collagen, Ddo_024746 (mRNA) Dugesia dorotocephala

Overview
Namecollagen
Unique NameDdo_024746
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length9192
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteCollagen
Homology
BLAST of collagen vs. uniprot
Match: gi|8134352|sp|O46392|CO1A2_CANFA (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor)

HSP 1 Score: 145.206 bits (365), Expect = 4.78131e-33
Identity = 70/224 (31.25%), Postives = 120/224 (53.57%), Query Frame = 1
Query: 8155 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW--NSPILNGPTWLQKLIN-KNEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ N+ ++W NS + WL + IN + +Y+V QLAF+++ +++A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LPI D+ I + +F + + VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKH-IWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365

HSP 2 Score: 145.206 bits (365), Expect = 4.78131e-33
Identity = 70/224 (31.25%), Postives = 120/224 (53.57%), Query Frame = -1
Query:  412 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW--NSPILNGPTWLQKLIN-KNEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1038
NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ N+ ++W NS + WL + IN + +Y+V QLAF+++ +++A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LPI D+ I + +F + + VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKH-IWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365

HSP 3 Score: 61.6178 bits (148), Expect = 1.37556e-07
Identity = 144/373 (38.61%), Postives = 170/373 (45.58%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGAL---------GPMGTSGMRGPPGNIGVEGSKGNKGPPG 6288
G G PG +GE G G G G +GA G G G G GP G +G G +GP G AGPIG G G G G GE GPVG G GP GP G++G PG G VG G G G+ G KG AG G+ G G PG RG GPVG G G +G +G+ G G +G SG +G+ G G G GP G +G +GP G G AG GP G +G G G G DG G G GP GA G G+ GPNG G+ G G +GP G PG G++G GK+G + GP+G +G RG PGNIG G KG G PG
Sbjct: 190 GQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGV---SGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGA------------DGPAGVMGPPGPRGATGPAGVR------------------------------------------GPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPG 505

HSP 4 Score: 61.6178 bits (148), Expect = 1.37556e-07
Identity = 144/373 (38.61%), Postives = 170/373 (45.58%), Query Frame = -1
Query: 2905 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGAL---------GPMGTSGMRGPPGNIGVEGSKGNKGPPG 3996
G G PG +GE G G G G +GA G G G G GP G +G G +GP G AGPIG G G G G GE GPVG G GP GP G++G PG G VG G G G+ G KG AG G+ G G PG RG GPVG G G +G +G+ G G +G SG +G+ G G G GP G +G +GP G G AG GP G +G G G G DG G G GP GA G G+ GPNG G+ G G +GP G PG G++G GK+G + GP+G +G RG PGNIG G KG G PG
Sbjct: 190 GQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGV---SGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGA------------DGPAGVMGPPGPRGATGPAGVR------------------------------------------GPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPG 505

HSP 5 Score: 57.7658 bits (138), Expect = 1.82277e-06
Identity = 117/363 (32.23%), Postives = 140/363 (38.57%), Query Frame = 1
Query: 5200 VTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPG------KKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKG 6270
+ G PG G +G +G G+ G +GA G GP+GE+G GP GE G G G G G G+ G G GP G++GPPGP G G G G +G SG+PG G +GP G G PG K+G +G G+ G G GP G RG GN G GPKG GD G G +G AG+ G +G G DG G++G GP G G G E GP GP G G G G G+ G G G PG+ G GP G G RGPPG G G G
Sbjct: 344 IVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGP------------SGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGV---------------------------RGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGP---------------------DGNNGAQGPPGPQGVQGGKG------------------------------------------EQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSG 604

HSP 6 Score: 57.7658 bits (138), Expect = 1.82277e-06
Identity = 117/363 (32.23%), Postives = 140/363 (38.57%), Query Frame = -1
Query: 2923 VTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPG------KKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKG 3993
+ G PG G +G +G G+ G +GA G GP+GE+G GP GE G G G G G G+ G G GP G++GPPGP G G G G +G SG+PG G +GP G G PG K+G +G G+ G G GP G RG GN G GPKG GD G G +G AG+ G +G G DG G++G GP G G G E GP GP G G G G G+ G G G PG+ G GP G G RGPPG G G G
Sbjct: 344 IVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGP------------SGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGV---------------------------RGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGP---------------------DGNNGAQGPPGPQGVQGGKG------------------------------------------EQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSG 604

HSP 7 Score: 56.9954 bits (136), Expect = 2.82363e-06
Identity = 131/374 (35.03%), Postives = 149/374 (39.84%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEG------LSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGV---EGSKGNKGPPGS 6291
GV G PG G +G GPVG G + G PG G GE G+ G PG G G GP G G+RGP G G GP GP G GSPGS GL G G G GP GP G G G +G GD G G G+ GPRG G PG GP G +G G G++GR G +GP G +G+ G+ G GP G GDPG NG G G G G PG G G GP GP G G KG GP G PG +G PG G G +G G RG PG G+ G +G +GPPG
Sbjct: 316 GVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGP------------------PGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGS---------------------------RGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRG---FPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGE------------------------PGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQ------------------GPPGPQGVQGGKGEQGPAGPPGFQGL---PGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGE 596

HSP 8 Score: 56.9954 bits (136), Expect = 2.82363e-06
Identity = 131/374 (35.03%), Postives = 149/374 (39.84%), Query Frame = -1
Query: 2902 GVTGPPGARGEQGPAGPVGKEG------LSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGV---EGSKGNKGPPGS 3996
GV G PG G +G GPVG G + G PG G GE G+ G PG G G GP G G+RGP G G GP GP G GSPGS GL G G G GP GP G G G +G GD G G G+ GPRG G PG GP G +G G G++GR G +GP G +G+ G+ G GP G GDPG NG G G G G PG G G GP GP G G KG GP G PG +G PG G G +G G RG PG G+ G +G +GPPG
Sbjct: 316 GVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGP------------------PGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGS---------------------------RGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRG---FPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGE------------------------PGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQ------------------GPPGPQGVQGGKGEQGPAGPPGFQGL---PGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGE 596

HSP 9 Score: 56.225 bits (134), Expect = 5.1325e-06
Identity = 91/231 (39.39%), Postives = 115/231 (49.78%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGD---IXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGING---RPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 5838
TG +GPPG GE+GP+G G +GL GAPG +G G +G+ G PG G +G+ +G G G GPPG G G G GE G G G GPPG +G+ G G +G G G G G PG GP+GP G +G PG G +G +G GP+G SGP+G RG G PGE GP+G G +G GL+G G+ G G +G
Sbjct: 833 ETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGE---------------------RGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGLAGQHGDQG 1042

HSP 10 Score: 56.225 bits (134), Expect = 5.1325e-06
Identity = 91/231 (39.39%), Postives = 115/231 (49.78%), Query Frame = -1
Query: 3355 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGD---IXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGING---RPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 4002
TG +GPPG GE+GP+G G +GL GAPG +G G +G+ G PG G +G+ +G G G GPPG G G G GE G G G GPPG +G+ G G +G G G G G PG GP+GP G +G PG G +G +G GP+G SGP+G RG G PGE GP+G G +G GL+G G+ G G +G
Sbjct: 833 ETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGE---------------------RGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGLAGQHGDQG 1042
BLAST of collagen vs. uniprot
Match: gi|123797137|sp|Q3U962|CO5A2_MOUSE (RecName: Full=Collagen alpha-2(V) chain; Flags: Precursor)

HSP 1 Score: 142.51 bits (358), Expect = 3.48282e-32
Identity = 76/221 (34.39%), Postives = 114/221 (51.58%), Query Frame = 1
Query: 8158 NAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW---NSPILNGPTWLQKLINKNEI----QYSVPN---NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMT-HPKLKYSVIKDECQYSKSSEAESVIEVK--DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
+++P G+K+ PARTC L +P GEYWIDPN G EDA+KVYC + +TCI + ++ ++W SP N P W +N+ Y PN Q+ FL++ S A Q +T+ C N +++ N A L +D IK + + +Y+V++D C + +++ E + +VA LPI DVG I N +FGL I VCF
Sbjct: 1278 ETMRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPD-NKPVWYGLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVAR-LPIIDVGPVDIGNADQEFGLDIGPVCF 1496

HSP 2 Score: 142.51 bits (358), Expect = 3.48282e-32
Identity = 76/221 (34.39%), Postives = 114/221 (51.58%), Query Frame = -1
Query:  412 NAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW---NSPILNGPTWLQKLINKNEI----QYSVPN---NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMT-HPKLKYSVIKDECQYSKSSEAESVIEVK--DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1035
+++P G+K+ PARTC L +P GEYWIDPN G EDA+KVYC + +TCI + ++ ++W SP N P W +N+ Y PN Q+ FL++ S A Q +T+ C N +++ N A L +D IK + + +Y+V++D C + +++ E + +VA LPI DVG I N +FGL I VCF
Sbjct: 1278 ETMRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPD-NKPVWYGLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVAR-LPIIDVGPVDIGNADQEFGLDIGPVCF 1496

HSP 3 Score: 72.7886 bits (177), Expect = 4.58305e-11
Identity = 129/368 (35.05%), Postives = 153/368 (41.58%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 6294
G +G PGARG G G G +G G G GP GE G G GE G G + G GP+GP GM PG G++G G+PG+ G G GKPG GP+G G +G PG G G+ G TG +G GP+G+RG G PG P GSQG G +G +G G GP G G G PG G G GP G GP G++G G+ PG PG G E GP G G G +G IGP G+ G RG G+PG G GPMG RG PGN G GS G GP G++
Sbjct: 275 EVGFSGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPM------------------------GAMGPLGPRGM---PGERGRLGPQGAPGKRG------------------------AHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPG---PAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGD------PGVPGFKG---------------------------------------EAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGE---RGAPGNRGFPGSDGLPGPKGAQ 540

HSP 4 Score: 72.7886 bits (177), Expect = 4.58305e-11
Identity = 129/368 (35.05%), Postives = 153/368 (41.58%), Query Frame = -1
Query: 2899 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 4002
G +G PGARG G G G +G G G GP GE G G GE G G + G GP+GP GM PG G++G G+PG+ G G GKPG GP+G G +G PG G G+ G TG +G GP+G+RG G PG P GSQG G +G +G G GP G G G PG G G GP G GP G++G G+ PG PG G E GP G G G +G IGP G+ G RG G+PG G GPMG RG PGN G GS G GP G++
Sbjct: 275 EVGFSGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPM------------------------GAMGPLGPRGM---PGERGRLGPQGAPGKRG------------------------AHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPG---PAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGD------PGVPGFKG---------------------------------------EAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGE---RGAPGNRGFPGSDGLPGPKGAQ 540

HSP 5 Score: 62.003 bits (149), Expect = 8.83187e-08
Identity = 152/404 (37.62%), Postives = 174/404 (43.07%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGP---------DGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGL------------------TGPQGISGPRGKRGRVGNPGEGGPKGS---QGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNP---GKDGALGPMGT---SGMRGPPGNIGVEGSKGNKGPPGSR 6294
S G G PGA G G G G +GL G G +G G KG+ GP G G +G +GP G GERG +GP GM G PGP G +G PGS G PG G KGE G G +G +G G+ G G G G++G G VG +G PG KG G G TGPQGI G G G G GE GPKG G QGPIG G G GP+G G G P G G RG G G PG GL PGP GA G RG VG +GP G G+ G G G PG RG GNP G +G LGP+G G GPPG+IG+ G G+ G PG +
Sbjct: 281 SPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMP------------------GERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPP------------------GPMGERGAPGNRGFPGSDGL------------------------------PGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPK 618

HSP 6 Score: 62.003 bits (149), Expect = 8.83187e-08
Identity = 152/404 (37.62%), Postives = 174/404 (43.07%), Query Frame = -1
Query: 2899 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGP---------DGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGL------------------TGPQGISGPRGKRGRVGNPGEGGPKGS---QGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNP---GKDGALGPMGT---SGMRGPPGNIGVEGSKGNKGPPGSR 4002
S G G PGA G G G G +GL G G +G G KG+ GP G G +G +GP G GERG +GP GM G PGP G +G PGS G PG G KGE G G +G +G G+ G G G G++G G VG +G PG KG G G TGPQGI G G G G GE GPKG G QGPIG G G GP+G G G P G G RG G G PG GL PGP GA G RG VG +GP G G+ G G G PG RG GNP G +G LGP+G G GPPG+IG+ G G+ G PG +
Sbjct: 281 SPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMP------------------GERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPP------------------GPMGERGAPGNRGFPGSDGL------------------------------PGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPK 618

HSP 7 Score: 61.2326 bits (147), Expect = 1.8361e-07
Identity = 81/209 (38.76%), Postives = 95/209 (45.45%), Query Frame = 1
Query: 5233 GPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGING------RPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGD 5841
GP G G+ G G PGF G G KG+ GP G QG +G P G G+RGP G G +GPPGP G+ G+PG+ +G G GL G G G RGP+G G G RPG+ G G GLTG G+ GP GK G +G PGE G G G G G G G+ GPKG GD
Sbjct: 457 GPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIG---------------------PPGEEGKRGPRGDPGTVGPPGPMGERGAPGN---------------------RGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGD 623

HSP 8 Score: 61.2326 bits (147), Expect = 1.8361e-07
Identity = 81/209 (38.76%), Postives = 95/209 (45.45%), Query Frame = -1
Query: 3352 GPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGING------RPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGD 3960
GP G G+ G G PGF G G KG+ GP G QG +G P G G+RGP G G +GPPGP G+ G+PG+ +G G GL G G G RGP+G G G RPG+ G G GLTG G+ GP GK G +G PGE G G G G G G G+ GPKG GD
Sbjct: 457 GPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIG---------------------PPGEEGKRGPRGDPGTVGPPGPMGERGAPGN---------------------RGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGD 623

HSP 9 Score: 60.8474 bits (146), Expect = 2.08303e-07
Identity = 98/251 (39.04%), Postives = 118/251 (47.01%), Query Frame = 1
Query: 5593 GKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGR------AGVLGPK------GQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGM------RGPPGNIGVEGSKGNKGPPGS 6291
G G+PG GP+GP G G PG++GE G GL G +G++G G G GNPG P G+ GD GP GL+G AG GPK G+KG G G G G GP+GP GP G G +GE GP G G PG G PG G NGP G G G GP GQPGV+G G PG+ G G G G+ GP G G++G +G +GPPG+
Sbjct: 694 GVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPG---PTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPG------------------------------------SRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGA 905

HSP 10 Score: 60.8474 bits (146), Expect = 2.08303e-07
Identity = 98/251 (39.04%), Postives = 118/251 (47.01%), Query Frame = -1
Query: 2902 GKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGR------AGVLGPK------GQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGM------RGPPGNIGVEGSKGNKGPPGS 3600
G G+PG GP+GP G G PG++GE G GL G +G++G G G GNPG P G+ GD GP GL+G AG GPK G+KG G G G G GP+GP GP G G +GE GP G G PG G PG G NGP G G G GP GQPGV+G G PG+ G G G G+ GP G G++G +G +GPPG+
Sbjct: 694 GVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPG---PTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPG------------------------------------SRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGA 905

HSP 11 Score: 55.8398 bits (133), Expect = 7.75364e-06
Identity = 107/272 (39.34%), Postives = 122/272 (44.85%), Query Frame = 1
Query: 5221 RGEQGPAGPV------------------GKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSP------XXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPG 5964
RGEQGP GP G +G+ G PG VGP G +G+ G PGE+G+ G G PG G G G GP G G G G GP G+ G PG G G+PG G G G G G G+ G G G G G+ G+PG RG +GP G G PG +GE G G G G GP G+ G G PGE G KG G GP GL G G GP G G+KG RG GP GA G PG
Sbjct: 663 RGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHG------------------------VPGLKGGRGTQGPPGATGFPG 910

HSP 12 Score: 55.8398 bits (133), Expect = 7.75364e-06
Identity = 107/272 (39.34%), Postives = 122/272 (44.85%), Query Frame = -1
Query: 3229 RGEQGPAGPV------------------GKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSP------XXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPG 3972
RGEQGP GP G +G+ G PG VGP G +G+ G PGE+G+ G G PG G G G GP G G G G GP G+ G PG G G+PG G G G G G G+ G G G G G+ G+PG RG +GP G G PG +GE G G G G GP G+ G G PGE G KG G GP GL G G GP G G+KG RG GP GA G PG
Sbjct: 663 RGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHG------------------------VPGLKGGRGTQGPPGATGFPG 910
BLAST of collagen vs. uniprot
Match: gi|296439507|sp|P08123|CO1A2_HUMAN (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor)

HSP 1 Score: 142.124 bits (357), Expect = 4.02171e-32
Identity = 69/223 (30.94%), Postives = 116/223 (52.02%), Query Frame = 1
Query: 8155 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW-NSPILNGPTWLQKLINK-NEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ N+ ++W S WL + IN ++ +Y+V QLAF+++ ++ A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LP D+ I +F + I VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365

HSP 2 Score: 142.124 bits (357), Expect = 4.02171e-32
Identity = 69/223 (30.94%), Postives = 116/223 (52.02%), Query Frame = -1
Query:  412 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW-NSPILNGPTWLQKLINK-NEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1038
NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ N+ ++W S WL + IN ++ +Y+V QLAF+++ ++ A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LP D+ I +F + I VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365

HSP 3 Score: 56.225 bits (134), Expect = 4.87975e-06
Identity = 92/228 (40.35%), Postives = 114/228 (50.00%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIG---LTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 5838
G GPPG GE+GP+G G +GL GAPG +G G +G+ G PG G +G+ GP G AGP G G G G G G G G DG G GP G+ G PG KG +G G G G +G PG GP+GP G +G G+ G G +G GP+G SGP+G RG G PGE GP+G G +G GL+G G+ G G +G
Sbjct: 833 EVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGH------------------KGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQG 1042

