi|767913127|ref|XP_011508611.1| (PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Homo sapiens])

HSP 1 Score: 224.942 bits (572), Expect = 8.71996e-66
Identity = 126/386 (32.64%), Postives = 201/386 (52.07%), Query Frame = 2
Query:  251 PLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN----------------DKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCART 1351
PLSN + +P+DQ+NF+VC L ++ R +K S IR ++ T G+ + LFC+G+ + L+QS +SY +++++ + + + +G++ V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R ++ + Q++ AV+++P +++ Y F GILAGP Y +Y +I G + ++ P + L + + L + P + +Q +I++ IS R KYYFAW++ +A + G G+ G D+NG W + N IE +S K+ +D WNI T WL+ + YER F TI F +SA WHG YPGYY+ FLT L T AR
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARA 395
BLAST of porcupine-like vs. RefSeq Human
Match: gi|578811432|ref|XP_006715062.1| (PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Homo sapiens])

HSP 1 Score: 208.379 bits (529), Expect = 5.33549e-59
Identity = 134/435 (30.80%), Postives = 216/435 (49.66%), Query Frame = 2
Query:  287 INFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYW-CMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDKHI-------------------PCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 1519
+NF+VC L+++ R P S ++R + T FGI V+FC+G+ +L + + Y +++ S + H +++ MG++ + H+ R++ + YG T D SGP+MI TQK+T+LAF + DG L + + + A+K P +++ Y F ++AGP N +K+YI KHI P + L ++ + LL + FP C D +H R+ + + + KYYFAW++ +A + G G+ G DKNG W + N + IE+ +S K+ ++ WNI T WL+ + Y+R P + T++ F +SA WHG YPGYY FLT L T AR VR + R FL + +Y T T LA++Y PF +L + + +K YF+
Sbjct: 2 VNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVT-ASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG--LGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC---NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFP--VTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFY 427
BLAST of porcupine-like vs. RefSeq Human
Match: gi|767913132|ref|XP_011508613.1| (PREDICTED: lysophospholipid acyltransferase 2 isoform X3 [Homo sapiens])