HSP 4 Score: 56.225 bits (134), Expect = 4.87975e-06
Identity = 92/228 (40.35%), Postives = 114/228 (50.00%), Query Frame = -1
Query: 3355 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIG---LTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 4002
G GPPG GE+GP+G G +GL GAPG +G G +G+ G PG G +G+ GP G AGP G G G G G G G G DG G GP G+ G PG KG +G G G G +G PG GP+GP G +G G+ G G +G GP+G SGP+G RG G PGE GP+G G +G GL+G G+ G G +G
Sbjct: 833 EVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGH------------------KGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQG 1042
BLAST of collagen vs. uniprot
Match: gi|8039779|sp|P02465|CO1A2_BOVIN (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor)

HSP 1 Score: 141.354 bits (355), Expect = 7.1953e-32
Identity = 74/249 (29.72%), Postives = 125/249 (50.20%), Query Frame = 1
Query: 8077 VMAMQMRSPTKGVVYGDDPKAAELLGNNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW-NSPILNGPTWLQKLIN-KNEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
A Q RSPT + A NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ ++ +++W + W+ + IN + +Y+V QLAF+++ +++A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LPI D+ I + L I VCF
Sbjct: 1115 YRADQPRSPTSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCF 1363

HSP 2 Score: 141.354 bits (355), Expect = 7.1953e-32
Identity = 74/249 (29.72%), Postives = 125/249 (50.20%), Query Frame = -1
Query:  412 VMAMQMRSPTKGVVYGDDPKAAELLGNNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW-NSPILNGPTWLQKLIN-KNEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1116
A Q RSPT + A NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ ++ +++W + W+ + IN + +Y+V QLAF+++ +++A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LPI D+ I + L I VCF
Sbjct: 1115 YRADQPRSPTSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCF 1363

HSP 3 Score: 62.003 bits (149), Expect = 9.18025e-08
Identity = 94/228 (41.23%), Postives = 117/228 (51.32%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGING---RPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 5838
TG +GPPG GE+GP+G G +GL GAPGF+G G +G+ G PG G +G+ GP G AGP G G G G G G G G DG G GP G+ G PG G G G G G +G PG +GP+GPVG +G PG G +G G GP+G SGP+G RG G PG+ GP+G G +G GL+G G+ G G +G
Sbjct: 831 ETGASGPPGFVGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPV------------------GAAGAPGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGDQG 1040

HSP 4 Score: 62.003 bits (149), Expect = 9.18025e-08
Identity = 94/228 (41.23%), Postives = 117/228 (51.32%), Query Frame = -1
Query: 3355 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGING---RPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 4002
TG +GPPG GE+GP+G G +GL GAPGF+G G +G+ G PG G +G+ GP G AGP G G G G G G G G DG G GP G+ G PG G G G G G +G PG +GP+GPVG +G PG G +G G GP+G SGP+G RG G PG+ GP+G G +G GL+G G+ G G +G
Sbjct: 831 ETGASGPPGFVGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPV------------------GAAGAPGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGDQG 1040
BLAST of collagen vs. uniprot
Match: gi|18202250|sp|O93484|CO1A2_ONCMY (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor [Oncorhynchus mykiss])

HSP 1 Score: 139.043 bits (349), Expect = 3.9784e-31
Identity = 68/223 (30.49%), Postives = 112/223 (50.22%), Query Frame = 1
Query: 8155 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILN-GPTWLQKLIN-KNEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMT-HPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
N+ I+N P+G+K+ PARTC+ + +P G YWIDPN G I DA+K YC S TCI +++ ++W N W + IN E Y+ QLAF+++ ++ A Q +T++C+N + + N A L +D ++ + + ++V++D C +++VIE + + + LPI D+ I +FGL I VCF
Sbjct: 1133 NSQIENLLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355

HSP 2 Score: 139.043 bits (349), Expect = 3.9784e-31
Identity = 68/223 (30.49%), Postives = 112/223 (50.22%), Query Frame = -1
Query:  412 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILN-GPTWLQKLIN-KNEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMT-HPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1038
N+ I+N P+G+K+ PARTC+ + +P G YWIDPN G I DA+K YC S TCI +++ ++W N W + IN E Y+ QLAF+++ ++ A Q +T++C+N + + N A L +D ++ + + ++V++D C +++VIE + + + LPI D+ I +FGL I VCF
Sbjct: 1133 NSQIENLLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355

HSP 3 Score: 58.151 bits (139), Expect = 1.34422e-06
Identity = 187/413 (45.28%), Postives = 213/413 (51.57%), Query Frame = 1
Query: 5194 TGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVG---PDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRP---GKKGELGDIGLTGPQGISGPRGKRGR---VGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKG------------------AIGPTG---QPGVRGSIGNPGKDGA------LGPMGTSGMRGPPGNIGV------------EGSKGNKGPPG 6288
GV G G +GEQGPAG G +GL PG GP GE G G G GD G GP G G G G +G G QG +G RGP G PDG G PG G +G+ G G G G++G GG G KG KGE G GL+G G+ G RG GP G G G+KGE G G GP G+ GP G+RG G PG GP GS G GP G + GP G KGD G G G +G GP G GP G G RG++GP+G G PG G+ G GP GI G PG AGP G+ GP G G G GP+GE G GP G SG+KG +GP+G PG RG G PG GA LGP G SG RGP GNIG+ EG+ GN GPPG
Sbjct: 528 AGVVGNTGEKGEQGPAGAPGFQGL---PGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGGPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGLPGFAGPPGSDGQSGPRGEK------GPAGGKGDVGPAGPAGPSGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEQGVVGPAGISGDKGPSGESGPPGAPGTAGPQGVLGPSGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPAGNIGMPGMTGTQGEAGREGNSGNDGPPG 931

HSP 4 Score: 58.151 bits (139), Expect = 1.34422e-06
Identity = 187/413 (45.28%), Postives = 213/413 (51.57%), Query Frame = -1
Query: 2905 TGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVG---PDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRP---GKKGELGDIGLTGPQGISGPRGKRGR---VGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKG------------------AIGPTG---QPGVRGSIGNPGKDGA------LGPMGTSGMRGPPGNIGV------------EGSKGNKGPPG 3999
GV G G +GEQGPAG G +GL PG GP GE G G G GD G GP G G G G +G G QG +G RGP G PDG G PG G +G+ G G G G++G GG G KG KGE G GL+G G+ G RG GP G G G+KGE G G GP G+ GP G+RG G PG GP GS G GP G + GP G KGD G G G +G GP G GP G G RG++GP+G G PG G+ G GP GI G PG AGP G+ GP G G G GP+GE G GP G SG+KG +GP+G PG RG G PG GA LGP G SG RGP GNIG+ EG+ GN GPPG
Sbjct: 528 AGVVGNTGEKGEQGPAGAPGFQGL---PGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGGPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGLPGFAGPPGSDGQSGPRGEK------GPAGGKGDVGPAGPAGPSGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEQGVVGPAGISGDKGPSGESGPPGAPGTAGPQGVLGPSGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPAGNIGMPGMTGTQGEAGREGNSGNDGPPG 931
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15040033 (dd_smedV4_702_0_1|m.35199|m.6295)

HSP 1 Score: 471.855 bits (1213), Expect = 4.32297e-138
Identity = 319/397 (80.35%), Postives = 351/397 (88.41%), Query Frame = 1
Query: 7597 TSGGKGYDGQTGTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGTPGREGKPGPRGAKGTKGPKGVPGYPGRPGIEXXXXXXXXXXXXXXXXXXXXXXLQGPVGIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS* 8787
TSGGKGYDGQ+GTSGKSGK+G PG+KG DGKPGP+G+LGD GLRGAKGKKG DG PGREG+PG RG+KG KGPKGVPGYPGRPG+EGDPGPPGY GPDGP GPKGPDGLQGPVGI GPRGDPGIPG IGPTG GK GG G G GPLGPPGPPGPPGG+MAMQMRSPTKGV YGDDP AAELLGNNAIKNP+GTKEVPA TCK LS +P PDGEYWIDPNGGR+ DAVKVYC+ISEQKTCIK I+N +S+RSW S NG TWL+ ++NK EIQYS+PN Q+AFLKV SD+AVQRVTF CENHPIIGNE+ NKVTAPRLLADDD+IIKMTH LKY+VIKDECQYSKSSEAES+IEV++ ANLLPIRD+G+ IINNRKSKFG+TIE+VCFS*
Sbjct: 890 TSGGKGYDGQSGTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGRPGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDGLQGPVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGIMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS* 1286

HSP 2 Score: 471.855 bits (1213), Expect = 4.32297e-138
Identity = 319/397 (80.35%), Postives = 351/397 (88.41%), Query Frame = -1
Query:  406 TSGGKGYDGQTGTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGTPGREGKPGPRGAKGTKGPKGVPGYPGRPGIEXXXXXXXXXXXXXXXXXXXXXGLQGPVGIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVMAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS* 1596
TSGGKGYDGQ+GTSGKSGK+G PG+KG DGKPGP+G+LGD GLRGAKGKKG DG PGREG+PG RG+KG KGPKGVPGYPGRPG+EGDPGPPGY GPDGP GPKGPDGLQGPVGI GPRGDPGIPG IGPTG GK GG G G GPLGPPGPPGPPGG+MAMQMRSPTKGV YGDDP AAELLGNNAIKNP+GTKEVPA TCK LS +P PDGEYWIDPNGGR+ DAVKVYC+ISEQKTCIK I+N +S+RSW S NG TWL+ ++NK EIQYS+PN Q+AFLKV SD+AVQRVTF CENHPIIGNE+ NKVTAPRLLADDD+IIKMTH LKY+VIKDECQYSKSSEAES+IEV++ ANLLPIRD+G+ IINNRKSKFG+TIE+VCFS*
Sbjct: 890 TSGGKGYDGQSGTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGRPGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDGLQGPVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGIMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS* 1286

HSP 3 Score: 376.326 bits (965), Expect = 1.75889e-106
Identity = 505/663 (76.17%), Postives = 560/663 (84.46%), Query Frame = 1
Query: 4930 MLKISILSGCVFLILLFIGNSYGQFRTLNEAVGPAGIRGNXXXXXXXXXXXXXXXXXXXXXXXXXXLRXXXXXXXXXXXXXXXXXXXSTGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSRXXXXXXXXXXXXXXXXXXXSEGPVGNMXXXXXXXXXXXXXXXXXXXXXXLIGPVGYAGSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGSLGPPGPTGLKGSXXXXXXXXXXXXXXXXXSLGVIGKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDKQKPRSVGSAGIRGPIGKPGADGIPGDVGPVGKQ 6918
M K SI SG + LIL+++ SYGQFRTLNEA GP GIRGNPGK GK GPDGDPG +GPPGP GKDGLRG PG GP G AGPDGK G TG TGPPG+RGEQGP GPVGKEGL+G G+ GP+GEKGD+G GEQGD GDIGP G AGP+GPPGQSGPTGPQG VGERGP GPDG++GPPGPEG++GSPGSPGRPGE+GKKGEGGDEG+KGGKGE GKTG++GKSGKPG RGPIGPVGING+ G+KGELGDIGLTGPQG+ GPRG RG VGNPG+ GPKGSQGDQGPIGLEG+ G GPKGQKGDRGRPG GE GPLGP GPIGPDG KGSRGE GPNG+PG PG NGKPGA GPPG PG PG+AGPGGQ GP+GRPGPNGAPGPRGE+GPNGPDGKSG KG++GPTG G+RG GNPGKDG LGP+GT G+RGPPG+IG G KGN GPPGS+GKVG+AGK GP GK G++GSEGP+GN G+PGFPG +GDPG GP G +GL G VGY G+QG+ GKNG+PG GKPGK G PG+PGKPG+PGP GD G++GPPGP GLKG+PGI GVPGNYGPNG PG LG +GKQG EG +G PG GSPG GPRGPPG G+PG+AGGEGV+K KPRSVGSAGIRGP GKPG DG PGDVGP GKQ
Sbjct: 1 MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLGPPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKKGEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKPGATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGRKGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVGPPGKQ 663

HSP 4 Score: 376.326 bits (965), Expect = 1.75889e-106
Identity = 505/663 (76.17%), Postives = 560/663 (84.46%), Query Frame = -1
Query: 2275 MLKISILSGCVFLILLFIGNSYGQFRTLNEAVGPAGIRGNXXXXXXXXXXXXXXXXXXXXXXXXXGLRXXXXXXXXXXXXXXXXXXGSTGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSRXXXXXXXXXXXXXXXXXXGSEGPVGNMXXXXXXXXXXXXXXXXXXXXXGLIGPVGYAGSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRGSLGPPGPTGLKGSXXXXXXXXXXXXXXXXGSLGVIGKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVDKQKPRSVGSAGIRGPIGKPGADGIPGDVGPVGKQ 4263
M K SI SG + LIL+++ SYGQFRTLNEA GP GIRGNPGK GK GPDGDPG +GPPGP GKDGLRG PG GP G AGPDGK G TG TGPPG+RGEQGP GPVGKEGL+G G+ GP+GEKGD+G GEQGD GDIGP G AGP+GPPGQSGPTGPQG VGERGP GPDG++GPPGPEG++GSPGSPGRPGE+GKKGEGGDEG+KGGKGE GKTG++GKSGKPG RGPIGPVGING+ G+KGELGDIGLTGPQG+ GPRG RG VGNPG+ GPKGSQGDQGPIGLEG+ G GPKGQKGDRGRPG GE GPLGP GPIGPDG KGSRGE GPNG+PG PG NGKPGA GPPG PG PG+AGPGGQ GP+GRPGPNGAPGPRGE+GPNGPDGKSG KG++GPTG G+RG GNPGKDG LGP+GT G+RGPPG+IG G KGN GPPGS+GKVG+AGK GP GK G++GSEGP+GN G+PGFPG +GDPG GP G +GL G VGY G+QG+ GKNG+PG GKPGK G PG+PGKPG+PGP GD G++GPPGP GLKG+PGI GVPGNYGPNG PG LG +GKQG EG +G PG GSPG GPRGPPG G+PG+AGGEGV+K KPRSVGSAGIRGP GKPG DG PGDVGP GKQ
Sbjct: 1 MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLGPPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKKGEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKPGATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGRKGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVGPPGKQ 663
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15002271 (Asxlregen_comp67208_c0_seq1|m.27270|m.10319)

HSP 1 Score: 270.781 bits (691), Expect = 4.43728e-73
Identity = 114/232 (49.14%), Postives = 151/232 (65.09%), Query Frame = 1
Query: 8092 MRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS* 8787
+RSPTKG+ + DDP A GNNAI P+GTKEVPAR+CKHLS NP DGEYWIDPNGGR+ DAV VYC+I+ Q+TCIK I SW W Q + E +Y + N QL +LK S+ A Q+++ NC N II + + LL DDD+I+ + HPK ++ VIKDECQY K SEAE+++EV+ A+ LPI+DVG+ I ++R K G+ + +VC+S*
Sbjct: 1064 LRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS* 1295

HSP 2 Score: 270.781 bits (691), Expect = 4.43728e-73
Identity = 114/232 (49.14%), Postives = 151/232 (65.09%), Query Frame = -1
Query:  406 MRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS* 1101
+RSPTKG+ + DDP A GNNAI P+GTKEVPAR+CKHLS NP DGEYWIDPNGGR+ DAV VYC+I+ Q+TCIK I SW W Q + E +Y + N QL +LK S+ A Q+++ NC N II + + LL DDD+I+ + HPK ++ VIKDECQY K SEAE+++EV+ A+ LPI+DVG+ I ++R K G+ + +VC+S*
Sbjct: 1064 LRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS* 1295

HSP 3 Score: 138.272 bits (347), Expect = 4.42956e-32
Identity = 200/363 (55.10%), Postives = 238/363 (65.56%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG 6279
S GV GP G RGE G AG +G EG +G G G TG+KGD G G +G G+ G G G GP G+ GP G QG GERG G DG+ G GP+G IG PG G PGE+G KG G+ GIKG KG++G GL GK+G G+ GP G G++GRPG +GE G +G GP G G RG+RG GNPG GPKGSQG++GPIG+EG+ G GPKGQKGD GRPGE G+ GP G G +GP G KGSRGESGP+G+PG+PG +G PG G G PG+ G+ G G G MG+ G NGAPGPRGE G G +G G KGA+GP G G G G PG G +G MG G+RGP G +G G KG+KG
Sbjct: 95 SHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKG 457

HSP 4 Score: 138.272 bits (347), Expect = 4.42956e-32
Identity = 200/363 (55.10%), Postives = 238/363 (65.56%), Query Frame = -1
Query: 2914 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG 4002
S GV GP G RGE G AG +G EG +G G G TG+KGD G G +G G+ G G G GP G+ GP G QG GERG G DG+ G GP+G IG PG G PGE+G KG G+ GIKG KG++G GL GK+G G+ GP G G++GRPG +GE G +G GP G G RG+RG GNPG GPKGSQG++GPIG+EG+ G GPKGQKGD GRPGE G+ GP G G +GP G KGSRGESGP+G+PG+PG +G PG G G PG+ G+ G G G MG+ G NGAPGPRGE G G +G G KGA+GP G G G G PG G +G MG G+RGP G +G G KG+KG
Sbjct: 95 SHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKG 457

HSP 5 Score: 68.5514 bits (166), Expect = 6.32554e-11
Identity = 151/398 (37.94%), Postives = 185/398 (46.48%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGN---------------KGAIGPTGQPGVRGSI---GNPGKDGALGPMGTSGMRGPP---------------GNIGVEGSKGNKGPPGS 6291
G++GP G++GE+GP G GK+G +G P G+KGD G PGE GD G GERG VGP G G G G GSPG+PG G GK G G+ G G+ G G+ G +G +G+NG PG +GE G G G G G G +G +G+PG G G+ G G +G G G LGP G GD+G G G G G G +G G G G GP+G+PG G PG AG GQ GP+G GP G G G G NG DGK+G KG+IGP G+ G+ G I G G DG +GP GT GM GPP G +G+ GS+G GP GS
Sbjct: 280 GLSGPKGSQGEEGPIGIEGKQGSAG------PKGQKGDPGRPGETGDEGP------------------------RGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGS------------QGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGF---------------PGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAPGKLGPVGITGSRGRPGPIGS 620

HSP 6 Score: 68.5514 bits (166), Expect = 6.32554e-11
Identity = 151/398 (37.94%), Postives = 185/398 (46.48%), Query Frame = -1
Query: 2902 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGN---------------KGAIGPTGQPGVRGSI---GNPGKDGALGPMGTSGMRGPP---------------GNIGVEGSKGNKGPPGS 3996
G++GP G++GE+GP G GK+G +G P G+KGD G PGE GD G GERG VGP G G G G GSPG+PG G GK G G+ G G+ G G+ G +G +G+NG PG +GE G G G G G G +G +G+PG G G+ G G +G G G LGP G GD+G G G G G G +G G G G GP+G+PG G PG AG GQ GP+G GP G G G G NG DGK+G KG+IGP G+ G+ G I G G DG +GP GT GM GPP G +G+ GS+G GP GS
Sbjct: 280 GLSGPKGSQGEEGPIGIEGKQGSAG------PKGQKGDPGRPGETGDEGP------------------------RGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLHGNPGS------------QGEVGSRGSPGAMGKLGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGF---------------PGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAPGKLGPVGITGSRGRPGPIGS 620

HSP 7 Score: 64.6994 bits (156), Expect = 1.1467e-09
Identity = 94/246 (38.21%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 5587 LDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRV------GNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGV------KGSRGESGPNGAPGD---PGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG 6279
+ GK G PG+ G +GP+G G PG G +G G TGPQG G G +G + G+ GE G +G QG +GP G G AG+ GP G++G +G G G GP G IGP G G+ KG RGESG GA GD PGL G GP G G G G G+PGVRG G G G +G +G G RGP GN G+ G KG++G
Sbjct: 86 IPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGL------------------------------------------AGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQG 289

HSP 8 Score: 64.6994 bits (156), Expect = 1.1467e-09
Identity = 94/246 (38.21%), Postives = 115/246 (46.75%), Query Frame = -1
Query: 2914 LDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRV------GNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGV------KGSRGESGPNGAPGD---PGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG 3606
+ GK G PG+ G +GP+G G PG G +G G TGPQG G G +G + G+ GE G +G QG +GP G G AG+ GP G++G +G G G GP G IGP G G+ KG RGESG GA GD PGL G GP G G G G G+PGVRG G G G +G +G G RGP GN G+ G KG++G
Sbjct: 86 IPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGL------------------------------------------AGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQG 289

HSP 9 Score: 55.4546 bits (132), Expect = 7.19697e-07
Identity = 161/388 (41.49%), Postives = 191/388 (49.23%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKP------------GTRGPIGPVGINGRPGKKGELGDIGLTGPQ---GISGPRGKRGRVGNP---GEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGP------TGQPGVRGSIGNPGKDGALGPMGTS---GMRGPPGNIGVEGSKGNKG 6279
G G PGA+G GP G +G G+ G PG TG G GP G +G LG +G PG G G G +G G G++GE+GP G DG GP G G +G PG G+ G+ G G G G G +G G G DGK+GK G +G IGPV G+ G +G IGL GP+ GI GP G G G P GE GP G+ G GP+G+ G G GP G G+ G G G P+ GV G RGE G+PGD GL G G GPPG G G G G G G G G G GE G G DG G G GP TG+ G +G G PG GA GP G+S G +GP G IG G +G +G
Sbjct: 400 GTNGHPGAKGAVGPKGNMGSPGVRGLPGN---TGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGFPGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPV------GETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAPGKLGPVGITGSRGRPGPIGSSGEPGEKGPQGLPEVEKPLAGRSVGGVSGPRGE---RGSPGDDGLPGPNGDPGPPGPIGMDGGRGDTGDRGLPGPAGDPGKDGKPGEPGTPGIDGPPGQVGPEGPRGPSGETGEQGPQGLPGKPGDPGAEGPRGSSGKQGFQGPTGPIGPTGKQGKQG 775

HSP 10 Score: 55.4546 bits (132), Expect = 7.19697e-07
Identity = 161/388 (41.49%), Postives = 191/388 (49.23%), Query Frame = -1
Query: 2914 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKP------------GTRGPIGPVGINGRPGKKGELGDIGLTGPQ---GISGPRGKRGRVGNP---GEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGP------TGQPGVRGSIGNPGKDGALGPMGTS---GMRGPPGNIGVEGSKGNKG 3996
G G PGA+G GP G +G G+ G PG TG G GP G +G LG +G PG G G G +G G G++GE+GP G DG GP G G +G PG G+ G+ G G G G G +G G G DGK+GK G +G IGPV G+ G +G IGL GP+ GI GP G G G P GE GP G+ G GP+G+ G G GP G G+ G G G P+ GV G RGE G+PGD GL G G GPPG G G G G G G G G G GE G G DG G G GP TG+ G +G G PG GA GP G+S G +GP G IG G +G +G
Sbjct: 400 GTNGHPGAKGAVGPKGNMGSPGVRGLPGN---TGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGFPGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPV------GETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAPGKLGPVGITGSRGRPGPIGSSGEPGEKGPQGLPEVEKPLAGRSVGGVSGPRGE---RGSPGDDGLPGPNGDPGPPGPIGMDGGRGDTGDRGLPGPAGDPGKDGKPGEPGTPGIDGPPGQVGPEGPRGPSGETGEQGPQGLPGKPGDPGAEGPRGSSGKQGFQGPTGPIGPTGKQGKQG 775
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15036469 (dd_smedV4_1070_0_1|m.1593|m.7941)

HSP 1 Score: 207.223 bits (526), Expect = 3.42234e-53
Identity = 93/239 (38.91%), Postives = 135/239 (56.49%), Query Frame = 1
Query: 8077 VMAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNR--KSKFGLTIEDVCFS* 8787
V M R ++ DDP A+ LGN+AI P GT PAR+C HL+ +NP PDG YWIDPNGG+I+DAV+VYCKI E+KTCIK + + ++ P N W + + I YS+ Q+ FLK+ S+ A Q +T NC N P+ I N V R+ D+D I+ + Y V++D CQ++ + + +E+ LPI+D+ + +N R +S+ IE+VCF *
Sbjct: 1066 VATMSNRQQGYMIIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQ---KPKFN---WFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPV-----IKNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCFY* 1293

HSP 2 Score: 207.223 bits (526), Expect = 3.42234e-53
Identity = 93/239 (38.91%), Postives = 135/239 (56.49%), Query Frame = -1
Query:  406 VMAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNR--KSKFGLTIEDVCFS* 1116
V M R ++ DDP A+ LGN+AI P GT PAR+C HL+ +NP PDG YWIDPNGG+I+DAV+VYCKI E+KTCIK + + ++ P N W + + I YS+ Q+ FLK+ S+ A Q +T NC N P+ I N V R+ D+D I+ + Y V++D CQ++ + + +E+ LPI+D+ + +N R +S+ IE+VCF *
Sbjct: 1066 VATMSNRQQGYMIIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQ---KPKFN---WFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPV-----IKNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCFY* 1293

HSP 3 Score: 58.151 bits (139), Expect = 8.76633e-08
Identity = 101/238 (42.44%), Postives = 120/238 (50.42%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAGPV---GKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGP---EGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGT------RGPIGPVGINGRPGK------KGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPI---GLEGRAGVLGPKGQKGD 5841
S G GP G G GP GPV G +G G G GP GEKG GP G GD+G +G PG G +G GP G GP GP +G G PG PG G G G G G G KG AGK G+ G SG PG+ GPIG GI G GK KGE G +GL GPQG+SGP G +G +G PG G KG++G GP+ G G G++G G++G+
Sbjct: 105 SIGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNPGDIGVLGLPGPP------------------GHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGE 324

HSP 4 Score: 58.151 bits (139), Expect = 8.76633e-08
Identity = 101/238 (42.44%), Postives = 120/238 (50.42%), Query Frame = -1
Query: 3352 STGVTGPPGARGEQGPAGPV---GKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGP---EGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGT------RGPIGPVGINGRPGK------KGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPI---GLEGRAGVLGPKGQKGD 4002
S G GP G G GP GPV G +G G G GP GEKG GP G GD+G +G PG G +G GP G GP GP +G G PG PG G G G G G G KG AGK G+ G SG PG+ GPIG GI G GK KGE G +GL GPQG+SGP G +G +G PG G KG++G GP+ G G G++G G++G+
Sbjct: 105 SIGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNPGDIGVLGLPGPP------------------GHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGE 324

HSP 5 Score: 56.6102 bits (135), Expect = 2.82567e-07
Identity = 102/240 (42.50%), Postives = 121/240 (50.42%), Query Frame = 1
Query: 5593 GKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGS------IGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 6294
GK G G G IGP GING+PG G +G G GP G SGP G VG PG GP G G +GP+G +G G P+G GD G G G G G GP G G +G RG G +G PG PG G G G G MG G G G +G +G +G G G GA GP GQPG+ GS IG G++G LG +G G+ GPP G++GS G GP GS+
Sbjct: 80 GKDGPQGVLGLIGPTGINGKPGVDGSIGAPGPVGPDGPSGPTGP---VGMPGNQGPDGPSGSKGPVGEKGPDG---PQGNPGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQ---------------PGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPP---GLQGSLGPPGPQGSK 295

HSP 6 Score: 56.6102 bits (135), Expect = 2.82567e-07
Identity = 102/240 (42.50%), Postives = 121/240 (50.42%), Query Frame = -1
Query: 2899 GKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGS------IGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 3600
GK G G G IGP GING+PG G +G G GP G SGP G VG PG GP G G +GP+G +G G P+G GD G G G G G GP G G +G RG G +G PG PG G G G G MG G G G +G +G +G G G GA GP GQPG+ GS IG G++G LG +G G+ GPP G++GS G GP GS+
Sbjct: 80 GKDGPQGVLGLIGPTGINGKPGVDGSIGAPGPVGPDGPSGPTGP---VGMPGNQGPDGPSGSKGPVGEKGPDG---PQGNPGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQ---------------PGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPP---GLQGSLGPPGPQGSK 295

HSP 7 Score: 54.299 bits (129), Expect = 1.49668e-06
Identity = 156/416 (37.50%), Postives = 182/416 (43.75%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPG---------------FVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVG------------PDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIG---------------LEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKG---------AIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 6291
G G PG G QGP GP G +G+ G PG +GPTG KG G +QG LG G PG G G PG G G G+ G+ GP+G P G+ GPPG +G +G PG G G G IGPVG G PG G +G+IG RG+ G GNPG GP+G +G GP G ++G G+ G KG+ GD PG LG GP G G G DG +G RG GPNG G PG G+ G G G G G G G G G GP G PGPRG+ GP G G G KG G G+PGV G G G +G LGP G G GP G G EG+ G G PG+
Sbjct: 167 GHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAG---KQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGP---------------------------------QGSKGNEGKIGPVGPAGSPGSPGLIGEIGE---------RGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGD---PGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGT 534

HSP 8 Score: 54.299 bits (129), Expect = 1.49668e-06
Identity = 156/416 (37.50%), Postives = 182/416 (43.75%), Query Frame = -1
Query: 2902 GVTGPPGARGEQGPAGPVGKEGLSGAPG---------------FVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVG------------PDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIG---------------LEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKG---------AIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 3996
G G PG G QGP GP G +G+ G PG +GPTG KG G +QG LG G PG G G PG G G G+ G+ GP+G P G+ GPPG +G +G PG G G G IGPVG G PG G +G+IG RG+ G GNPG GP+G +G GP G ++G G+ G KG+ GD PG LG GP G G G DG +G RG GPNG G PG G+ G G G G G G G G G GP G PGPRG+ GP G G G KG G G+PGV G G G +G LGP G G GP G G EG+ G G PG+
Sbjct: 167 GHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAG---KQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGP---------------------------------QGSKGNEGKIGPVGPAGSPGSPGLIGEIGE---------RGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGD---PGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGT 534

HSP 9 Score: 53.5286 bits (127), Expect = 2.242e-06
Identity = 69/147 (46.94%), Postives = 83/147 (56.46%), Query Frame = 1
Query: 5416 NVGERGP---VGPDGMIGPPGPEGKIGSPGSPX------XXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKG 5829
N G++GP GPDG++GP GP GK G PG G + G+VGK G G G G G G GL G++GKPG GP+GP G GRPG G G GL GP G SG GK+G G+ G GP+G GD G G +G G G +G
Sbjct: 682 NPGKQGPPGEAGPDGLLGPMGPPGKDGKPGEDGNLGPIGKTGKVGKDGPPGPPGPTGDVGPIGPNGLPGQNGKPGKAGPLGPTGPVGRPGSDGIRGPNGLRGPTGKSGADGKKGPAGDDGPPGPQGEAGDMGSPGQDGPPGNQGNRG 828

HSP 10 Score: 53.5286 bits (127), Expect = 2.242e-06
Identity = 69/147 (46.94%), Postives = 83/147 (56.46%), Query Frame = -1
Query: 3364 NVGERGP---VGPDGMIGPPGPEGKIGSPGSPX------XXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKG 3777
N G++GP GPDG++GP GP GK G PG G + G+VGK G G G G G G GL G++GKPG GP+GP G GRPG G G GL GP G SG GK+G G+ G GP+G GD G G +G G G +G
Sbjct: 682 NPGKQGPPGEAGPDGLLGPMGPPGKDGKPGEDGNLGPIGKTGKVGKDGPPGPPGPTGDVGPIGPNGLPGQNGKPGKAGPLGPTGPVGRPGSDGIRGPNGLRGPTGKSGADGKKGPAGDDGPPGPQGEAGDMGSPGQDGPPGNQGNRG 828
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15029208 (SmedSxlregen_c102983_g1_i1|m.43148|m.11576)

HSP 1 Score: 181.415 bits (459), Expect = 2.53308e-45
Identity = 81/226 (35.84%), Postives = 130/226 (57.52%), Query Frame = 1
Query: 8116 VYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWN-SPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNR-KSKFGLTIEDVCFS* 8787
+ DD A + LG++ +K P GTK++PARTCK L NP DG Y+IDPNGG+ +DA +V C+ +++CI+ + ++ W+ S + +W ++ + Y + +QL FLK++S NA QR+T NC ++GN + + V L +D D + KYSVI+D C+ S + +E+ A LPIRD+ ++ +++ + +FGL I VCFS*
Sbjct: 1099 LLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSE--HPVI---LYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS* 1319

HSP 2 Score: 181.415 bits (459), Expect = 2.53308e-45
Identity = 81/226 (35.84%), Postives = 130/226 (57.52%), Query Frame = -1
Query:  406 VYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWN-SPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNR-KSKFGLTIEDVCFS* 1077
+ DD A + LG++ +K P GTK++PARTCK L NP DG Y+IDPNGG+ +DA +V C+ +++CI+ + ++ W+ S + +W ++ + Y + +QL FLK++S NA QR+T NC ++GN + + V L +D D + KYSVI+D C+ S + +E+ A LPIRD+ ++ +++ + +FGL I VCFS*
Sbjct: 1099 LLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSE--HPVI---LYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS* 1319

HSP 3 Score: 68.9366 bits (167), Expect = 5.89416e-11
Identity = 140/373 (37.53%), Postives = 168/373 (45.04%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGL------------SGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG 6279
G TG PG RG G GPVG G G PG GP G G GP GE+G G +G G ++G+ G G DG G PG G G G G G G G+ G+ G G +G G G G G+ G++G IGP+G +G PG +G G IG G QG G RG +G +G+PG G GS+G QG IG+ G G G G+ G G PG+ G G GP+GPIG G G G+ GP G PG PG N + GP GP G+ G G G G PG G G G G +GP G SG RG PG+ G G+KGNKG
Sbjct: 183 GPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKG------------------SIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKN---------------------------------------MQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG 498

HSP 4 Score: 68.9366 bits (167), Expect = 5.89416e-11
Identity = 140/373 (37.53%), Postives = 168/373 (45.04%), Query Frame = -1
Query: 2914 GVTGPPGARGEQGPAGPVGKEGL------------SGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG 3996
G TG PG RG G GPVG G G PG GP G G GP GE+G G +G G ++G+ G G DG G PG G G G G G G G+ G+ G G +G G G G G+ G++G IGP+G +G PG +G G IG G QG G RG +G +G+PG G GS+G QG IG+ G G G G+ G G PG+ G G GP+GPIG G G G+ GP G PG PG N + GP GP G+ G G G G PG G G G G +GP G SG RG PG+ G G+KGNKG
Sbjct: 183 GPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKG------------------SIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKN---------------------------------------MQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG 498

HSP 5 Score: 68.5514 bits (166), Expect = 6.14767e-11
Identity = 150/365 (41.10%), Postives = 174/365 (47.67%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 6291
G GPPG G QGP GP G G G PG GP+G KG+ G +G G G G G GP G G G GN GE+GPVG +G G G G+PG PG+ GE GK G +G G G G RGP G GI G PG G GDIG TGP G G G G+ G G GP+G +GD+G G G GV+GP+G +G RG+ G LG+ G G G G RG+ GP+G PG G G G GP G PG G GP G G KG GP G+ GSIG PG++GA G +G G+ G PG G GS G GPPG
Sbjct: 459 GNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG---SKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVG---EVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI------------GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSG-----GQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGP---------------------------TGPIGSIGLKGERGPN---GIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQ 770

HSP 6 Score: 68.5514 bits (166), Expect = 6.14767e-11
Identity = 150/365 (41.10%), Postives = 174/365 (47.67%), Query Frame = -1
Query: 2902 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 3996
G GPPG G QGP GP G G G PG GP+G KG+ G +G G G G G GP G G G GN GE+GPVG +G G G G+PG PG+ GE GK G +G G G G RGP G GI G PG G GDIG TGP G G G G+ G G GP+G +GD+G G G GV+GP+G +G RG+ G LG+ G G G G RG+ GP+G PG G G G GP G PG G GP G G KG GP G+ GSIG PG++GA G +G G+ G PG G GS G GPPG
Sbjct: 459 GNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKG---SKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVG---EVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNI------------GPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSG-----GQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGP---------------------------TGPIGSIGLKGERGPN---GIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQ 770