HSP 1 Score: 181.03 bits (458), Expect = 3.81621e-50
Identity = 102/341 (29.91%), Postives = 174/341 (51.03%), Query Frame = 2
Query:  251 PLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN----------------DKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRE 1216
PLSN + +P+DQ+NF+VC L ++ R +K S IR ++ T G+ + LFC+G+ + L+QS +SY +++++ + + + +G++ V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R ++ + Q++ AV+++P +++ Y F GILAGP Y +Y +I G + ++ P + L + + L + P + +Q +I++ IS R KYYFAW++ +A + G G+ G D+NG W + N IE +S K+ +D WNI T WL+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKR 351
BLAST of porcupine-like vs. uniprot
Match: gi|82082193|sp|Q5ZKL6|MBOA2_CHICK (RecName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 273.092 bits (697), Expect = 2.57813e-82
Identity = 160/488 (32.79%), Postives = 254/488 (52.05%), Query Frame = 2
Query:  215 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN----------------DKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFRPII--NDKVNQMNFVFTKK 1615
M+ GST+L PLSN + +PVDQ+NF+VC L ++ R +K S IR ++ T G+ + LFC+G+ + ++QS +SY L++++ + + +G++ V + R++ +DYG Y+ D SGP+MI TQK+TSLAF + DG R N+ + Q+ AV+++P +++ Y F GILAGP Y +Y +I G + ++ P ++ L + + L + P + +++ R+ + +S R KYYFAW++ +A + G G+ G DKNG W + N IES +S K+ +D WNI T WL+ + YERA F TI F +SA WHG YPGYY+ FLT L T AR +R +IR F+ +P Y I+T + T +A++Y PF LL + F+ YF HI ++ +L + N + + V++KK
Sbjct: 1 MATSTTGSTLLQPLSNAVRLPVDQVNFVVCQLFALLAAIWFRTYLHSSKTSPFIRHVVATLLGLYLALFCFGWYALHFVIQSGISYYLMIIIGVENMHKYCFVFALGYLTVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAFEIHDGMFRKNEDLTPSQR---CLAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYQLQQSEANGKEDTKYEQTDPSPNIAVAQKLLICGLSLLFHMTITKTLPVEYNIDENFRATASWPVRVFYLYLSLMAARPKYYFAWTLADAINNAAGFGFRGYDKNGVTRWDLISNLRIQQIESSTSFKMFLDNWNIQTALWLKRVCYERAT-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAIRNNIRHYFVESPAVKLCYDIITWMTTQVAISYTVVPFVLLSVKPSFTFYSSCYFCLHIASILVLLVFPLKRTQKGNKQHESIQPVWSKK 484
BLAST of porcupine-like vs. uniprot
Match: gi|81879081|sp|Q8R3I2|MBOA2_MOUSE (RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 2; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=Lysophosphatidylcholine acyltransferase; Short=LPCAT; Short=Lyso-PC acyltransferase; AltName: Full=Lysophosphatidylcholine acyltransferase 4; Short=Lyso-PC acyltransferase 4; Short=mLPCAT4; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 254.988 bits (650), Expect = 1.93495e-75
Identity = 144/447 (32.21%), Postives = 233/447 (52.13%), Query Frame = 2
Query:  251 PLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGY------------NDKH---IPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAM 1537
PLSN + +P+DQ+NF+VC L ++ R +K S IR ++ T G+ + FC+G+ + L+QS +SY ++++ + + +G+++V + R++ +DYG Y+ D SGP+MI TQK+TSLA+ + DG R ++ + Q+ AV+++P +++ YT F GILAGP Y +Y +I G +++H P ++ L + + L ++ P + +Q + + +S R KYYFAW++ +A + G G+ G DKNG W + N IE +S K+ +D WNI T WL+ + YERA F TI F +SA WHG YPGYY+ FLT L T AR VR + R FL P Y ++T + T + ++Y PF LL + F+ +Y+ H+ ++
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMQQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGL---AVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSI 456
BLAST of porcupine-like vs. uniprot
Match: gi|124015157|sp|Q3T1J2|MBOA2_RAT (RecName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 253.447 bits (646), Expect = 7.97243e-75
Identity = 144/447 (32.21%), Postives = 230/447 (51.45%), Query Frame = 2
Query:  251 PLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIG---------------YNDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRM-HMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAM 1537
PLSN + +P+DQ+NF+VC L ++ R +K S IR ++ T G+ + FC+G+ + L+QS +SY ++++ + + +G+++V + R++ +DYG Y+ D SGP+MI TQK+TSLA+ + DG R ++ + Q+ AV+++P +++ YT F GILAGP Y +Y +I G + K P ++ L + + L ++ P + +Q + + +S R KYYFAW++ +A + G G+ G DKNG W + N IE +S K+ +D WNI T WL+ + YERA F T+ F +SA WHG YPGYY+ FLT L T AR VR + R F+ P Y I+T T + ++Y PF LL F++ +Y+ HI ++
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMHQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGL---AVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHMAQSGENGKEEQHGKAEPSPNAAVTEKLLVCGLSLLFHLTISSMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTVQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFVEPPQLKLFYDIITWAATQITISYTVVPFVLLSINPSFTFYRSWYYCLHICSI 456
BLAST of porcupine-like vs. uniprot
Match: gi|143811417|sp|Q6ZWT7|MBOA2_HUMAN (RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 2; AltName: Full=1-acylglycerophosphate O-acyltransferase; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=Lysophosphatidic acid acyltransferase; Short=LPAAT; Short=Lyso-PA acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 252.677 bits (644), Expect = 1.65627e-74
Identity = 145/442 (32.81%), Postives = 233/442 (52.71%), Query Frame = 2
Query:  251 PLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN----------------DKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQL-YHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYF 1516
PLSN + +P+DQ+NF+VC L ++ R +K S IR ++ T G+ + LFC+G+ + L+QS +SY +++++ + + + +G++ V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R ++ + Q++ AV+++P +++ Y F GILAGP Y +Y +I G + ++ P + L + + L + P + +Q +I++ IS R KYYFAW++ +A + G G+ G D+NG W + N IE +S K+ +D WNI T WL+ + YER F TI F +SA WHG YPGYY+ FLT L T AR +R + R F + P L+L Y ++T I T +A++Y PF LL + L F+ +Y+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYF-IEPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450
BLAST of porcupine-like vs. uniprot
Match: gi|81873769|sp|Q8BH98|MBOA1_MOUSE (RecName: Full=Lysophospholipid acyltransferase 1; Short=LPLAT 1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=1-acylglycerophosphoserine O-acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Lysophosphatidylserine acyltransferase; Short=LPSAT; Short=Lyso-PS acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 1; Short=O-acyltransferase domain-containing protein 1)

HSP 1 Score: 238.424 bits (607), Expect = 1.82945e-69
Identity = 141/451 (31.26%), Postives = 233/451 (51.66%), Query Frame = 2
Query:  233 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYW-CMGFMAVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDKHI-------------------PCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDY-QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 1519
GST L PLS ++GIP+DQ+NF+ C L ++ R P K S +R + T GI V+FC+G+ +L + + Y +++ S + H +++ MG++ + H+ R++ + YG T D SGP+MI TQK+T+LAF + DG L + + + AVK P +++ Y F ++AGP N +K+Y+ +HI P + LC++ + LL ++ FP F+ + + + R+ + + + KYYFAW++ +A + G G+ G D +G++ W + N + IE+ +S K+ ++ WNI T+ WL+ + YER P + T++ F +SA WHG YPGYY FLT T AR VR + R FL + Y ++T T LA++Y PF +L + + +K +FF
Sbjct: 15 GSTCLHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCY-GVMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG--LGRKAEDLSAEQHRLAVKAKPSLLEYLSYHLNFMSVIAGPC---NNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLPEPSPMGAVIQKLCVTLMSLLLFLTLSKSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGFNGMDTDGKSRWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVPWY-PTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQLAVSYTAAPFVMLAVEPTISLYKSVFFF 458
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|20129843|ref|NP_610546.1| (oysgedart, isoform A [Drosophila melanogaster])

HSP 1 Score: 285.419 bits (729), Expect = 8.22072e-86
Identity = 155/466 (33.26%), Postives = 254/466 (54.51%), Query Frame = 2
Query:  212 IMSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN-------DKHIPCAKKQL------SAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1555
I + Y GS L++++G+ VD +NF++C + ++ L L R P+KVS +R G+ FC+G Q ++ + YI++ +I V M ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG +G + + K + HA++K+P A+++F Y ++F ILAGP VFY +Y E++ GYN + ++ +K+++ + A+ + L+ A++ +F I+ + M M + M++ +R KYY AW + +A ++GLG+ G DK+G + W + N + ++ E ++++ ++ WN T RWLR L+YER P T++ F +SA WHGFYPGYY+ F T ++ ART R+ R F +T Y ILT + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 8 IENDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399947|ref|NP_001286265.1| (oysgedart, isoform B [Drosophila melanogaster])

HSP 1 Score: 285.419 bits (729), Expect = 8.22072e-86
Identity = 155/466 (33.26%), Postives = 254/466 (54.51%), Query Frame = 2
Query:  212 IMSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN-------DKHIPCAKKQL------SAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1555
I + Y GS L++++G+ VD +NF++C + ++ L L R P+KVS +R G+ FC+G Q ++ + YI++ +I V M ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG +G + + K + HA++K+P A+++F Y ++F ILAGP VFY +Y E++ GYN + ++ +K+++ + A+ + L+ A++ +F I+ + M M + M++ +R KYY AW + +A ++GLG+ G DK+G + W + N + ++ E ++++ ++ WN T RWLR L+YER P T++ F +SA WHGFYPGYY+ F T ++ ART R+ R F +T Y ILT + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 8 IENDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399951|ref|NP_001286267.1| (oysgedart, isoform E [Drosophila melanogaster])

HSP 1 Score: 285.419 bits (729), Expect = 8.22072e-86
Identity = 155/466 (33.26%), Postives = 254/466 (54.51%), Query Frame = 2
Query:  212 IMSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN-------DKHIPCAKKQL------SAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1555
I + Y GS L++++G+ VD +NF++C + ++ L L R P+KVS +R G+ FC+G Q ++ + YI++ +I V M ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG +G + + K + HA++K+P A+++F Y ++F ILAGP VFY +Y E++ GYN + ++ +K+++ + A+ + L+ A++ +F I+ + M M + M++ +R KYY AW + +A ++GLG+ G DK+G + W + N + ++ E ++++ ++ WN T RWLR L+YER P T++ F +SA WHGFYPGYY+ F T ++ ART R+ R F +T Y ILT + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 8 IENDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399949|ref|NP_001286266.1| (oysgedart, isoform D [Drosophila melanogaster])

HSP 1 Score: 272.707 bits (696), Expect = 2.63643e-81
Identity = 148/443 (33.41%), Postives = 241/443 (54.40%), Query Frame = 2
Query:  281 DQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYN-------DKHIPCAKKQL------SAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1555
D +NF++C + ++ L L R P+KVS +R G+ FC+G Q ++ + YI++ +I V M ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG +G + + K + HA++K+P A+++F Y ++F ILAGP VFY +Y E++ GYN + ++ +K+++ + A+ + L+ A++ +F I+ + M M + M++ +R KYY AW + +A ++GLG+ G DK+G + W + N + ++ E ++++ ++ WN T RWLR L+YER P T++ F +SA WHGFYPGYY+ F T ++ ART R+ R F +T Y ILT + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 11 DLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 451
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|24666648|ref|NP_524157.2| (nessy, isoform A [Drosophila melanogaster])

HSP 1 Score: 105.145 bits (261), Expect = 1.47076e-23
Identity = 82/370 (22.16%), Postives = 163/370 (44.05%), Query Frame = 2
Query:  242 ILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWC--MGFMAVVHLYRMHYDYGGYTLDI--SGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDKH---IPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVS----AFWHGFYPGYYMMFL 1318
++ +++ +G+PV+ + ++ L + L + KF + + G + F YG + L+ +Y L+LLL K L + M ++ + + Y DY DI + P I ++ F++ DG + + K+ + A+KK P ++ ++++ G L GP + YK ++ G +H + ++ A A + ++ P + + ++ ++ +RI KY W + E + GL Y G+DKNG+ +WS N +E+G++++ V +N++T +W+ + IY+R + + + A WHG++ GYYM FL
Sbjct: 13 LMDGIASGVGVPVEALRLLLTILAGYPVAALYQ-KFISVIADKTVHHMFFAGCGAGLCYFNYGLDTYHSLIAILTTYFLVLLLRKKTQIFLAINFVFHMSYLLLGYFYTSSNDY-----DILWTMPHCILVLRMIGYGFDITDGLKEESEL---SKDQKETALKKPPSLLELLAFSYFPSGFLVGPQFPFRRYKAFVDGEFRQHEGNVEAGVRRFGAG----AFYLIVCQVGLRYLPDSYFLTPEFAQVSFVKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGCSNVKLKLLETGNTMEHYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFLAVWHGYHSGYYMTFL 369
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15039044 (dd_smedV4_413_0_1|m.25695|m.4576)