HSP 7 Score: 63.929 bits (154), Expect = 1.61354e-09
Identity = 149/396 (37.63%), Postives = 178/396 (44.95%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSG---APGFVGPTGEKGDTGPPGEQGDLGDIXXX---------------XXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPP------------GPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 6294
G GP G +G +G GP GK G++G A G GP GE GD G GEQG +G++G G G G G GP G+ G RGP G G+ GPP GP G+IG PG P GKPG GP GP G G G G G G+ GPQG+ G RGK G +G G G Q GP G G +G G G KG G PG +GE GP GP GPIG G+KG RG +G +G+ G PG NG PGA+GP G+ +G G G +G+ G IGP GQ G G+ G PG DG +GP+G G G PG GV G +G +G G R
Sbjct: 486 GSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIP---------------------------------GKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQ--SGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGL------------------------------IGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPR 816

HSP 8 Score: 63.929 bits (154), Expect = 1.61354e-09
Identity = 149/396 (37.63%), Postives = 178/396 (44.95%), Query Frame = -1
Query: 2899 GVTGPPGARGEQGPAGPVGKEGLSG---APGFVGPTGEKGDTGPPGEQGDLGDIXXX---------------XXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPP------------GPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 3996
G GP G +G +G GP GK G++G A G GP GE GD G GEQG +G++G G G G G GP G+ G RGP G G+ GPP GP G+IG PG P GKPG GP GP G G G G G G+ GPQG+ G RGK G +G G G Q GP G G +G G G KG G PG +GE GP GP GPIG G+KG RG +G +G+ G PG NG PGA+GP G+ +G G G +G+ G IGP GQ G G+ G PG DG +GP+G G G PG GV G +G +G G R
Sbjct: 486 GSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIP---------------------------------GKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQ--SGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGL------------------------------IGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPR 816

HSP 9 Score: 58.151 bits (139), Expect = 1.09596e-07
Identity = 79/233 (33.91%), Postives = 100/233 (42.92%), Query Frame = 1
Query: 5590 DGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPG 6288
DGK GK G GP GP G G G G G G+ GP G+ G +G+RGR+G G GP+G+ G QGP G GR G +G G G+ G G G G G++GE G G PG PGL GP+G+ G++G + G++GSIG G G+ G G G G PG G++G G KG PG
Sbjct: 119 DGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGN------------AGHPGVQGISGRPGNQGEPGMQGPPGLPGL---------------------------------------------RGPEGEKGSQGGL------GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPG 288

HSP 10 Score: 58.151 bits (139), Expect = 1.09596e-07
Identity = 79/233 (33.91%), Postives = 100/233 (42.92%), Query Frame = -1
Query: 2905 DGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPG 3603
DGK GK G GP GP G G G G G G+ GP G+ G +G+RGR+G G GP+G+ G QGP G GR G +G G G+ G G G G G++GE G G PG PGL GP+G+ G++G + G++GSIG G G+ G G G G PG G++G G KG PG
Sbjct: 119 DGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGN------------AGHPGVQGISGRPGNQGEPGMQGPPGLPGL---------------------------------------------RGPEGEKGSQGGL------GIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPG 288

HSP 11 Score: 52.373 bits (124), Expect = 5.49337e-06
Identity = 134/379 (35.36%), Postives = 166/379 (43.80%), Query Frame = 1
Query: 5200 VTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTR---GPIGPVGINGRPGKKGELGDIGLTGP------QGISGPRGKRGRVGNPGEGGP---KGSQGDQGPIGLEGRA------GVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGP 6282
+ G G++G+ GP GP G GL G PG +G G +G G G QG LG GP G G+ G +G +G G+ G PG +GK G G PG+ G G+ G G G+ G G+ GK G G G PG GP GP+G G PGK G+ G G GP QG GP G G+ G PG GP KG++G +GP G G A G GP+G+ GD G GE G G G+ G G NGAPG PG + G NG D G KG IGP G G R GP G +G++GPPG+IG++G G+ GP
Sbjct: 310 IIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGS---------------PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV------------GEVGNAGIRGVNGAPGIPGKD------------------------------------------GENGKDAVDGAKGNIGPIGSSGRR------------GPQGMTGIQGPPGSIGLKGDIGSTGP 607

HSP 12 Score: 52.373 bits (124), Expect = 5.49337e-06
Identity = 134/379 (35.36%), Postives = 166/379 (43.80%), Query Frame = -1
Query: 2911 VTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTR---GPIGPVGINGRPGKKGELGDIGLTGP------QGISGPRGKRGRVGNPGEGGP---KGSQGDQGPIGLEGRA------GVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGP 3993
+ G G++G+ GP GP G GL G PG +G G +G G G QG LG GP G G+ G +G +G G+ G PG +GK G G PG+ G G+ G G G+ G G+ GK G G G PG GP GP+G G PGK G+ G G GP QG GP G G+ G PG GP KG++G +GP G G A G GP+G+ GD G GE G G G+ G G NGAPG PG + G NG D G KG IGP G G R GP G +G++GPPG+IG++G G+ GP
Sbjct: 310 IIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGS---------------PGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPV------------GEVGNAGIRGVNGAPGIPGKD------------------------------------------GENGKDAVDGAKGNIGPIGSSGRR------------GPQGMTGIQGPPGSIGLKGDIGSTGP 607
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15040144 (dd_smedV4_740_0_1|m.36260|m.3408)

HSP 1 Score: 176.792 bits (447), Expect = 6.70114e-44
Identity = 85/226 (37.61%), Postives = 125/226 (55.31%), Query Frame = 1
Query: 8116 VYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDS--IIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS* 8787
+Y DD AA +LG++ I P GTK++PAR+C HL S + DG Y+IDPNGG++ DA +V+CK+ +TCI ++ S S++ +N +L Y + N QL FLK+ S A Q + C N ++ K P ++ D++ + K H L Y VIKDECQ S EAE+V+ V + LPIRD+ + ++ S+F L + VCFS*
Sbjct: 1101 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVV------EKTEYPAIIFTDNNRELTKDDH-HLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLG-SDSDISEFRLKLSKVCFS* 1318

HSP 2 Score: 176.792 bits (447), Expect = 6.70114e-44
Identity = 85/226 (37.61%), Postives = 125/226 (55.31%), Query Frame = -1
Query:  406 VYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDDS--IIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS* 1077
+Y DD AA +LG++ I P GTK++PAR+C HL S + DG Y+IDPNGG++ DA +V+CK+ +TCI ++ S S++ +N +L Y + N QL FLK+ S A Q + C N ++ K P ++ D++ + K H L Y VIKDECQ S EAE+V+ V + LPIRD+ + ++ S+F L + VCFS*
Sbjct: 1101 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVV------EKTEYPAIIFTDNNRELTKDDH-HLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLG-SDSDISEFRLKLSKVCFS* 1318

HSP 3 Score: 63.1586 bits (152), Expect = 3.13766e-09
Identity = 146/375 (38.93%), Postives = 174/375 (46.40%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGP---------MGTSGMRGPPGNIGVEGSKGNKGPPG 6288
S G GPPG G G +G +GK G G GF G G G G G QG G G G G G G GP G G+ G GP G DG+ G GPEGK G+PG G G G+ G SG+ G RG G +G+ G PG+ G G G G G++G RG G PG GP G +G G GL G G G KG+ G+ G G+ G++G +GP G G PG GK G G PG G G G G++G G+ G G+ G +G GP GP GK G G +GP G+PG G G PGKDG GP MG G+ GPPG G G G+ G PG
Sbjct: 696 SPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPG---------------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAG---MRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGP------------------KGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPG 1028

HSP 4 Score: 63.1586 bits (152), Expect = 3.13766e-09
Identity = 146/375 (38.93%), Postives = 174/375 (46.40%), Query Frame = -1
Query: 2905 STGVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGP---------MGTSGMRGPPGNIGVEGSKGNKGPPG 4002
S G GPPG G G +G +GK G G GF G G G G G QG G G G G G G GP G G+ G GP G DG+ G GPEGK G+PG G G G+ G SG+ G RG G +G+ G PG+ G G G G G++G RG G PG GP G +G G GL G G G KG+ G+ G G+ G++G +GP G G PG GK G G PG G G G G++G G+ G G+ G +G GP GP GK G G +GP G+PG G G PGKDG GP MG G+ GPPG G G G+ G PG
Sbjct: 696 SPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPG---------------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAG---MRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGP------------------KGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPG 1028

HSP 5 Score: 60.4622 bits (145), Expect = 2.21303e-08
Identity = 155/383 (40.47%), Postives = 182/383 (47.52%), Query Frame = 1
Query: 5215 GARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXX------XXNVGERGPVGPDG---------MIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGN------PGKDGALGPMGTSGMRG---PPGNIGVEGSKGNKGPPGS 6291
G G GP GP GK GL G+ GP G G GP GEQG GD GPPG GP GP G+ G GP +G++G +GP+G G IG PG +G G G PG G G KG+ G +G KGG+G G G+DGK G G G G G NG PG KG G TGPQGI G G GR G G G +G +GD GP GL GR+G++G G G G G G G G IG G G+ G++G GPNG PG+N G G DG+ G G G G+PG RG G+ PGKDG +GP+G SG G PPG G G +G G PGS
Sbjct: 124 GRNGAGGPQGPTGKPGLMGS---QGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG---TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGP---PGIN------------------------------------------GSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGS 455

HSP 6 Score: 60.4622 bits (145), Expect = 2.21303e-08
Identity = 155/383 (40.47%), Postives = 182/383 (47.52%), Query Frame = -1
Query: 2902 GARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXX------XGNVGERGPVGPDG---------MIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGN------PGKDGALGPMGTSGMRG---PPGNIGVEGSKGNKGPPGS 3978
G G GP GP GK GL G+ GP G G GP GEQG GD GPPG GP GP G+ G GP +G++G +GP+G G IG PG +G G G PG G G KG+ G +G KGG+G G G+DGK G G G G G NG PG KG G TGPQGI G G GR G G G +G +GD GP GL GR+G++G G G G G G G G IG G G+ G++G GPNG PG+N G G DG+ G G G G+PG RG G+ PGKDG +GP+G SG G PPG G G +G G PGS
Sbjct: 124 GRNGAGGPQGPTGKPGLMGS---QGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG---TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGP---PGIN------------------------------------------GSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGS 455

HSP 7 Score: 58.151 bits (139), Expect = 1.10504e-07
Identity = 135/352 (38.35%), Postives = 158/352 (44.89%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIG 6252
GV GP G +G++G G G EG+ GAPG G G GD G PGE G G G+ G +G GP G+IG G G+ G LDG G G +G GP G+NGR G G +G G GP G G RG GR+G PG G G++G QGP G G G G G+ G G G G+ G GP G G G+ G G GP G G PG N PG G G G G G G GP+G+PGP G+ G G G G +G GN G G G PG GS G PG G GP G +G+RGP G G
Sbjct: 232 GVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG---------------------IPGSKGSQGGTGPQGIIGNAGATGRPG---------------------------------LDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKG 529

HSP 8 Score: 58.151 bits (139), Expect = 1.10504e-07
Identity = 135/352 (38.35%), Postives = 158/352 (44.89%), Query Frame = -1
Query: 2941 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIG 3996
GV GP G +G++G G G EG+ GAPG G G GD G PGE G G G+ G +G GP G+IG G G+ G LDG G G +G GP G+NGR G G +G G GP G G RG GR+G PG G G++G QGP G G G G G+ G G G G+ G GP G G G+ G G GP G G PG N PG G G G G G G GP+G+PGP G+ G G G G +G GN G G G PG GS G PG G GP G +G+RGP G G
Sbjct: 232 GVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG---------------------IPGSKGSQGGTGPQGIIGNAGATGRPG---------------------------------LDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKG 529

HSP 9 Score: 57.7658 bits (138), Expect = 1.45895e-07
Identity = 156/381 (40.94%), Postives = 189/381 (49.61%), Query Frame = 1
Query: 5218 ARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGP---------DGMIGPPGPEG------------KIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGP---DGKSGNKGAIGPTGQPGVRGSIGNPGKDGA---LGPMGTSGMRGPPGNIGVEGSKGNKG 6279
ARG +G GP GK+G++G PG G PG+ G +G G G GP G PG +G G +G++G GP+GP GM GPPGP+G K+GSPG PG G+ G G G+ I G G GKPG G G G G PG+ G GDIG TG G G G +G VG PG+ G G G G G G G +GP+G KG G G G G G GP G DG+ G+ GP G PG+PGL+G PG G PG+ G G+ G G+ G G PG E G NG DG+ G G G TGQPG RG G G GA +G +G G +G PGN G +G GN+G
Sbjct: 545 ARGVRGKPGPPGKDGVNGKPG---------KDGKPGDLGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGG-----SGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGN---VGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG---------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 899

HSP 10 Score: 57.7658 bits (138), Expect = 1.45895e-07
Identity = 156/381 (40.94%), Postives = 189/381 (49.61%), Query Frame = -1
Query: 2914 ARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGP---------DGMIGPPGPEG------------KIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGP---DGKSGNKGAIGPTGQPGVRGSIGNPGKDGA---LGPMGTSGMRGPPGNIGVEGSKGNKG 3975
ARG +G GP GK+G++G PG G PG+ G +G G G GP G PG +G G +G++G GP+GP GM GPPGP+G K+GSPG PG G+ G G G+ I G G GKPG G G G G PG+ G GDIG TG G G G +G VG PG+ G G G G G G G +GP+G KG G G G G G GP G DG+ G+ GP G PG+PGL+G PG G PG+ G G+ G G+ G G PG E G NG DG+ G G G TGQPG RG G G GA +G +G G +G PGN G +G GN+G
Sbjct: 545 ARGVRGKPGPPGKDGVNGKPG---------KDGKPGDLGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGG-----SGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGN---VGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG---------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 899

HSP 11 Score: 54.6842 bits (130), Expect = 1.02864e-06
Identity = 128/355 (36.06%), Postives = 155/355 (43.66%), Query Frame = 1
Query: 5224 GEQGPAGPVGKEGLSGAPGFVGPTGEKG---DTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGP---PGNIGVEGSKG 6270
GE G G +GK G +GAPG +G G G D GPPG G G IG G+ G G PG G G +G G+ GP G DG+ G PG +GK PG G +G G+ G G G G AG GL G G G GP+G GI+G PG G G G G G+SG GK G G PG G GS G G + + GR+ G G KG GE G G PG PG GE+GP G G +G GA+G +PG +G +G PGKDG G +G G +GP PG +G +G+KG
Sbjct: 481 GENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGK------PGDLGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRS-----------------------------SGGSGTKGKPGEDGDAGKPGSPG---------------------------------------SPGEIGPPGDIGPTGQSGALG---KPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKG 758

HSP 12 Score: 54.6842 bits (130), Expect = 1.02864e-06
Identity = 128/355 (36.06%), Postives = 155/355 (43.66%), Query Frame = -1
Query: 2923 GEQGPAGPVGKEGLSGAPGFVGPTGEKG---DTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGP---PGNIGVEGSKG 3969
GE G G +GK G +GAPG +G G G D GPPG G G IG G+ G G PG G G +G G+ GP G DG+ G PG +GK PG G +G G+ G G G G AG GL G G G GP+G GI+G PG G G G G G+SG GK G G PG G GS G G + + GR+ G G KG GE G G PG PG GE+GP G G +G GA+G +PG +G +G PGKDG G +G G +GP PG +G +G+KG
Sbjct: 481 GENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGK------PGDLGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRS-----------------------------SGGSGTKGKPGEDGDAGKPGSPG---------------------------------------SPGEIGPPGDIGPTGQSGALG---KPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSPGKVGPQGAKG 758

HSP 13 Score: 54.299 bits (129), Expect = 1.62064e-06
Identity = 41/84 (48.81%), Postives = 51/84 (60.71%), Query Frame = 1
Query: 5590 DGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGD 5841
DG G+PG +GP G G G+PGK G+ G IG GPQ GP G+ GR G G GGP+G G G +G +G G+ GPKG G+
Sbjct: 78 DGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGPVGPQ---GPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGE 158

HSP 14 Score: 54.299 bits (129), Expect = 1.62064e-06
Identity = 41/84 (48.81%), Postives = 51/84 (60.71%), Query Frame = -1
Query: 3352 DGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKGD 3603
DG G+PG +GP G G G+PGK G+ G IG GPQ GP G+ GR G G GGP+G G G +G +G G+ GPKG G+
Sbjct: 78 DGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGPVGPQ---GPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGE 158

HSP 15 Score: 51.9878 bits (123), Expect = 6.49966e-06
Identity = 124/350 (35.43%), Postives = 146/350 (41.71%), Query Frame = 1
Query: 5419 VGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGD------------IGLTGPQGISGPRGKRGR------------------VGNPGEGGP------KGSQGDQGPIG------------------------LEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPG 6288
G +GP GP+G GP GP G G G P GK GKPG GP+GP G NGR G+ G G +G GPQG++GP+G G +G G GP +G G QGPIG + G GV+GP G KGDRG G+ G G DG G G+ G G PG PG +G G G G G G G G G GRPG +G G +G G +GP G +G G IG G PG G IGNPG G G +GT G RG P G +GS+G GPPG
Sbjct: 72 AGLQGPDGPEGRPGPKGPNGLTGPQGKP------------------------------GKDGKPGPIGPVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIP---GTKGSQGPNGPPG 379

HSP 16 Score: 51.9878 bits (123), Expect = 6.49966e-06
Identity = 124/350 (35.43%), Postives = 146/350 (41.71%), Query Frame = -1
Query: 2905 VGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGD------------IGLTGPQGISGPRGKRGR------------------VGNPGEGGP------KGSQGDQGPIG------------------------LEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPG 3774
G +GP GP+G GP GP G G G P GK GKPG GP+GP G NGR G+ G G +G GPQG++GP+G G +G G GP +G G QGPIG + G GV+GP G KGDRG G+ G G DG G G+ G G PG PG +G G G G G G G G G GRPG +G G +G G +GP G +G G IG G PG G IGNPG G G +GT G RG P G +GS+G GPPG
Sbjct: 72 AGLQGPDGPEGRPGPKGPNGLTGPQGKP------------------------------GKDGKPGPIGPVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIP---GTKGSQGPNGPPG 379
BLAST of collagen vs. RefSeq Human
Match: gi|48762934|ref|NP_000080.2| (collagen alpha-2(I) chain precursor [Homo sapiens])