HSP 1 Score: 939.488 bits (2427), Expect = 0
Identity = 443/483 (91.72%), Postives = 471/483 (97.52%), Query Frame = 2
Query:  215 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFRPIINDKVNQMNFVFTKKAHYRLQKLKNHLQRKL 1663
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQ+MR+KFPP+K+SG+ RG+IE FFGILIVLFC+GYQVKYLLLQSTVSY++LL LPS+ISAHLVTYWCM FMA+VHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHR+NQGIKL+Q+NHESHAVKKLPDAIKFFGYTFYFHG+LAGPFVFYNEYKEYI GY+DKHIPC+KKQLS+ALCLS IHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWS+VKNYDFMAIESGSSLK+LVDGWNISTTRWLRELIYERAPLFCRTI+VFTVSAFWHGFYPGYY+MFLTFSLFTFCARTVRKHIRPLF+V+PITLQLYH+LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGH+LAMF VLTLQFRPIINDKVN MN VFT+KA YR QKLK HLQ+KL
Sbjct: 1 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLLQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKL 483
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15001330 (Asxlregen_comp63653_c0_seq2|m.14305|m.9304)

HSP 1 Score: 347.821 bits (891), Expect = 7.028e-112
Identity = 194/475 (40.84%), Postives = 282/475 (59.37%), Query Frame = 2
Query:  215 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGY------NDKHIPCAKKQLSAAL------------CLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHM-TRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQL-YHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILA-MFFVLTLQFRPIIN 1576
MS FY GS I P+S+ +G+ VDQ NF+ C L++ G G + +K+S R +IE G+ + +FC+G Q+ +LL QS YI++ + +K + + + + + F++V HL RM+YDYGGYT+DI+GP+MIQTQKL+SLAFNL DG R+ + L + H HA+ K P ++FF Y FYFHGI+ GPFVF +Y +I G N+K +K S L CL + GLLT +V P F + + +Y + M + IM T++S FLVRQKYYFAWS+ + +GLG+ G + + + VKN+DF IE G+S K ++D WN+ T WLRE +Y+R P T+ VF S+ WHG+YPGYY+ F++ +LFT +R RK+IRP LV+ +L L Y +LT + LALNY PF LE Q W +F H+ + + + LT + P+ +
Sbjct: 1 MSNFYSGSKIFQPVSDAVGLTVDQFNFMFCQLVASGFGFIFSRYLNTDKISPTFRHIIELVCGVSLTIFCFGSQIWHLLGQSISVYIMMNAMSTKSARYFILGFVLLFLSVAHLARMYYDYGGYTMDITGPLMIQTQKLSSLAFNLHDGQRIKKNEPLRRDYHRKHALLKYPTLLEFFSYMFYFHGIMVGPFVFLADYLRFIEGRQEEVLDNEKEKEYFRKNKSTILAGWPEIGFYVKSCL--VFGLLTIFVQPHFDPDYFKTDEYLQSGMFYKYIMLTIVS-FLVRQKYYFAWSIGSMSNIFSGLGFSGFSEERKPIYDVVKNFDFFKIELGTSTKSIIDNWNVGTIYWLRECVYDRIPRAYGTLAVFVCSSIWHGYYPGYYLCFMSLALFTEASRAGRKYIRP--LVHKASLNLPYDVLTSLLGMLALNYCAIPFTQLEVQLTFYIWSKMFFIVHVGSVLLYFLTPKLAPLFS 470
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15028343 (SmedSxldir_c96028_g2_i3|m.38137|m.41744)

HSP 1 Score: 336.265 bits (861), Expect = 1.25698e-107
Identity = 179/454 (39.43%), Postives = 259/454 (57.05%), Query Frame = 2
Query:  215 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDK---------HIPCAKKQLSAALCLSAIH-------GLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHI 1528
MS F+ GS IL P S +G+ +DQ NF+ C + + G+G L K++ N + + E GIL+ LFC+G Q+ YLL QS Y+++ +L + + + + + + F++V H+ RM+YDYG YTLDI+GP+MIQTQKL+SLAFNL+DG R+ KL + H+ HA+ P ++FF YTFYFHG++ GPFVF +Y +I G D+ H K Q+ +A + H LL ++ P F F+ S ++ + +R + I+ FLVRQKYY AW+M L GLG+ G D+ + + VKN+ F E G+S K ++D WN+ T WLRE +Y+R P TI VFT SA WHG+YPGYY+ F + +L T AR R+ R F + L Y I T + LN+ PF LL+ + G + WK Y G +
Sbjct: 32 MSNFHSGSKILLPFSEAVGLKIDQFNFLFCQISACGIGYLFSRYLSRAKINPNYKHISEIILGILLTLFCFGLQIWYLLAQSISVYVMMNVLSVRKARYCILIFVLFFLSVAHIGRMYYDYGSYTLDITGPLMIQTQKLSSLAFNLMDGQRVKNKEKLRKDYHQVHAINHYPTVLEFFSYTFYFHGLMVGPFVFLGDYLRFIEGRQDELLINEDDKNHFKRNKFQILSAWPEISFHLFSLVCYSLLFFFIEPYFKPEFLLSDEFYQNGFFKRYLLMTITMFLVRQKYYIAWTMGSITNLFAGLGFSGFDEKQQPKYHIVKNFHFSRTEFGTSAKTMIDHWNVGTAIWLRECVYDRVPHSIGTITVFTCSAIWHGYYPGYYLAFASVALMTNAARCGRRLFRTYFHNAGLKLP-YDITTATMSMFCLNFSIIPFALLDIRKGFMVWKSLYILGPV 484
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15014228 (SmedAsxldir_c93263_g1_i1|m.32754|m.42353)

HSP 1 Score: 321.627 bits (823), Expect = 4.847e-102
Identity = 173/479 (36.12%), Postives = 269/479 (56.16%), Query Frame = 2
Query:  215 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGYNDKHIPCAKKQ----------LSAA------LCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDK-NGENNWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVN---PITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFRPIINDKVNQ 1591
MS+FY G PLS+ GI VDQ NF+ C + +G+ + K+ +S R G + LFC+G+Q+ +L + +SY ++ LP + S ++V + M ++AV HL R ++DYGGYTLDI+GP+M+ Q+L+ LAFNL DG ++ + KL + HAV + P ++FF Y F I+ GPF+FY++Y +I G ++ +K++ LS + I G L +V P F F + ++ + +++F +I L+RQ+YYFAWS+ A L +GLG+ G +K +G+ + + N+D IE ++K ++DGWN +WLRE IY RAP T VF SA WHGFYPGYY+ F+T +F +R R++IRP FLVN T + Y +LT + + A+NY PF LL + FW+ +YF GH+ ++ ++F P I +++Q
Sbjct: 19 MSKFYAGVRFFEPLSSKFGIHVDQFNFVFCMFAACLMGRQFQTKYSIKNISAEQRHRFAFLGGFTLALFCFGHQIMHLFIPPIISYCIMYFLPYQHSRYIVLLFAMSYLAVTHLARQYWDYGGYTLDITGPLMVLVQRLSILAFNLYDGDQIKKKRKLDFDDAIKHAVLEHPTPLQFFSYVINFQTIMIGPFIFYSDYLRFIEGREIEYAETSKEKEYFVVHRTSILSPEDVTKKYFIIMLICGGLHLFVFPFFQPTFYLTPEFGQYSFINKVIFMLIVSPLLRQQYYFAWSLTSACCLCSGLGFSGFNKISGKPEYKLIDNFDMRNIEMAKNMKAIIDGWNKPANQWLRECIYNRAPKKFATPAVFICSAIWHGFYPGYYLFFVTAGIFLEISRMARRYIRPYFLVNFGDGQTSKFYDVLTTLISMFAINYMSVPFVLLGLSKSIQFWRQFYFCGHLAVPALLILIRFLPKIRTRIHQ 497
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15003924 (SmedAsxldir_c103283_g3_i5|m.58037|m.44976)