HSP 1 Score: 142.124 bits (357), Expect = 1.51783e-32
Identity = 69/223 (30.94%), Postives = 116/223 (52.02%), Query Frame = 1
Query: 8155 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW-NSPILNGPTWLQKLINK-NEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ N+ ++W S WL + IN ++ +Y+V QLAF+++ ++ A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LP D+ I +F + I VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365

HSP 2 Score: 142.124 bits (357), Expect = 1.51783e-32
Identity = 69/223 (30.94%), Postives = 116/223 (52.02%), Query Frame = -1
Query:  412 NNAIKN---PQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSW-NSPILNGPTWLQKLINK-NEIQYSVPN-------NQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLLADDD-SIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVK-DVANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1038
NN I+ P+G+++ PARTC+ L +P+ G YWIDPN G DA+KVYC S +TCI++ N+ ++W S WL + IN ++ +Y+V QLAF+++ ++ A Q +T++C+N +E+ N A L +D ++ + + Y+V+ D C + +++IE K + + LP D+ I +F + I VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365

HSP 3 Score: 56.225 bits (134), Expect = 1.84166e-06
Identity = 92/228 (40.35%), Postives = 114/228 (50.00%), Query Frame = 1
Query: 5191 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIG---LTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 5838
G GPPG GE+GP+G G +GL GAPG +G G +G+ G PG G +G+ GP G AGP G G G G G G G G DG G GP G+ G PG KG +G G G G +G PG GP+GP G +G G+ G G +G GP+G SGP+G RG G PGE GP+G G +G GL+G G+ G G +G
Sbjct: 833 EVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGH------------------KGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQG 1042

HSP 4 Score: 56.225 bits (134), Expect = 1.84166e-06
Identity = 92/228 (40.35%), Postives = 114/228 (50.00%), Query Frame = -1
Query: 3355 STGVTGPPGARGEQGPAG---------PVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIG---LTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKGQKG 4002
G GPPG GE+GP+G G +GL GAPG +G G +G+ G PG G +G+ GP G AGP G G G G G G G G DG G GP G+ G PG KG +G G G G +G PG GP+GP G +G G+ G G +G GP+G SGP+G RG G PGE GP+G G +G GL+G G+ G G +G
Sbjct: 833 EVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGH------------------KGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQG 1042
BLAST of collagen vs. RefSeq Human
Match: gi|767902458|ref|XP_011539022.1| (PREDICTED: collagen alpha-1(XI) chain isoform X2 [Homo sapiens])

HSP 1 Score: 126.716 bits (317), Expect = 7.153e-28
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = 1
Query: 8164 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 1004 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1215

HSP 2 Score: 126.716 bits (317), Expect = 7.153e-28
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = -1
Query:  412 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1029
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 1004 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1215
BLAST of collagen vs. RefSeq Human
Match: gi|767902460|ref|XP_011539023.1| (PREDICTED: collagen alpha-1(XI) chain isoform X3 [Homo sapiens])

HSP 1 Score: 120.939 bits (302), Expect = 3.60839e-26
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = 1
Query: 8164 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 789 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1000

HSP 2 Score: 120.939 bits (302), Expect = 3.60839e-26
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = -1
Query:  412 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1029
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 789 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1000
BLAST of collagen vs. RefSeq Human
Match: gi|299523253|ref|NP_542197.3| (collagen alpha-1(XI) chain isoform C preproprotein [Homo sapiens])

HSP 1 Score: 120.939 bits (302), Expect = 4.6253e-26
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = 1
Query: 8164 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 1477 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1688

HSP 2 Score: 120.939 bits (302), Expect = 4.6253e-26
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = -1
Query:  412 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1029
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 1477 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1688
BLAST of collagen vs. RefSeq Human
Match: gi|299523257|ref|NP_001177638.1| (collagen alpha-1(XI) chain isoform E preproprotein [Homo sapiens])

HSP 1 Score: 119.783 bits (299), Expect = 1.09513e-25
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = 1
Query: 8164 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 8781
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 1554 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1765

HSP 2 Score: 119.783 bits (299), Expect = 1.09513e-25
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = -1
Query:  412 IKNPQGTKEVPARTCKHLSSVNPQAPDGEYWIDPNGGRIEDAVKVYCKISE-QKTCIKSIDNNLSIRSWNSPILNGPTWLQKLINKNEIQY------SVPNNQLAFLKVYSDNAVQRVTFNCENHPIIGNEKIFNKVTAPRLL-ADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIEVKD-VANLLPIRDVGIHIINNRKSKFGLTIEDVCF 1029
+K P GT+ PARTCK L +P PDGEYWIDPN G D+ KVYC + +TCI + +R + P +W + + Y S+ Q+ FLK+ + +A Q T++C + + A R L ++D+ + +P +K + D C K E ++VIE+ + +PI DV I+ ++ KFG + VCF
Sbjct: 1554 MKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIK--TLYDGCASRKGYE-KTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCF 1765
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|17137252|ref|NP_477190.1| (viking, isoform A [Drosophila melanogaster])

HSP 1 Score: 61.2326 bits (147), Expect = 2.17962e-08
Identity = 93/241 (38.59%), Postives = 116/241 (48.13%), Query Frame = 1
Query: 5611 GTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGL---EGRAGVLGP--KGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRG---------SIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 6291
G RGP G G G PG G G IGLTGP+G+ G +G GR G+ G GP G G+ G +G +G+A +G KG+ GD G G G+ G G G G DG KG RGE+G G GD G G+ G G G G PG + +G G DG G +G G TG GV+G + G PG+DG GP G G +G G IG+ G G++GP G
Sbjct: 534 GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---------------IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759

HSP 2 Score: 61.2326 bits (147), Expect = 2.17962e-08
Identity = 93/241 (38.59%), Postives = 116/241 (48.13%), Query Frame = -1
Query: 2902 GTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGL---EGRAGVLGP--KGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRG---------SIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 3582
G RGP G G G PG G G IGLTGP+G+ G +G GR G+ G GP G G+ G +G +G+A +G KG+ GD G G G+ G G G G DG KG RGE+G G GD G G+ G G G G PG + +G G DG G +G G TG GV+G + G PG+DG GP G G +G G IG+ G G++GP G
Sbjct: 534 GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---------------IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|442626067|ref|NP_001260071.1| (viking, isoform B [Drosophila melanogaster])

HSP 1 Score: 61.2326 bits (147), Expect = 2.17962e-08
Identity = 93/241 (38.59%), Postives = 116/241 (48.13%), Query Frame = 1
Query: 5611 GTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGL---EGRAGVLGP--KGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRG---------SIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 6291
G RGP G G G PG G G IGLTGP+G+ G +G GR G+ G GP G G+ G +G +G+A +G KG+ GD G G G+ G G G G DG KG RGE+G G GD G G+ G G G G PG + +G G DG G +G G TG GV+G + G PG+DG GP G G +G G IG+ G G++GP G
Sbjct: 534 GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---------------IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759

HSP 2 Score: 61.2326 bits (147), Expect = 2.17962e-08
Identity = 93/241 (38.59%), Postives = 116/241 (48.13%), Query Frame = -1
Query: 2902 GTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGL---EGRAGVLGP--KGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRG---------SIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 3582
G RGP G G G PG G G IGLTGP+G+ G +G GR G+ G GP G G+ G +G +G+A +G KG+ GD G G G+ G G G G DG KG RGE+G G GD G G+ G G G G PG + +G G DG G +G G TG GV+G + G PG+DG GP G G +G G IG+ G G++GP G
Sbjct: 534 GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---------------IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|442626069|ref|NP_001260072.1| (viking, isoform C [Drosophila melanogaster])

HSP 1 Score: 61.2326 bits (147), Expect = 2.17962e-08
Identity = 93/241 (38.59%), Postives = 116/241 (48.13%), Query Frame = 1
Query: 5611 GTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGL---EGRAGVLGP--KGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRG---------SIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 6291
G RGP G G G PG G G IGLTGP+G+ G +G GR G+ G GP G G+ G +G +G+A +G KG+ GD G G G+ G G G G DG KG RGE+G G GD G G+ G G G G PG + +G G DG G +G G TG GV+G + G PG+DG GP G G +G G IG+ G G++GP G
Sbjct: 534 GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---------------IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759

HSP 2 Score: 61.2326 bits (147), Expect = 2.17962e-08
Identity = 93/241 (38.59%), Postives = 116/241 (48.13%), Query Frame = -1
Query: 2902 GTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGL---EGRAGVLGP--KGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRG---------SIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGS 3582
G RGP G G G PG G G IGLTGP+G+ G +G GR G+ G GP G G+ G +G +G+A +G KG+ GD G G G+ G G G G DG KG RGE+G G GD G G+ G G G G PG + +G G DG G +G G TG GV+G + G PG+DG GP G G +G G IG+ G G++GP G
Sbjct: 534 GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYL---------------IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGE 759
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|45549584|ref|NP_573262.2| (CG6867 [Drosophila melanogaster])

HSP 1 Score: 59.3066 bits (142), Expect = 6.01357e-08
Identity = 42/86 (48.84%), Postives = 47/86 (54.65%), Query Frame = 1
Query: 7600 SGGKGYDGQTGTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGT--PGREGKPGPRGAKGTKGPKGVPGYPGRPGI 7851
+G G DG+ G G+ G G PG GADGK G G G GL G GK G T G +G PG RG KG GP+G PG PG GI
Sbjct: 320 TGRAGLDGRDGVPGEPGLDGVPGRAGADGKNGLPGRDGKDGLHGKDGKDGLSITGPKGAQGPPGERGLKGIAGPRGRPGKPGTNGI 405

HSP 2 Score: 59.3066 bits (142), Expect = 6.01357e-08
Identity = 42/86 (48.84%), Postives = 47/86 (54.65%), Query Frame = -1
Query: 1342 SGGKGYDGQTGTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGT--PGREGKPGPRGAKGTKGPKGVPGYPGRPGI 1593
+G G DG+ G G+ G G PG GADGK G G G GL G GK G T G +G PG RG KG GP+G PG PG GI
Sbjct: 320 TGRAGLDGRDGVPGEPGLDGVPGRAGADGKNGLPGRDGKDGLHGKDGKDGLSITGPKGAQGPPGERGLKGIAGPRGRPGKPGTNGI 405
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581820|ref|NP_723044.1| (collagen type IV, isoform A [Drosophila melanogaster])

HSP 1 Score: 58.151 bits (139), Expect = 1.62944e-07
Identity = 130/392 (33.16%), Postives = 166/392 (42.35%), Query Frame = 1
Query: 5197 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXX--XXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGP---VGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGS------QGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGV---------------RGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 6294
G++G PG +GE GPVG +G +GAPG P GE+G G PG + DI + GERG GP G+ G G G G PG+ G G E G G+ GL G+ G+ G +G IG +G G PG GE G +GL GP G +G +G+RG G+PG+ G G +GD GP G +G G+ G +GQKGD+G G G +G G +G G G G G GP GAPG+ G GP G DG+ G G G G+PG+ G G PG+ G G +G G RG G G+ G GN G PG +
Sbjct: 1180 GLSGLPGLKGE---TGPVGLQGFTGAPG---PKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKG-----EQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGF------------------------------------------TGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPK 1518

HSP 2 Score: 58.151 bits (139), Expect = 1.62944e-07
Identity = 130/392 (33.16%), Postives = 166/392 (42.35%), Query Frame = -1
Query: 2899 GVTGPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXX--XXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGP---VGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGS------QGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGV---------------RGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPGSR 3996
G++G PG +GE GPVG +G +GAPG P GE+G G PG + DI + GERG GP G+ G G G G PG+ G G E G G+ GL G+ G+ G +G IG +G G PG GE G +GL GP G +G +G+RG G+PG+ G G +GD GP G +G G+ G +GQKGD+G G G +G G +G G G G G GP GAPG+ G GP G DG+ G G G G+PG+ G G PG+ G G +G G RG G G+ G GN G PG +
Sbjct: 1180 GLSGLPGLKGE---TGPVGLQGFTGAPG---PKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKG-----EQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGF------------------------------------------TGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPK 1518

HSP 3 Score: 56.225 bits (134), Expect = 7.33254e-07
Identity = 124/377 (32.89%), Postives = 150/377 (39.79%), Query Frame = 1
Query: 5215 GARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGK---------KGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGR--AGVLGP--------KGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPG 6288
G RG GP GP G +G G PG GP+G+KG G PG G GD GERG G G G PG +G G+PG+P G G G G+ G GL+G SG PG RG G +G G G+ KGE G+ G G G++GP+G G G G+ GP G++G +G GL+G A GP KG+KG+ + V G RG+ G G PG G GE GP G G G KG G G PG RG GN G G+ G G RG PG G+ G+ G KG PG
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGD------------------------KGERGSPGLHGQAGVPGVQGPAGNPGAP------------GINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHT-----------VMGPRGDMGQKGEPGLVGRK---------------------------------------GEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGS---TGQKGDRGEPGLNGLPGNPGQKGEPG 376

HSP 4 Score: 56.225 bits (134), Expect = 7.33254e-07
Identity = 124/377 (32.89%), Postives = 150/377 (39.79%), Query Frame = -1
Query: 2905 GARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGK---------KGELGDIGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGR--AGVLGP--------KGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGPNGPDGKSGNKGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKGPPG 3978
G RG GP GP G +G G PG GP+G+KG G PG G GD GERG G G G PG +G G+PG+P G G G G+ G GL+G SG PG RG G +G G G+ KGE G+ G G G++GP+G G G G+ GP G++G +G GL+G A GP KG+KG+ + V G RG+ G G PG G GE GP G G G KG G G PG RG GN G G+ G G RG PG G+ G+ G KG PG
Sbjct: 89 GNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGD------------------------KGERGSPGLHGQAGVPGVQGPAGNPGAP------------GINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHT-----------VMGPRGDMGQKGEPGLVGRK---------------------------------------GEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGS---TGQKGDRGEPGLNGLPGNPGQKGEPG 376

HSP 5 Score: 53.5286 bits (127), Expect = 4.65647e-06
Identity = 96/262 (36.64%), Postives = 114/262 (43.51%), Query Frame = 1
Query: 5206 GPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXXNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGE-------GGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXXDGVKGSRGESGPNGAPGDPGLN 5970
GP G RG+ GPAG G G G PG G GPPGE+GD G G GR G GE+G G G+ G PG +G +G+PG PG PG G G G G G PG RG G G++G PG KGE G +GL G G GP+G+RG G PG G KGSQG++G G +G G G G G V G++G+ G G PG GLN
Sbjct: 1070 GPSGLRGDTGPAGTPGWPGEKGLPGLA----VHGRAGPPGEKGDQGRSGIDGRDGIN---------------GEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPG---------------AVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAG------------------------VAGAKGDRGLQGPPGASGLN 1273

HSP 6 Score: 53.5286 bits (127), Expect = 4.65647e-06
Identity = 96/262 (36.64%), Postives = 114/262 (43.51%), Query Frame = -1
Query: 3223 GPPGARGEQGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIXXXXXXXXXXXXXXXXXXXXXGNVGERGPVGPDGMIGPPGPEGKIGSPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDGKSGKPGTRGPIGPVGINGRPGKKGELGDIGLTGPQGISGPRGKRGRVGNPGE-------GGPKGSQGDQGPIGLEGRAGVLGPKGQKGDXXXXXXXXXXXXXXXXXXXXPDGVKGSRGESGPNGAPGDPGLN 3987
GP G RG+ GPAG G G G PG G GPPGE+GD G G GR G GE+G G G+ G PG +G +G+PG PG PG G G G G G PG RG G G++G PG KGE G +GL G G GP+G+RG G PG G KGSQG++G G +G G G G G V G++G+ G G PG GLN
Sbjct: 1070 GPSGLRGDTGPAGTPGWPGEKGLPGLA----VHGRAGPPGEKGDQGRSGIDGRDGIN---------------GEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPG---------------AVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAG------------------------VAGAKGDRGLQGPPGASGLN 1273
The following BLAST results are available for this feature:
BLAST of collagen vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|8134352|sp|O46392|CO1A2_CANFA4.781310e-3331.25RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|123797137|sp|Q3U962|CO5A2_MOUSE3.482820e-3234.39RecName: Full=Collagen alpha-2(V) chain; Flags: Pr... [more]
gi|296439507|sp|P08123|CO1A2_HUMAN4.021710e-3230.94RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|8039779|sp|P02465|CO1A2_BOVIN7.195300e-3229.72RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|18202250|sp|O93484|CO1A2_ONCMY3.978400e-3130.49RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
back to top
BLAST of collagen vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150400334.322970e-13880.35dd_smedV4_702_0_1|m.35199|m.6295[more]
SMU150022714.437280e-7349.14Asxlregen_comp67208_c0_seq1|m.27270|m.10319[more]
SMU150364693.422340e-5338.91dd_smedV4_1070_0_1|m.1593|m.7941[more]
SMU150292082.533080e-4535.84SmedSxlregen_c102983_g1_i1|m.43148|m.11576[more]
SMU150401446.701140e-4437.61dd_smedV4_740_0_1|m.36260|m.3408[more]
back to top
BLAST of collagen vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|48762934|ref|NP_000080.2|1.517830e-3230.94collagen alpha-2(I) chain precursor [Homo sapiens][more]
gi|767902458|ref|XP_011539022.1|7.153000e-2831.63PREDICTED: collagen alpha-1(XI) chain isoform X2 [... [more]
gi|767902460|ref|XP_011539023.1|3.608390e-2631.63PREDICTED: collagen alpha-1(XI) chain isoform X3 [... [more]
gi|299523253|ref|NP_542197.3|4.625300e-2631.63collagen alpha-1(XI) chain isoform C preproprotein... [more]
gi|299523257|ref|NP_001177638.1|1.095130e-2531.63collagen alpha-1(XI) chain isoform E preproprotein... [more]
back to top
BLAST of collagen vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17137252|ref|NP_477190.1|2.179620e-838.59viking, isoform A [Drosophila melanogaster][more]
gi|442626067|ref|NP_001260071.1|2.179620e-838.59viking, isoform B [Drosophila melanogaster][more]
gi|442626069|ref|NP_001260072.1|2.179620e-838.59viking, isoform C [Drosophila melanogaster][more]
gi|45549584|ref|NP_573262.2|6.013570e-848.84CG6867 [Drosophila melanogaster][more]
gi|24581820|ref|NP_723044.1|1.629440e-733.16collagen type IV, isoform A [Drosophila melanogast... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_024746 ID=Ddo_024746|Name=collagen|organism=Dugesia dorotocephala|type=mRNA|length=9192bp
TCGAGGAAAGAAATTTGGAAATCATTTTCTCCAAAAGACATTAAAAAACA
TAAGAAAACATACGAAACATTATATTAGAACACATCATGTAACTATGATG
ATCTCTCAAGTAACTTTTCAAGCAATTGGTGGAAGGGTATTGAAACTCAA
TTGTATGTACGAATAAGAACCACAGTAAGTTTCATAATCTGTGTGAAAGA
AACTGAACATGTATTTTGAATGAATGCAGTTTTAGTAGACTTTTAAGTTG
ACCAGATAGTAATGATGGATGATCTAACCTGTCGACATTTACAAAAGTAT
TGTCAAAGAAAATTATTATTGATAAATTACAGCAAAAATAAATTCCATTT
AAAGAAACAGCTAATAAGAAAAAAATGTACAATCACTTGACACTGTCGAG
ATGAATTATGAAAAACAGACGTCTTCAATGGTCAATCCGAACTTGCTTTT
TCTATTATTTATTATATGGATCCCGACATCTCGAATCGGTAGTAAATTGG
CGACATCTTTAACTTCTATTACACTTTCCGCTTCACTGGATTTGGAATAT
TGGCATTCGTCTTTAATCACTGAGTACTTCAGTTTGGGATGTGTCATCTT
TATGATACTATCATCGTCTGCCAATAAGCGGGGCGCGGTAACCTTATTAA
AAATCTTCTCATTTCCTATTATAGGATGATTTTCGCAATTGAATGTCACT
CTCTGTACGGCGTTATCACTATAAACTTTAAGAAACGCCAATTGATTATT
TGGTACTGAATATTGTATTTCATTTTTGTTAATTAGTTTTTGTAACCATG
TCGGACCATTAAGTATTGGACTATTCCATGACCTAATGCTGAGATTATTA
TCAATGGATTTGATACAGGTTTTTTGCTCAGAAATTTTACAATAAACCTT
AACGGCATCTTCTATTCGACCTCCATTCGGATCTATCCAGTACTCACCAT
CAGGTGCTTGAGGATTTACTGAACTAAGATGTTTGCAGGTTCTAGCTGGT
ACTTCTTTTGTTCCTTGAGGATTTTTAATAGCATTATTTCCAAGGAGTTC
TGCTGCCTTCGGATCATCTCCGTATACAACACCTTTAGTGGGTGATCGCA
TCTGCATTGCCATTACGCCTCCTGGAGGTCCAGGTGGACCTGGTGGTCCC
AACGGTCCTCTTTGGCCAGCAGGACCAGTTCCACCTGGTTTACCTGGTGG
TCCAGTAGGTCCAATTGCACCTGGTATTCCAGGGTCTCCACGAGGTCCGA
ATATTCCAACTGGTCCTTGTAAACCGTCAGGGCCTTTAGGGCCTGTTGGT
CCATCGGGTCCGGAATAACCTGGAGGTCCTGGATCTCCTTCAATTCCTGG
TCTTCCGGGATATCCAGGAACTCCTTTTGGACCTTTAGTTCCTTTAGCTC
CTCGAGGACCCGGTTTTCCTTCCCTACCTGGAGTTCCATCTGTTCCTTTT
TTTCCTTTTGCACCTCTTAAACCAGTATCGCCAAGAAGACCATTTGGCCC
TGGTTTTCCATCTGCTCCCTTTTCACCGGGAGCTCCAATTTTACCCGATT
TGCCACTAGTTCCGGTCTGTCCATCGTACCCTTTACCACCACTAGTTCCA
TCTTTCCCAGGTTTACCTGCTGCACCTTTACTTCCAGGTGGTCCCGGATC
ACCTCTTGGTCCTACTGGTCCAGTAAGACCAGGTACACCAAGTGGTCCTT
GAGGACCAGGTTTTCCCATTTCACCATGGTCTCCCTGTAAACCTATACCT
CCAGTTGGACCTGGTTTACCAGGTTTACCAGCTATTCCTTGAGGTCCAGG
TTGACCCGGTGGACCCAAATACCCAGGAAATCCATCAGTTCCAGGGGTTC
CAACTTTTCCATCAATTCCAGGTCCTCCTGATTTTCCCTTTGGTCCGGGT
GGACCTCTTAAACCTAAGGGGCCCTTACGGCCATTAGCTGCATCTAATCC
TGCCAAACCAGGAGGGCCTGTTGGGCCCGGTTTTCCAGAAGGCCCCTGCT
TGCCTTGATTTCCAGATTTTCCTTGTTTACCTGGACCTCCAGCACTTCCT
ACTCTACCCGGATCTCCTCTAGGACCACTAGGACCAGATTTTCCAGGTTC
ACCAATATCTCCAGGCAGTCCAGCGGGTCCTTCTGGTCCATCCACACCGC
TTGGTCCAGGTTTTCCAGCAGCTCCTGGTTTTCCAGGGTTTCCATCTTTA
CCTGAATCACCGATTGCTCCAACTGATCCCATATCTCCAGGATCCCCTGG
ATCACCAGGGGGTCCTTCAGAACCTTGTTTTCCAACCGGTCCCACATCCC
CAGGAATTCCATCTGCTCCCGGCTTACCAATCGGACCTCTTATGCCGGCA
GACCCAACACTTCTAGGTTTTTGTTTATCTACACCTTCACCACCGGCATT
TCCAGGAGTTCCAGCAGGTCCAGGAGGACCTCTAGGTCCTGTACCTCCTG
GGCTTCCTGGTGTACCTGGAGGTCCTAATTCTCCTTCAAGACCTTGTTTT
CCGATCACACCTAAAGAACCCGGAGGTCCATTGGGACCATAATTACCAGG
AACACCTATTATTCCCGGAGAGCCTTTCAGACCAGTAGGCCCCGGAGGTC
CAAGGCTGCCTCTATCTCCATCAGGTCCAGGAATTCCTGGTTTTCCAGGT
GCTCCTGGTGGCCCTACTTTTCCAGGTTTTCCAACGTTTCCAGGGTCTCC
ATTTTTTCCATTGACACCTTGACTACCAGCATAACCAACAGGACCAATTA
AACCAACTGGTCCCTTTGGTCCCGGTGCTCCTGGATCACCAGATGATCCT
GGAAATCCAGGATTACCCATATTTCCAACAGGACCTTCACTGCCGTTAAC
CCCAGGCTTTCCCGGTGGACCAACTTTTCCCGCACTTCCAACTTTTCCTC
TAGAACCAGGAGGACCTTTATTTCCCTTACTTCCTTCTACTCCTATATTT
CCTGGTGGACCTCTCATGCCTGAGGTACCCATTGGACCAAGCGCTCCATC
TTTACCAGGATTTCCAATTGAGCCTCGTACTCCTGGTTGACCAGTAGGTC
CTATGGCTCCTTTATTTCCGGACTTTCCATCAGGACCATTCGGACCGACT
TCTCCTCTTGGACCGGGTGCACCATTTGGACCAGGTCTACCCATCGGTCC
GGTTTGGCCACCAGGTCCAGCATCTCCAGGAGTACCAGGAATACCTGGAG
GACCAATGGCTCCAGGCTTTCCATTTAATCCAGGATCTCCAGGTGCACCA
TTTGGACCACTCTCTCCTCTACTTCCTTTAACTCCATCGGGACCTATCGG
CCCAATTGGTCCTAATGGTCCAGCTTCACCCAGTTCTCCTGGGCGACCTC
TATCCCCTTTTTGACCTTTAGGGCCCAATACACCAGCTCTTCCTTCTAGA
CCAATAGGCCCTTGATCTCCTTGAGAACCTTTAGGTCCTCCTTCTCCGGG
ATTACCAACTCTTCCTCGTTTACCTCTCGGACCAGAAATACCCTGAGGCC
CAGTAAGTCCAATGTCACCTAACTCACCCTTTTTACCAGGTCTTCCATTT
ATACCAACAGGTCCTATTGGTCCTCGCGTCCCTGGTTTTCCAGATTTTCC
ATCAAGACCAGTTTTACCAGCTTCGCCTTTACCACCTTTTATTCCTTCAT
CTCCACCTTCACCTTTTTTTCCCACTTCACCAGGTCTACCTGGAGACCCA
GGTGACCCAATTTTACCTTCTGGTCCTGGAGGACCAATCATTCCATCAGG
ACCAACTGGTCCTCTTTCACCGACATTACCTTGAGGACCAGTAGGACCAG
ATTGTCCAGGAGGCCCAATAGGACCGGCTCTCCCTGGGGGACCAATATCA
CCAAGATCACCTTGTTCTCCAGGAGGTCCAGTGTCTCCTTTTTCTCCGGT
TGGTCCTACAAATCCGGGTGCTCCACTGAGACCCTCTTTTCCAACAGGAC
CAGCGGGACCTTGTTCACCTCTTGCACCCGGGGGACCAGTGACACCTGTA
CTTCCTGGTTTACCATCAGGTCCTGCATTTCCATTAGGCCCAGGAGCTCC
AGGTTGTCCCCTTAACCCATCTTTACCAGTGGGACCAGGGGGTCCTGTTG
GACCAGGATCCCCATCGGGACCCGGTTTACCAGGTTTTCCGGGATTTCCC
CTAATTCCAGCTGGTCCAACAGCTTCATTAAGAGTTCTGAATTGGCCATA
ACTATTTCCAATAAACAACAAAATCAAAAAAACACATCCAGAAAGAATTG
ATATTTTGAGCATTCTGAAATCTTAAGTTCCAGAAAGAACTGTTCGTTAA
GATAAAATCCAATTTAATGCAAATTCAATGTTTCGTATAATCCCCAAAAA
GTTGTTGTTAACAGTTTAAAAATTATTTTTTATATAATAAAATACACTTT
CAATATATCTGCAAGAAATCCGATTGGTGGAAATTTCACAGTTTTAATAC
ATAACACAGCATCACTTTCCTTTAGTCGAAGATAAATGTATAGAAATGCA
ATAACCTTTAAGTGTACAAATCAATACATGCATAGGGATAGTTGTGTTGT
GTGACATTTATCCCAGAATAGAAGACATTCGAAATTTTAAATTAATATTA
ATTTAAAATTTCGAATGTCTTCTATTCTGGGATAAATGTCACACAACACA
ACTATCCCTATGCATGTATTGATTTGTACACTTAAAGGTTATTGCATTTC
TATACATTTATCTTCGACTAAAGGAAAGTGATGCTGTGTTATGTATTAAA
ACTGTGAAATTTCCACCAATCGGATTTCTTGCAGATATATTGAAAGTGTA
TTTTATTATATAAAAAATAATTTTTAAACTGTTAACAACAACTTTTTGGG
GATTATACGAAACATTGAATTTGCATTAAATTGGATTTTATCTTAACGAA
CAGTTCTTTCTGGAACTTAAGATTTCAGAATGCTCAAAATATCAATTCTT
TCTGGATGTGTTTTTTTGATTTTGTTGTTTATTGGAAATAGTTATGGCCA
ATTCAGAACTCTTAATGAAGCTGTTGGACCAGCTGGAATTAGGGGAAATC
CCGGAAAACCTGGTAAACCGGGTCCCGATGGGGATCCTGGTCCAACAGGA
CCCCCTGGTCCCACTGGTAAAGATGGGTTAAGGGGACAACCTGGAGCTCC
TGGGCCTAATGGAAATGCAGGACCTGATGGTAAACCAGGAAGTACAGGTG
TCACTGGTCCCCCGGGTGCAAGAGGTGAACAAGGTCCCGCTGGTCCTGTT
GGAAAAGAGGGTCTCAGTGGAGCACCCGGATTTGTAGGACCAACCGGAGA
AAAAGGAGACACTGGACCTCCTGGAGAACAAGGTGATCTTGGTGATATTG
GTCCCCCAGGGAGAGCCGGTCCTATTGGGCCTCCTGGACAATCTGGTCCT
ACTGGTCCTCAAGGTAATGTCGGTGAAAGAGGACCAGTTGGTCCTGATGG
AATGATTGGTCCTCCAGGACCAGAAGGTAAAATTGGGTCACCTGGGTCTC
CAGGTAGACCTGGTGAAGTGGGAAAAAAAGGTGAAGGTGGAGATGAAGGA
ATAAAAGGTGGTAAAGGCGAAGCTGGTAAAACTGGTCTTGATGGAAAATC
TGGAAAACCAGGGACGCGAGGACCAATAGGACCTGTTGGTATAAATGGAA
GACCTGGTAAAAAGGGTGAGTTAGGTGACATTGGACTTACTGGGCCTCAG
GGTATTTCTGGTCCGAGAGGTAAACGAGGAAGAGTTGGTAATCCCGGAGA
AGGAGGACCTAAAGGTTCTCAAGGAGATCAAGGGCCTATTGGTCTAGAAG
GAAGAGCTGGTGTATTGGGCCCTAAAGGTCAAAAAGGGGATAGAGGTCGC
CCAGGAGAACTGGGTGAAGCTGGACCATTAGGACCAATTGGGCCGATAGG
TCCCGATGGAGTTAAAGGAAGTAGAGGAGAGAGTGGTCCAAATGGTGCAC
CTGGAGATCCTGGATTAAATGGAAAGCCTGGAGCCATTGGTCCTCCAGGT
ATTCCTGGTACTCCTGGAGATGCTGGACCTGGTGGCCAAACCGGACCGAT
GGGTAGACCTGGTCCAAATGGTGCACCCGGTCCAAGAGGAGAAGTCGGTC
CGAATGGTCCTGATGGAAAGTCCGGAAATAAAGGAGCCATAGGACCTACT
GGTCAACCAGGAGTACGAGGCTCAATTGGAAATCCTGGTAAAGATGGAGC
GCTTGGTCCAATGGGTACCTCAGGCATGAGAGGTCCACCAGGAAATATAG
GAGTAGAAGGAAGTAAGGGAAATAAAGGTCCTCCTGGTTCTAGAGGAAAA
GTTGGAAGTGCGGGAAAAGTTGGTCCACCGGGAAAGCCTGGGGTTAACGG
CAGTGAAGGTCCTGTTGGAAATATGGGTAATCCTGGATTTCCAGGATCAT
CTGGTGATCCAGGAGCACCGGGACCAAAGGGACCAGTTGGTTTAATTGGT
CCTGTTGGTTATGCTGGTAGTCAAGGTGTCAATGGAAAAAATGGAGACCC
TGGAAACGTTGGAAAACCTGGAAAAGTAGGGCCACCAGGAGCACCTGGAA
AACCAGGAATTCCTGGACCTGATGGAGATAGAGGCAGCCTTGGACCTCCG
GGGCCTACTGGTCTGAAAGGCTCTCCGGGAATAATAGGTGTTCCTGGTAA
TTATGGTCCCAATGGACCTCCGGGTTCTTTAGGTGTGATCGGAAAACAAG
GTCTTGAAGGAGAATTAGGACCTCCAGGTACACCAGGAAGCCCAGGAGGT
ACAGGACCTAGAGGTCCTCCTGGACCTGCTGGAACTCCTGGAAATGCCGG
TGGTGAAGGTGTAGATAAACAAAAACCTAGAAGTGTTGGGTCTGCCGGCA
TAAGAGGTCCGATTGGTAAGCCGGGAGCAGATGGAATTCCTGGGGATGTG
GGACCGGTTGGAAAACAAGGTTCTGAAGGACCCCCTGGTGATCCAGGGGA
TCCTGGAGATATGGGATCAGTTGGAGCAATCGGTGATTCAGGTAAAGATG
GAAACCCTGGAAAACCAGGAGCTGCTGGAAAACCTGGACCAAGCGGTGTG
GATGGACCAGAAGGACCCGCTGGACTGCCTGGAGATATTGGTGAACCTGG
AAAATCTGGTCCTAGTGGTCCTAGAGGAGATCCGGGTAGAGTAGGAAGTG
CTGGAGGTCCAGGTAAACAAGGAAAATCTGGAAATCAAGGCAAGCAGGGG
CCTTCTGGAAAACCGGGCCCAACAGGCCCTCCTGGTTTGGCAGGATTAGA
TGCAGCTAATGGCCGTAAGGGCCCCTTAGGTTTAAGAGGTCCACCCGGAC
CAAAGGGAAAATCAGGAGGACCTGGAATTGATGGAAAAGTTGGAACCCCT
GGAACTGATGGATTTCCTGGGTATTTGGGTCCACCGGGTCAACCTGGACC
TCAAGGAATAGCTGGTAAACCTGGTAAACCAGGTCCAACTGGAGGTATAG
GTTTACAGGGAGACCATGGTGAAATGGGAAAACCTGGTCCTCAAGGACCA
CTTGGTGTACCTGGTCTTACTGGACCAGTAGGACCAAGAGGTGATCCGGG
ACCACCTGGAAGTAAAGGTGCAGCAGGTAAACCTGGGAAAGATGGAACTA
GTGGTGGTAAAGGGTACGATGGACAGACCGGAACTAGTGGCAAATCGGGT
AAAATTGGAGCTCCCGGTGAAAAGGGAGCAGATGGAAAACCAGGGCCAAA
TGGTCTTCTTGGCGATACTGGTTTAAGAGGTGCAAAAGGAAAAAAAGGAA
CAGATGGAACTCCAGGTAGGGAAGGAAAACCGGGTCCTCGAGGAGCTAAA
GGAACTAAAGGTCCAAAAGGAGTTCCTGGATATCCCGGAAGACCAGGAAT
TGAAGGAGATCCAGGACCTCCAGGTTATTCCGGACCCGATGGACCAACAG
GCCCTAAAGGCCCTGACGGTTTACAAGGACCAGTTGGAATATTCGGACCT
CGTGGAGACCCTGGAATACCAGGTGCAATTGGACCTACTGGACCACCAGG
TAAACCAGGTGGAACTGGTCCTGCTGGCCAAAGAGGACCGTTGGGACCAC
CAGGTCCACCTGGACCTCCAGGAGGCGTAATGGCAATGCAGATGCGATCA
CCCACTAAAGGTGTTGTATACGGAGATGATCCGAAGGCAGCAGAACTCCT
TGGAAATAATGCTATTAAAAATCCTCAAGGAACAAAAGAAGTACCAGCTA
GAACCTGCAAACATCTTAGTTCAGTAAATCCTCAAGCACCTGATGGTGAG
TACTGGATAGATCCGAATGGAGGTCGAATAGAAGATGCCGTTAAGGTTTA
TTGTAAAATTTCTGAGCAAAAAACCTGTATCAAATCCATTGATAATAATC
TCAGCATTAGGTCATGGAATAGTCCAATACTTAATGGTCCGACATGGTTA
CAAAAACTAATTAACAAAAATGAAATACAATATTCAGTACCAAATAATCA
ATTGGCGTTTCTTAAAGTTTATAGTGATAACGCCGTACAGAGAGTGACAT
TCAATTGCGAAAATCATCCTATAATAGGAAATGAGAAGATTTTTAATAAG
GTTACCGCGCCCCGCTTATTGGCAGACGATGATAGTATCATAAAGATGAC
ACATCCCAAACTGAAGTACTCAGTGATTAAAGACGAATGCCAATATTCCA
AATCCAGTGAAGCGGAAAGTGTAATAGAAGTTAAAGATGTCGCCAATTTA
CTACCGATTCGAGATGTCGGGATCCATATAATAAATAATAGAAAAAGCAA
GTTCGGATTGACCATTGAAGACGTCTGTTTTTCATAATTCATCTCGACAG
TGTCAAGTGATTGTACATTTTTTTCTTATTAGCTGTTTCTTTAAATGGAA
TTTATTTTTGCTGTAATTTATCAATAATAATTTTCTTTGACAATACTTTT
GTAAATGTCGACAGGTTAGATCATCCATCATTACTATCTGGTCAACTTAA
AAGTCTACTAAAACTGCATTCATTCAAAATACATGTTCAGTTTCTTTCAC
ACAGATTATGAAACTTACTGTGGTTCTTATTCGTACATACAATTGAGTTT
CAATACCCTTCCACCAATTGCTTGAAAAGTTACTTGAGAGATCATCATAG
TTACATGATGTGTTCTAATATAATGTTTCGTATGTTTTCTTATGTTTTTT
AATGTCTTTTGGAGAAAATGATTTCCAAATTTCTTTCCTCGA