HSP 1 Score: 90.1225 bits (222), Expect = 6.3554e-19
Identity = 112/466 (24.03%), Postives = 189/466 (40.56%), Query Frame = 2
Query:  347 FPPNKVSGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHLVTYWCMG---FMAVVHLYRMHYDYGGYTLDISGPVMIQ---TQKLTSLAFNLLDGHRLNQGIKLIQK--NHESHAVKKL----------PDAIKFFGYTFYFHGILAGPFVFYNEYKE----YIIGYNDKHIPCAKKQLSAALCLSAIHGLLTAYV-APQFPYI-FVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLG----------------YCGKDKNGEN---NWSRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFC-RTIMVFTVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHI------------------RPLFLVNPITLQLYHILTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQ 1558
F NK+ + + + FG+L V+ G V + L + +S I ++ K LV +C G F HL G+ S IQ T KL AF + D + +K++ E + ++ L D I F Y++ F G+L GP+ Y Y + Y +++I + +AA + AY+ A F +I + S ++ R +F + FF+ R + YFAW + E + G+G G + G++ ++ +N + E S++ + WN+S WL +Y R P+ RT + VSAFWHG +PGYY+ F+T L + K + +P L+ + ++F +Y F LLE S L++W +F H+L M ++++Q
Sbjct: 20 FISNKIQLSFKKYFMSLFGLLFVICVSGTAVWHSLFVTLIS-IGIIGFKLKHFHILVFIFCFGYLIFFRTCHLI-------GFNRPPSYSNAIQLVLTLKLVGAAFEIKDSLERERKLKILLNTIQMEDNEIEDLKLEIKYFNVKSDVIDLFTYSYCFIGLLTGPYFKYRVYLDCSQFSSTVYVNRYIEFWNRLKNAAF-------IGVAYLFASHFYFIEYAKSDEFYNRSFFYRFVFMSVMFFVFRMRMYFAWLISECVCMCAGMGAYPASSVPVPGHGPTNLKGMEPIGDSIAVSYDTTRNLNISGCEWAPSVRDGMRSWNMSVQYWLATFVYRRFPIKAYRTFVTMLVSAFWHGVHPGYYLSFMTIPLSLLAESALEKLVIGAAPTLSARIRNANGEWQPSMLIEKSFFIRWFYKMRVF-----DYCCMGFLLLEAGSTLMYWWSIWFSVHLL-MIVLISMQ 464
The following BLAST results are available for this feature:
BLAST of porcupine-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|40548387|ref|NP_620154.2|6.250900e-7532.81lysophospholipid acyltransferase 2 [Homo sapiens][more]
gi|122937404|ref|NP_001073949.1|8.261010e-6832.23lysophospholipid acyltransferase 1 [Homo sapiens][more]
gi|767913127|ref|XP_011508611.1|8.719960e-6632.64PREDICTED: lysophospholipid acyltransferase 2 isof... [more]
gi|578811432|ref|XP_006715062.1|5.335490e-5930.80PREDICTED: lysophospholipid acyltransferase 1 isof... [more]
gi|767913132|ref|XP_011508613.1|3.816210e-5029.91PREDICTED: lysophospholipid acyltransferase 2 isof... [more]
back to top
BLAST of porcupine-like vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|82082193|sp|Q5ZKL6|MBOA2_CHICK2.578130e-8232.79RecName: Full=Membrane-bound O-acyltransferase dom... [more]
gi|81879081|sp|Q8R3I2|MBOA2_MOUSE1.934950e-7532.21RecName: Full=Lysophospholipid acyltransferase 2; ... [more]
gi|124015157|sp|Q3T1J2|MBOA2_RAT7.972430e-7532.21RecName: Full=Membrane-bound O-acyltransferase dom... [more]
gi|143811417|sp|Q6ZWT7|MBOA2_HUMAN1.656270e-7432.81RecName: Full=Lysophospholipid acyltransferase 2; ... [more]
gi|81873769|sp|Q8BH98|MBOA1_MOUSE1.829450e-6931.26RecName: Full=Lysophospholipid acyltransferase 1; ... [more]
back to top
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|20129843|ref|NP_610546.1|8.220720e-8633.26oysgedart, isoform A [Drosophila melanogaster][more]
gi|665399947|ref|NP_001286265.1|8.220720e-8633.26oysgedart, isoform B [Drosophila melanogaster][more]
gi|665399951|ref|NP_001286267.1|8.220720e-8633.26oysgedart, isoform E [Drosophila melanogaster][more]
gi|665399949|ref|NP_001286266.1|2.636430e-8133.41oysgedart, isoform D [Drosophila melanogaster][more]
gi|24666648|ref|NP_524157.2|1.470760e-2322.16nessy, isoform A [Drosophila melanogaster][more]
back to top
BLAST of porcupine-like vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150390440.000000e+091.72dd_smedV4_413_0_1|m.25695|m.4576[more]
SMU150013307.028000e-11240.84Asxlregen_comp63653_c0_seq2|m.14305|m.9304[more]
SMU150283431.256980e-10739.43SmedSxldir_c96028_g2_i3|m.38137|m.41744[more]
SMU150142284.847000e-10236.12SmedAsxldir_c93263_g1_i1|m.32754|m.42353[more]
SMU150039246.355400e-1924.03SmedAsxldir_c103283_g3_i5|m.58037|m.44976[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_005554 ID=Gsp_005554|Name=porcupine-like|organism=Girardia sp.|type=mRNA|length=1722bp
GGTTAAATGATGTCTTTGTTTCGTAATTCCATAAAATGATAGTTTTCAAA
AATTACAACTTTATTATTGATTCAAATGAAACCAATAGAAAGCTAGTGGT
TCGATGTCATGTGAATCTGCATGCAGCCAATCATAATTTCATGATTCATT
AAAATATAATTTACATTTTAAAACAAATTAATCACTTTTGATTTTACGAC
AATTTTAGAGAATAATGTCTCAATTTTATGGTGGATCCACGATTTTGGCT
CCATTATCGAATGTTATGGGTATCCCAGTGGATCAAATAAATTTTATTGT
TTGCAGTTTATTATCAATTGGATTAGGTCAATTAATGAGATACAAATTTC
CTCCAAACAAAGTCTCTGGAAATATTAGAGGCCTAATTGAAACATTCTTT
GGAATTTTAATAGTACTTTTCTGTTACGGATATCAAGTGAAATATTTGTT
GCTACAATCTACTGTTTCGTATATTTTATTACTGCTGCTACCTTCAAAAA
TATCAGCACATCTAGTAACTTACTGGTGCATGGGATTTATGGCAGTGGTT
CATTTATACAGAATGCATTACGATTATGGTGGTTATACACTCGATATATC
AGGTCCAGTGATGATACAAACACAAAAGTTAACTAGTCTTGCATTTAATC
TTCTTGATGGACATCGACTAAATCAAGGAATAAAATTAATTCAGAAAAAT
CATGAATCTCATGCTGTGAAAAAGTTACCAGATGCCATAAAGTTTTTCGG
TTATACATTCTATTTTCACGGTATTTTAGCAGGTCCATTTGTATTCTATA
ACGAATATAAAGAATATATTATTGGTTATAATGACAAACATATTCCTTGT
GCAAAGAAGCAATTATCTGCAGCTTTGTGTCTATCAGCAATTCATGGTTT
ATTAACGGCGTACGTAGCACCACAATTTCCATACATATTTGTGTGCAGTA
CTGATTATCAACGAATGCATATGACTCGTCGAATAATGTTTACAATGATA
TCATTTTTTCTCGTTCGTCAAAAATATTATTTTGCATGGTCAATGGTTGA
AGCTGGAGCTCTTAGTACTGGTTTAGGATATTGTGGGAAGGATAAAAATG
GGGAAAATAATTGGTCTAGAGTAAAAAACTATGATTTTATGGCAATAGAA
AGTGGTAGCAGTTTGAAGATATTAGTTGACGGTTGGAATATTTCTACAAC
GAGATGGTTACGAGAACTGATTTATGAACGAGCTCCTCTATTTTGCAGAA
CAATAATGGTTTTTACAGTTAGTGCATTTTGGCATGGTTTTTATCCTGGT
TATTACATGATGTTTTTAACATTTTCTCTATTTACTTTTTGCGCAAGAAC
TGTAAGAAAACATATTCGACCCCTATTTCTAGTCAATCCAATAACTCTTC
AACTTTATCATATTTTAACAAAAATTTTTACTAATTTGGCTTTAAATTAT
GGACAGGGCCCATTTTATTTATTAGAATTCCAGTCAGGACTTTTGTTTTG
GAAACCTTATTACTTTTTTGGACATATTTTAGCAATGTTTTTTGTTCTTA
CTCTACAATTCCGGCCGATTATCAACGATAAAGTAAACCAAATGAATTTT
GTTTTCACTAAAAAAGCCCATTATCGGTTACAGAAATTGAAAAACCATTT
ACAAAGAAAATTGGGTTGAAAAAAGCCTATTGATTTTGATTATTATTTCT
ATAAAATAAATTTTGTTTTTTT