Design Primers for collagen

back to top

protein sequence

>Ddo_024746-protein ID=Ddo_024746-protein|Name=collagen|organism=Dugesia dorotocephala|type=polypeptide|length=1286bp
MLKISILSGCVFLILLFIGNSYGQFRTLNEAVGPAGIRGNPGKPGKPGPD
GDPGPTGPPGPTGKDGLRGQPGAPGPNGNAGPDGKPGSTGVTGPPGARGE
QGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIGPPGRAGPIG
PPGQSGPTGPQGNVGERGPVGPDGMIGPPGPEGKIGSPGSPGRPGEVGKK
GEGGDEGIKGGKGEAGKTGLDGKSGKPGTRGPIGPVGINGRPGKKGELGD
IGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKG
QKGDRGRPGELGEAGPLGPIGPIGPDGVKGSRGESGPNGAPGDPGLNGKP
GAIGPPGIPGTPGDAGPGGQTGPMGRPGPNGAPGPRGEVGPNGPDGKSGN
KGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG
PPGSRGKVGSAGKVGPPGKPGVNGSEGPVGNMGNPGFPGSSGDPGAPGPK
GPVGLIGPVGYAGSQGVNGKNGDPGNVGKPGKVGPPGAPGKPGIPGPDGD
RGSLGPPGPTGLKGSPGIIGVPGNYGPNGPPGSLGVIGKQGLEGELGPPG
TPGSPGGTGPRGPPGPAGTPGNAGGEGVDKQKPRSVGSAGIRGPIGKPGA
DGIPGDVGPVGKQGSEGPPGDPGDPGDMGSVGAIGDSGKDGNPGKPGAAG
KPGPSGVDGPEGPAGLPGDIGEPGKSGPSGPRGDPGRVGSAGGPGKQGKS
GNQGKQGPSGKPGPTGPPGLAGLDAANGRKGPLGLRGPPGPKGKSGGPGI
DGKVGTPGTDGFPGYLGPPGQPGPQGIAGKPGKPGPTGGIGLQGDHGEMG
KPGPQGPLGVPGLTGPVGPRGDPGPPGSKGAAGKPGKDGTSGGKGYDGQT
GTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGTPGREGK
PGPRGAKGTKGPKGVPGYPGRPGIEGDPGPPGYSGPDGPTGPKGPDGLQG
PVGIFGPRGDPGIPGAIGPTGPPGKPGGTGPAGQRGPLGPPGPPGPPGGV
MAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVN
PQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPI
LNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIG
NEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIE
VKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS*
back to top

coding sequence

>Ddo_024746.4930.8787 ID=Ddo_024746.4930.8787|Name=Ddo_024746.4930.8787|organism=Dugesia dorotocephala|type=CDS|length=3858bp
ATGCTCAAAATATCAATTCTTTCTGGATGTGTTTTTTTGATTTTGTTGTT
TATTGGAAATAGTTATGGCCAATTCAGAACTCTTAATGAAGCTGTTGGAC
CAGCTGGAATTAGGGGAAATCCCGGAAAACCTGGTAAACCGGGTCCCGAT
GGGGATCCTGGTCCAACAGGACCCCCTGGTCCCACTGGTAAAGATGGGTT
AAGGGGACAACCTGGAGCTCCTGGGCCTAATGGAAATGCAGGACCTGATG
GTAAACCAGGAAGTACAGGTGTCACTGGTCCCCCGGGTGCAAGAGGTGAA
CAAGGTCCCGCTGGTCCTGTTGGAAAAGAGGGTCTCAGTGGAGCACCCGG
ATTTGTAGGACCAACCGGAGAAAAAGGAGACACTGGACCTCCTGGAGAAC
AAGGTGATCTTGGTGATATTGGTCCCCCAGGGAGAGCCGGTCCTATTGGG
CCTCCTGGACAATCTGGTCCTACTGGTCCTCAAGGTAATGTCGGTGAAAG
AGGACCAGTTGGTCCTGATGGAATGATTGGTCCTCCAGGACCAGAAGGTA
AAATTGGGTCACCTGGGTCTCCAGGTAGACCTGGTGAAGTGGGAAAAAAA
GGTGAAGGTGGAGATGAAGGAATAAAAGGTGGTAAAGGCGAAGCTGGTAA
AACTGGTCTTGATGGAAAATCTGGAAAACCAGGGACGCGAGGACCAATAG
GACCTGTTGGTATAAATGGAAGACCTGGTAAAAAGGGTGAGTTAGGTGAC
ATTGGACTTACTGGGCCTCAGGGTATTTCTGGTCCGAGAGGTAAACGAGG
AAGAGTTGGTAATCCCGGAGAAGGAGGACCTAAAGGTTCTCAAGGAGATC
AAGGGCCTATTGGTCTAGAAGGAAGAGCTGGTGTATTGGGCCCTAAAGGT
CAAAAAGGGGATAGAGGTCGCCCAGGAGAACTGGGTGAAGCTGGACCATT
AGGACCAATTGGGCCGATAGGTCCCGATGGAGTTAAAGGAAGTAGAGGAG
AGAGTGGTCCAAATGGTGCACCTGGAGATCCTGGATTAAATGGAAAGCCT
GGAGCCATTGGTCCTCCAGGTATTCCTGGTACTCCTGGAGATGCTGGACC
TGGTGGCCAAACCGGACCGATGGGTAGACCTGGTCCAAATGGTGCACCCG
GTCCAAGAGGAGAAGTCGGTCCGAATGGTCCTGATGGAAAGTCCGGAAAT
AAAGGAGCCATAGGACCTACTGGTCAACCAGGAGTACGAGGCTCAATTGG
AAATCCTGGTAAAGATGGAGCGCTTGGTCCAATGGGTACCTCAGGCATGA
GAGGTCCACCAGGAAATATAGGAGTAGAAGGAAGTAAGGGAAATAAAGGT
CCTCCTGGTTCTAGAGGAAAAGTTGGAAGTGCGGGAAAAGTTGGTCCACC
GGGAAAGCCTGGGGTTAACGGCAGTGAAGGTCCTGTTGGAAATATGGGTA
ATCCTGGATTTCCAGGATCATCTGGTGATCCAGGAGCACCGGGACCAAAG
GGACCAGTTGGTTTAATTGGTCCTGTTGGTTATGCTGGTAGTCAAGGTGT
CAATGGAAAAAATGGAGACCCTGGAAACGTTGGAAAACCTGGAAAAGTAG
GGCCACCAGGAGCACCTGGAAAACCAGGAATTCCTGGACCTGATGGAGAT
AGAGGCAGCCTTGGACCTCCGGGGCCTACTGGTCTGAAAGGCTCTCCGGG
AATAATAGGTGTTCCTGGTAATTATGGTCCCAATGGACCTCCGGGTTCTT
TAGGTGTGATCGGAAAACAAGGTCTTGAAGGAGAATTAGGACCTCCAGGT
ACACCAGGAAGCCCAGGAGGTACAGGACCTAGAGGTCCTCCTGGACCTGC
TGGAACTCCTGGAAATGCCGGTGGTGAAGGTGTAGATAAACAAAAACCTA
GAAGTGTTGGGTCTGCCGGCATAAGAGGTCCGATTGGTAAGCCGGGAGCA
GATGGAATTCCTGGGGATGTGGGACCGGTTGGAAAACAAGGTTCTGAAGG
ACCCCCTGGTGATCCAGGGGATCCTGGAGATATGGGATCAGTTGGAGCAA
TCGGTGATTCAGGTAAAGATGGAAACCCTGGAAAACCAGGAGCTGCTGGA
AAACCTGGACCAAGCGGTGTGGATGGACCAGAAGGACCCGCTGGACTGCC
TGGAGATATTGGTGAACCTGGAAAATCTGGTCCTAGTGGTCCTAGAGGAG
ATCCGGGTAGAGTAGGAAGTGCTGGAGGTCCAGGTAAACAAGGAAAATCT
GGAAATCAAGGCAAGCAGGGGCCTTCTGGAAAACCGGGCCCAACAGGCCC
TCCTGGTTTGGCAGGATTAGATGCAGCTAATGGCCGTAAGGGCCCCTTAG
GTTTAAGAGGTCCACCCGGACCAAAGGGAAAATCAGGAGGACCTGGAATT
GATGGAAAAGTTGGAACCCCTGGAACTGATGGATTTCCTGGGTATTTGGG
TCCACCGGGTCAACCTGGACCTCAAGGAATAGCTGGTAAACCTGGTAAAC
CAGGTCCAACTGGAGGTATAGGTTTACAGGGAGACCATGGTGAAATGGGA
AAACCTGGTCCTCAAGGACCACTTGGTGTACCTGGTCTTACTGGACCAGT
AGGACCAAGAGGTGATCCGGGACCACCTGGAAGTAAAGGTGCAGCAGGTA
AACCTGGGAAAGATGGAACTAGTGGTGGTAAAGGGTACGATGGACAGACC
GGAACTAGTGGCAAATCGGGTAAAATTGGAGCTCCCGGTGAAAAGGGAGC
AGATGGAAAACCAGGGCCAAATGGTCTTCTTGGCGATACTGGTTTAAGAG
GTGCAAAAGGAAAAAAAGGAACAGATGGAACTCCAGGTAGGGAAGGAAAA
CCGGGTCCTCGAGGAGCTAAAGGAACTAAAGGTCCAAAAGGAGTTCCTGG
ATATCCCGGAAGACCAGGAATTGAAGGAGATCCAGGACCTCCAGGTTATT
CCGGACCCGATGGACCAACAGGCCCTAAAGGCCCTGACGGTTTACAAGGA
CCAGTTGGAATATTCGGACCTCGTGGAGACCCTGGAATACCAGGTGCAAT
TGGACCTACTGGACCACCAGGTAAACCAGGTGGAACTGGTCCTGCTGGCC
AAAGAGGACCGTTGGGACCACCAGGTCCACCTGGACCTCCAGGAGGCGTA
ATGGCAATGCAGATGCGATCACCCACTAAAGGTGTTGTATACGGAGATGA
TCCGAAGGCAGCAGAACTCCTTGGAAATAATGCTATTAAAAATCCTCAAG
GAACAAAAGAAGTACCAGCTAGAACCTGCAAACATCTTAGTTCAGTAAAT
CCTCAAGCACCTGATGGTGAGTACTGGATAGATCCGAATGGAGGTCGAAT
AGAAGATGCCGTTAAGGTTTATTGTAAAATTTCTGAGCAAAAAACCTGTA
TCAAATCCATTGATAATAATCTCAGCATTAGGTCATGGAATAGTCCAATA
CTTAATGGTCCGACATGGTTACAAAAACTAATTAACAAAAATGAAATACA
ATATTCAGTACCAAATAATCAATTGGCGTTTCTTAAAGTTTATAGTGATA
ACGCCGTACAGAGAGTGACATTCAATTGCGAAAATCATCCTATAATAGGA
AATGAGAAGATTTTTAATAAGGTTACCGCGCCCCGCTTATTGGCAGACGA
TGATAGTATCATAAAGATGACACATCCCAAACTGAAGTACTCAGTGATTA
AAGACGAATGCCAATATTCCAAATCCAGTGAAGCGGAAAGTGTAATAGAA
GTTAAAGATGTCGCCAATTTACTACCGATTCGAGATGTCGGGATCCATAT
AATAAATAATAGAAAAAGCAAGTTCGGATTGACCATTGAAGACGTCTGTT
TTTCATAA
back to top
Gene Groups
collagen is similar in sequence to the genes of this group: GG1008
Gene NameGene ID
SMU15002271SMU15002271
SMU15040033SMU15040033
Ddo_001537Ddo_001537
collagenDdo_024746
collagenGsp_012135
Gsp_016934Gsp_016934
Pgr_004907Pgr_004907
collagenPgr_010667
Pmo_000089Pmo_000089
collagenPmo_027332