Design Primers for porcupine-like

back to top

protein sequence

>Gsp_005554-protein ID=Gsp_005554-protein|Name=porcupine-like|organism=Girardia sp.|type=polypeptide|length=485bp
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKV
SGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHL
VTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKE
YIIGYNDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVF
TVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHI
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFR
PIINDKVNQMNFVFTKKAHYRLQKLKNHLQRKLG*
back to top

coding sequence

>Gsp_005554.215.1669 ID=Gsp_005554.215.1669|Name=Gsp_005554.215.1669|organism=Girardia sp.|type=CDS|length=1455bp
ATGTCTCAATTTTATGGTGGATCCACGATTTTGGCTCCATTATCGAATGT
TATGGGTATCCCAGTGGATCAAATAAATTTTATTGTTTGCAGTTTATTAT
CAATTGGATTAGGTCAATTAATGAGATACAAATTTCCTCCAAACAAAGTC
TCTGGAAATATTAGAGGCCTAATTGAAACATTCTTTGGAATTTTAATAGT
ACTTTTCTGTTACGGATATCAAGTGAAATATTTGTTGCTACAATCTACTG
TTTCGTATATTTTATTACTGCTGCTACCTTCAAAAATATCAGCACATCTA
GTAACTTACTGGTGCATGGGATTTATGGCAGTGGTTCATTTATACAGAAT
GCATTACGATTATGGTGGTTATACACTCGATATATCAGGTCCAGTGATGA
TACAAACACAAAAGTTAACTAGTCTTGCATTTAATCTTCTTGATGGACAT
CGACTAAATCAAGGAATAAAATTAATTCAGAAAAATCATGAATCTCATGC
TGTGAAAAAGTTACCAGATGCCATAAAGTTTTTCGGTTATACATTCTATT
TTCACGGTATTTTAGCAGGTCCATTTGTATTCTATAACGAATATAAAGAA
TATATTATTGGTTATAATGACAAACATATTCCTTGTGCAAAGAAGCAATT
ATCTGCAGCTTTGTGTCTATCAGCAATTCATGGTTTATTAACGGCGTACG
TAGCACCACAATTTCCATACATATTTGTGTGCAGTACTGATTATCAACGA
ATGCATATGACTCGTCGAATAATGTTTACAATGATATCATTTTTTCTCGT
TCGTCAAAAATATTATTTTGCATGGTCAATGGTTGAAGCTGGAGCTCTTA
GTACTGGTTTAGGATATTGTGGGAAGGATAAAAATGGGGAAAATAATTGG
TCTAGAGTAAAAAACTATGATTTTATGGCAATAGAAAGTGGTAGCAGTTT
GAAGATATTAGTTGACGGTTGGAATATTTCTACAACGAGATGGTTACGAG
AACTGATTTATGAACGAGCTCCTCTATTTTGCAGAACAATAATGGTTTTT
ACAGTTAGTGCATTTTGGCATGGTTTTTATCCTGGTTATTACATGATGTT
TTTAACATTTTCTCTATTTACTTTTTGCGCAAGAACTGTAAGAAAACATA
TTCGACCCCTATTTCTAGTCAATCCAATAACTCTTCAACTTTATCATATT
TTAACAAAAATTTTTACTAATTTGGCTTTAAATTATGGACAGGGCCCATT
TTATTTATTAGAATTCCAGTCAGGACTTTTGTTTTGGAAACCTTATTACT
TTTTTGGACATATTTTAGCAATGTTTTTTGTTCTTACTCTACAATTCCGG
CCGATTATCAACGATAAAGTAAACCAAATGAATTTTGTTTTCACTAAAAA
AGCCCATTATCGGTTACAGAAATTGAAAAACCATTTACAAAGAAAATTGG
GTTGA
back to top
Gene Groups
porcupine-like is similar in sequence to the genes of this group: GG1535
Gene NameGene ID
SMU15039044SMU15039044
porcupine-likeDdo_022473
Ddo_027705Ddo_027705
porcupine-likeGsp_005554
Pgr_005179Pgr_005179
porcupine-likePgr_029656
Pmo_003187Pmo_003187
Pmo_015173Pmo_015173
Pmo_032921Pmo_032921

Gene Group Protein Sequences

>SMU15039044

MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKL
SGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHL
VTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RINQGIKLLQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKE
YITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
TVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHV
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR
PIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR*
>Ddo_022473 porcupine-like
MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKL
SGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHL
VTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKE
YIVGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNENGENDW
SKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
ATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINLQFYHF
VTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFR
PIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
>Ddo_027705 Ddo_027705
MGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQG
IKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGY
NDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR
RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKN
YDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAF
WHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIF
TNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHI
>Gsp_005554 porcupine-like
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKV
SGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHL
VTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKE
YIIGYNDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVF
TVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHI
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFR
PIINDKVNQMNFVFTKKAHYRLQKLKNHLQRKLG*
>Pgr_005179 Pgr_005179
MSKFYGGSRILSPLSDLFGIPVDQINFVVCSLVSILLGQIMRHVFPPKKT
SANVRGFIETGFGFLIVIFCYGGQIKYLFLQSMVAYVILMLLPPRIAAHL
VTYWSMGFLAVVHLYRMHFDYGGYTIDISGPVMIQTQKLTSLAFNLLDGY
RINKGIDLSQKYHEQHAVKKFPDALKYFSYLMYFHGIQVGPFMFYNEYKE
YLIGYGNKTIPCANKQIRAALCMSVIFGLLTAYVAPQFPYIFTCSVDYQR
MAMSRRIMFTMISFFLTRQKYYFAWTIVEVGSLSAGMGYGGKNENNENDW
SRVKNYNFMAIESGSSLKLITDGWNISTARWLRELVYERAPLFCRTLLVY
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFVANPVTLQLYHI
ITKIITNLSFNYGQAPFFLLEFQLGLVFWKPYYFFGHVIAISVILIFQVK
PIFNNRVGHVDVADLRKKGDHLISQAATVTKF*
>Pgr_029656 porcupine-like
MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKT
SANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHL
VTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW
RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYRE
YLTGYDIKAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDW
SRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVF
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHV
ITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVR
PIINDKVGQINFNLTKKANLNFLLLKERLLLKLQ*
>Pmo_003187 Pmo_003187
MSQFYGGSTILSPLSDIVGLPVDQINFVICGLLSILLGQLMRHVFPPNKI
SSNVRGLIETFFGVLIVIFCYGYQIKYLLLQSMISYIILLIMPPRVAAHL
VTFWSLGFMGVVHLYRIHFDYGGYTMDISGPVMIQTQKLSSLAFNLLDGY
RLNQGNQLNNKKHEAHAVKRIPNLFSYMSYLIYFHGIQAGPFIFYNEYEE
YLGGYDNQAIPCAKKQIRAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSIAEAGSLSAGLGYGGKNENLENDW
SRVKNYDFMAIESGSSLKVVTDGWNMSTTRWLRELVYERSPLFCRTLLVF
TVSAFWHGFYPGYYLMFGTFAIFTFCARTARKFIRPMFMTNPVTFQLYHI
VTKILTNLSLNYGQAPFYLLEFQSALLFWKPYYFFAHVITISIILIFQFR
PIINDKVGQINFRITKKANLNFLNFKQCLKIKLR*
>Pmo_015173 Pmo_015173
LLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFY
NEYKEYIIGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCS
TDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNEN
GENDWSKVKNYDFKAIESGNSLKVLVDGWNISTTRWLRELIYERAPLFCR
TILVFATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINL
QFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFLVL
TLRFRPIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
>Pmo_032921 Pmo_032921
MSNFYGGSTILNPLSNVLGIPVDQVNFVVCCLLSIVFGQMMRHLFPPRNT
SANVRGIIEASAGLLIVLFCYGNQVKYLLLQSMVAYVMLMVLPPRIAAHF
VTYWSMGFLAVVHLYRMHYDYGGYTIDISGPVMIQTQRLTCLAFNLLDGH
RINNGLPLSNERHKLHAVKKLPDAVKFFSYLMYFHGVQVGPFTFYSEYKE
YLIGYGNKSIPCAKQQIRSALCLSVIFGLLTAYVAPQFPYLFTCSIEYQR
MTMTRRIVFTMISFFLTRQKYYFAWSIVEVGSLSAGLGYGGKTENLENDW
SRIRNYDFKAIESGSCLKLITDGWNMSTARWLRELVYERSPLFCRTLLVY
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHI
ITKIITNLSFNYGQAPFFLLEFQLGLLFWKPYYFFGHVIAISAILIFQCR
PIFNDKSAQISPRSIKTTDFLKSQSIVTTKIH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.