Gene Group Protein Sequences

>SMU15002271

MWNSIFFSLLFVLCVSINARAEEKLNRLKRQATSPNQAKGSQGPRGDPGP
MGKPGPPGDPGALGPIGPPGRDGARGKSGKPGASGIPGKDGTPGSHGVVG
PIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQ
GPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGI
PGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPG
VRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQ
GSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGN
PGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFG
TNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSP
GDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGFPGIAGK
IGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKG
SIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAP
GKLGPVGITGSRGRPGPIGSSGEPGEKGPQGLPEVEKPLAGRSVGGVSGP
RGERGSPGDDGLPGPNGDPGPPGPIGMDGGRGDTGDRGLPGPAGDPGKDG
KPGEPGTPGIDGPPGQVGPEGPRGPSGETGEQGPQGLPGKPGDPGAEGPR
GSSGKQGFQGPTGPIGPTGKQGKQGRAGKSGKNGLTGRKGPAGQRGSIGA
RGKDGQTGENGRAGSAGADGFPGFPGPNGPPGPTGPDGKMGPIGPPGEIG
EHGEMGDPGPTGKEGLVGPQGNVGPPGPIGSPGNPGIAGPPGPQGKRGNR
GNTGFVGPAGPRGKRGPVGPGGEKGIPGSPGLEGQRGQIGVSGARGNNGN
NGKPGRTGRAGPAGTMGQKGVRGVKGFTGPNGLKGPQGPSGYPGEDGSPG
PMGLIGERGPQGITGKRGDRGDPGLLGPLGPPGNDGEFGRPGPQGPMGPP
GPPGPPGSSMPMGLRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPAR
SCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIY
KTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISL
NCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEK
FSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS*
>SMU15040033
MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPD
GDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGE
QGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLG
PPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKK
GEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGD
IGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKG
QKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKP
GATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGR
KGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIG
PPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPP
GSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGD
VGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPG
LAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGM
DGFPGDVGPPGKQGPEGGPGDPGDPGDMGPIGNSGDPGPDGKPGKNGAPG
KQGPEGLPGSEGASGPPGDVGDPGKSGPTGPRGGPGRIGSPGGQGKQGKS
GNQGKLGPSGKPGPVGSPGVTGLDGTIGRKGPLGLRGPSGPKGKSGAPGV
DGKVGTQGVNGYPGYLGPPGPPGPQGPNGKPGKPGPPGNVGQIGDHGEMG
NPGPQGSVGPPGATGPVGPRGDAGEPGRKGPIGPQGKNGTSGGKGYDGQS
GTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGR
PGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDGLQG
PVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGI
MAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKH
PNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHS
ANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIG
NEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIE
VRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS*
>Ddo_001537 Ddo_001537
MHKFTFLFAIGVLCFSVFAENEKLHRLKRQATSPNQAKGSQGPRGDPGPM
GKPGPEGDSGMMGPVGPPGRDGARGKSGKPGLPGIPGKDGTPGSHGVSGP
MGPPGEIGVSGPVGPEGANGKQGNRGPTGDKGDMGLTGLKGSSGEPGLQG
PQGLRGPIGRVGPTGPTGPTGDRGKQGPDGIPGSVGPQGAIGPPGQPGIA
GEIGNKGVRGEAGIKGSKGDHGNPGMGGKLGSIGQPGPPGLPGVDGRPGI
RGEVGVPGLQGPEGKAGQRGQRGAPGNPGSQGPKGSQGEEGSPGIEGKPG
PPGIKGQKGDNGRPGENGDEGPRGERGLNGPSGNKGSQGESGPDGSPGNP
GTDGIPGKDGIAGSPGNEGEAGPKGPPGPMGKPGLNGAPGPRGENGVYGV
NGHPGAKGSVGPKGSIGSPGPRGLPGNNGPMGSMGPGGIRGPLGPVGSPG
EKGGKGRNGIPGASGDAGDIGELGPPGEDGSEGSSGSPGPAGFPGVSGKM
GQIGPIGVDGPPGPPGFEGTPGINGKDGKSGKDGKPGPPGEIGPPGINGS
TGPVGEIGPTGKIGLKGLKGADGIMGPPGTFGINGPPGLSGPMGPVGING
KRGPPGTPGKEGVPGAIGPQGIPGKRGSKGGDGVDKPLAGRSGGGPPGPK
GERGPQGEDGLSGPNGNPGPVGPPGIDGGRGDTGDRGLPGPIGDVGKDGK
PGEPGTPGQDGPPGPVGPEGPRGPPGETGDQGPQGLPGRPGESGLEGPRG
SPGKQGSQGSSGPVGAVGKPGKPGKPGKPGKDGMIGRKGPVGQRGPTGPR
GKDGPAGENGKPGSPGPDGFSGFPGSSGPPGPIGPDGKGGPPGPPGETGE
VGEMGDIGPLGKEGPQGPQGNDGPPGPIGSPGVPGNAGPPGPPGKRGNRG
NTGFVGGVGPRGKRGPVGADGEKGIPGQPGANGAKGQIGIPGPRGKLGNN
GKPGKIGRVGPPGTTGQKGTRGVKGFTGPNGLRGPQGLSGYPGEDGPPGP
IGLIGERGPQGVTGKRGDRGDPGAAGPNGPQGNDGEYGRPGPQGPVGPPG
PPGPPGSSMPMGLRSPTKGLTLADDPSVALSFGNNAIHTPRGTKDVPARS
CKLLSEINPTLPDGEYWIDPNGGRIDDAVKVYCKMSLAQTCIKPISKSFK
AKQWIRKYSKDHIWFQTTHEAGEFQYDIENYQLTYLKVHSDTATQQISLS
CINQAIVLDKNGKLSNASTSLLGDDDTILSLRHPKRRFKVVKDDCQYEKS
SEAETILEIRGKASRLPIRDVGLLVDDNPERKIGIELSEVCYS*
>Ddo_024746 collagen
MLKISILSGCVFLILLFIGNSYGQFRTLNEAVGPAGIRGNPGKPGKPGPD
GDPGPTGPPGPTGKDGLRGQPGAPGPNGNAGPDGKPGSTGVTGPPGARGE
QGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIGPPGRAGPIG
PPGQSGPTGPQGNVGERGPVGPDGMIGPPGPEGKIGSPGSPGRPGEVGKK
GEGGDEGIKGGKGEAGKTGLDGKSGKPGTRGPIGPVGINGRPGKKGELGD
IGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKG
QKGDRGRPGELGEAGPLGPIGPIGPDGVKGSRGESGPNGAPGDPGLNGKP
GAIGPPGIPGTPGDAGPGGQTGPMGRPGPNGAPGPRGEVGPNGPDGKSGN
KGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG
PPGSRGKVGSAGKVGPPGKPGVNGSEGPVGNMGNPGFPGSSGDPGAPGPK
GPVGLIGPVGYAGSQGVNGKNGDPGNVGKPGKVGPPGAPGKPGIPGPDGD
RGSLGPPGPTGLKGSPGIIGVPGNYGPNGPPGSLGVIGKQGLEGELGPPG
TPGSPGGTGPRGPPGPAGTPGNAGGEGVDKQKPRSVGSAGIRGPIGKPGA
DGIPGDVGPVGKQGSEGPPGDPGDPGDMGSVGAIGDSGKDGNPGKPGAAG
KPGPSGVDGPEGPAGLPGDIGEPGKSGPSGPRGDPGRVGSAGGPGKQGKS
GNQGKQGPSGKPGPTGPPGLAGLDAANGRKGPLGLRGPPGPKGKSGGPGI
DGKVGTPGTDGFPGYLGPPGQPGPQGIAGKPGKPGPTGGIGLQGDHGEMG
KPGPQGPLGVPGLTGPVGPRGDPGPPGSKGAAGKPGKDGTSGGKGYDGQT
GTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGTPGREGK
PGPRGAKGTKGPKGVPGYPGRPGIEGDPGPPGYSGPDGPTGPKGPDGLQG
PVGIFGPRGDPGIPGAIGPTGPPGKPGGTGPAGQRGPLGPPGPPGPPGGV
MAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVN
PQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPI
LNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIG
NEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIE
VKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS*
>Gsp_012135 collagen
MLKISIISGAILLVLIYIECVHGQFRTLNEATGPMGIRGNPGKRGKPGPD
GDPGAQGPTGPPGNDGQRGAPGLQGPPGSVGPEGKSGAGGVSGPPGSRGE
QGPPGPIGKEGLTGPVGYPGPSGEKGDSGGTGEQGDTGDIGPPGPPGPIG
QPGQNGPTGPQGPVGERGTHGPDGIVGPPGPEGRIGSPGLPGRPGEIGKK
GEGGDEGAKGGKGESGKTGINGKSGKPGLRGRTGPDGNNGKQGRKGEIGD
VGLLGPQGLTGPRGLRGSSGNPGDSGPKGSQGDQGPIGLEGKSGPFGPKG
QKGDRGRPGPQGEAGLIGPTGPIGPDGVKGSRGESGPNGSPGSPGPNGKP
GADGPPGNPGHPGNSGPGGSTGALGRPGPNGAPGPRGEIGPPGPDGKSGN
KGALGPIGPSGLRGPPGNPGKDGMIGPLGLPGLRGPPGNVGAPGNKGNIG
EPGPKGKTGNSGKPGPAGKNGADGSEGLSGNIGSPGFPGPNGDPGASGPP
GPAGAIGIPGYPGNQGISGKNGAPGTEGNPGKSGPVGPVGKAGVPGPIGD
SGNPGPPGPNGLKGAPGIVGIPGNYGPNGPPGALGPLGKQGPEGPVGAPG
LLGSPGPDGPRGPPGDNGSPGSAGGEGVEKHKPRSVGAAGIRGPVGKPGM
DGLPGDLGPPGKQGPEGNPGDPGDPGDMGPIGASGDSGPDGKPGKPGAPG
KQGPEGLSGPEGASGPPGDVGDPGKSGPGGPRGGPGRQGSPGGPGKQGKS
GIQGKPGPAGKPGPLGPQGVTGLDGSGGRKGPLGLRGPVGPKGKPGAPGT
DGKVGTSGPDGYPGYLGPPGPSGPQGITGKPGKKGPPGNRGPIGDNGEMG
KPGPVGVVGDPGITGPVGPRGDPGPPGSKGAAGSPGKDGTSGGKGYDGQG
GTSGKSGKLGTPGDKGADGKPGPGGVLGDVGLRGAKGKKGKDGVPGREGR
PGPRGAKGVKGPKGVPGYPGLIGIEGDPGPPGFPGPDGPVGPKGPDGIQG
PVGITGPRGDPGIPGAIGPTGLSGKKGSNGPLGQLGPLGPPGPPGPPGGI
MAMQLRSPTKGVVYGDDPAAAELLGNNAIKNPQGTKEVPARTCKQLSSEN
PNIPDGEYWIDPNGGRTSDAVKVFCKISEEKTCIKPLNQEISIRSWNSPI
TKGHTWLKSLLNSDEIQYSIPNGQLAFLKIYSDTATQRITFACENHPIIG
SEEKLNKVMAPRLLADDDTIIKMTQSKLKYTVIKDECQYSKSSEAESIIE
LKHLASLLPIRDIGINIINNRKSKFGLTIEEVCFS*
>Gsp_016934 Gsp_016934
MYNLIRLFIAILCVLSVPVIVNGEAKLNRIKRQATSPRQAKGSQGPRGDP
GPMGKPGPQGDPGPLGPVGPPGRDGARGKSGRPGASGVPGKDGTPGSHGV
IGPIGPRGEPGIAGSIGPEGASGPQGNRGYPGDKGDIGLNGLKGSNGEPG
LQGPQGIRGTSGRVGPTGPQGPPGERGKQGPDGIPGSPGPQGTIGPPGQS
GITGEMGNKGIRGEGGIKGSKGDVGNPGLSGKVGPAGPTGPPGFPGVDGR
PGVRGESGVVGQQGPVGKVGQQGQRGKTGNIGPPGPKGAQGDEGPMGIEG
KQGPPGPKGQKGDPGRPGETGDEGPRGERGIVGPSGNKGARGETGQDGSP
GNPGTDGIPGKDGLHGSPGSEGEVGSVGPPGEVGKPGLNGAPGIRGENGA
FGVNGKPGAKGSVGPKGNIGSPGPRGLSGNNGAMGVMGPGGIRGPIGPVG
SPGEKGGKGRVGIPGVSGDAGDIGEQGPPGEDGAEGSSGNPGPIGFPGIA
GKIGQAGPLGVDGPPGPPGFEGLPGVNGKDGKAGKDGKPGPPGEVGPPGV
KGSIGQFGETGPMGKIGIRGPKGMDGIMGPPGVFGMNGPPGPSGEAGPEG
APGKLGPVGIAGRPGRPGAIGPQGIAGEKGPKGLPEVDKPLAGRSSGGPP
GPKGERGPPGDDGLPGPNGNQGPPGPVGMDGGRGDTGDRGLPGPVGDPGK
DGKPGEQGVPGTDGPQGPLGPEGPRGPSGETGEQGPRGLPGKPGEPGGEG
PRGSPGKQGLQGPTGPVGPTGKQGKQGKPGKSGKNGVTGQKGPVGSRGPL
GPRGKDGPLGESGKPGSPGADGFSGFPGPIGPPGAIGPDGKQGPVGQPGE
PGEHGEMGDAGPNGNEGPLGPQGNVGPPGPTGPPGNPGNIGTPGPQGKRG
NRGNTGFVGAAGQRGKRGPLGPPGDKGIPGSPGMAGLKGQTGVQGPRGKN
GNNGKPGRIGRSGPPGSMGQKGVRGVKGFTGPNGLKGPQGSSGYPGEDGP
PGPIGLIGERGPQGITGKRGDRGDPGLLGPPGPLGNDGEYGRPGPQGPMG
PPGPPGPPGSSMPMGLRSPTKGLTMADDPTAAISFGNNAIITPRGTKDVP
ARSCKHLSEHNPDLPDGEYWIDPNGGRIDDAIPVFCRIELQQTCIKPISK
IFKPVQWIRKYARGHIWFQTVNEIGEFEYDIESHQLNFLKALSETATQQI
TFTCINQAIILDKTGKLSNASTKLLGDDDTFLTFHHPKRRYKVVKDECQY
EKFSEAETVLQIQGKASRLPIKDVGLITDSNTSRKVGIELSEVCYS*
>Pgr_004907 Pgr_004907
MLRLVCFFLISSVCLTTVLSKEELINRIKRQATSPNQAIGPQGPRGDPGP
RGKIGQIGDTGAIGPPGPPGRDGAAGKSGKPGPPGLPGKDGRPGTPGNSG
ARGTRGEPGVAGPLGPEGGTGKQGSKGAPGDKGDIGPNGLKGSNGEAGLQ
GIRGPRGSPGPVGPNGPPGSAGDRGKRGPDGRMGGAGPQGPIGPPGIPGL
LGDMGDKGERGDGGPKGVKGEAGNAGVSGKPGPTGPKGPQGSPGVDGRPG
IRGELGNIGPLGPPGVAGPRGQTGAPGNSGKLGPKGAQGEQGPVGLEGKI
GLIGDKGQKGDQGRPGDIGDPGVRGERGVEGIGGNKGPRGEMGPDGSPGN
GGTDGIPGRDGEQGQPGSIGPVGPRGPQGPQGKTGLNGSPGGRGENGPFG
LNGMPGGKGEPGVRGPPGLPGSRGSAGNNGLQGVMGPVGMRGPAGQVGEG
GDKGSPGTAGIAGMPGEAGDVGLQGPPGEEGVEGPSGSPGPAGFSGAVGK
IGQVGPIGINGPPGPPGYEGAPGVNGKDGKSGKDGKPGTPGDTGPVGPKG
ASGPLGERGPLGPLGIKGIKGFEGVMGIPGSFGTNGPPGLSGNIGAEGPV
GKPGTAGLPGLAGAPGQRGPIGDSGEPGSSGAQGVEKPPAGRSSGPPGPK
GNRGPPGDNGTPGAVGTQGPPGPPGIDGDRGDPGDRGLPGPIGEPGKDGK
LGKVGGSGKNGPPGQDGPEGPRGAPGDVGEPGRQGPEGKPGPDGPEGPRG
IPGLQGKRGPSGPIGPIGPPGKQGKTGSPGSDGVIGRKGPPGARGPQGPR
GKDGVAGENGKSGTPGPDGFAGFPGPSGPQGIIGGVGKPGNPGSPGETGE
QGEFGDIGPPGPPGPDGLNGNPGPPGPSGIPGSIGERGPPGPGGKKGPMG
NTGFIGMPGPRGGRGKPGLIGPMGLVGGVGLQGPKGPPGEPGDRGKDGVD
GKPGGPGRPGPTGSIGIKGARGFKGFTGPTGIRGNPGPSGYPGENGMPGP
MGLIGERGPQGAPGQRGERGDTGPAGMIGPQGNDGEYGRPGPQGPMGPSG
PPGPPGSSTLMNLRAPKKNLIYGDDPSSALILGNSVIKTPRGTKEVPART
CKHLAEHNPKIPDGEYWIDPNGGRIQDAVKVFCKIDNYQTCIESTTKKFK
LQSWIRKYPKGPIWFQTTNNVGDFEYDVSDDQLSYLKALSDKASQQITIK
CFNKAIIRDKNGALLKTSPSLLGDDDTILTLEHPKRQYTIVRDDCQYEKN
SEAETVLEVNGKASRLPIKDIGLVIDSDKKVGIELSEVCYS*
>Pgr_010667 collagen
MLTNTFLIGVFLGILSSTEFVSGQFKSLQEAVGPPGIRGNPGPQGKPGPD
GDDGAAGPTGFMGKDGFRGPPGPVGPAGKPGTDGKAGNAGVTGSPGSRGE
PGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEQGDVGPIGPVGPVGPKG
PIGQPGPTGKQGGTGNRGITGPDGKVGPPGPQGRMGSQGPPGNPGEMGNK
GEKGSEGRKGGKGSVGKPGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGN
IGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEGKPGNKGPNG
QKGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGTPGQNGAP
GKNGPPGTPGNPGGTGPAGQPGSLGRPGPNGTPGPRGEPGPSGNDGTPGA
KGSPGPPGPPGQTGLAGNLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTG
SPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPV
GIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIGAPGPDGD
RGDSGPIGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGEDG
APGIPGSPGPKGPPGEGGDPGNPGMPRISKPQPRGAGPAGPKGEAGKPGL
DGIPGEIGPSGKPGAPGPDGDPGDPGETGAPGQDGEEGKEGAPGAPGKPG
LLGPQGLEGNIGSPGPSGEAGDPGATGAPGPVGAPGRDGSLGLPGRQGKP
GEPGKEGAVGKVGSPGVIGAPGNNGADGRKGPLGPRGPPGDKGKPGGPGT
EGKPGSDGSPGDPGFMGSPGPSGPQGSLGKPGKPGPAGSDGLPGDYGEMG
VPGPAGPDGAPGNSGTAGARGPSGLPGGKGKPGPAGKAGKPGNGGFAGIP
GARGASGTPGPAGDAGPLGAPGSNGAIGETGLAGDKGVSGANGKPGQAGR
PGPRGPAGTKGPKGSPGFDGPTGADGDRGAIGYPGPNGPPGPSGPAGLTG
PTGVIGPRGDPGVLGPVGVAGLPGRQGESGPIGQRGPIGPPGPPGPPGGV
MAMQMRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSY
PNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSS
VNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG
INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIE
VSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS*
>Pmo_000089 Pmo_000089
MLRIVSLILICAIYIIAVMANEELVQRVKRQATSPNQAIGPQGPRGDPGP
RGKAGIPGDTGVLGPPGPPGRDGAAGKSGQSGPSGLPGKDGRPGTPGNVG
SRGPRGEAGVPGPIGPEGGTGKQGSKGPPGEKGDIGPNGLKGSNGESGLQ
GIRGPRGPPGPIGPNGPSGSAGERGKPGPDGRVGGAGPQGPIGPPGVPGL
PGDMGDKGERGDNGPKGVKGEAGNAGLSGKSGPIGPKGPQGSPGVDGRPG
IRGELGNVGPTGPPGSGGPRGQTGAPGNSGHMGPKGAQGEQGPVGLEGKL
GPAGMKGQKGDQGRPGDIGDPGLRGERGVGGIGGNKGPRGEMGPEGSPGN
SGTDGIPGRDGEPGQPGSAGPPGPRGPQGSQGNTGLNGSPGARGENGPFG
SNGIPGNKGEPGVKGPPGLPGSRGSTGNNGVQGIIGPTGIRGPAGQVGEG
GDKGVPGSTGIGGVPGEAGDAGIQGPPGEEGNEGPSGSPGPAGFSGSVGK
IGQTGPVGIDGPPGPPGYEGAPGPNGKDGKSGKDGKPGVPGDTGPSGQKG
TSGPVGERGPSGPSGVKGVKGFDGIMGIPGSFGANGPPGLSGNFGAEGPV
GKSGAPGLPGLPGTQGQRGPIGDSGDPGSSGAQGVEKPPAGRSAGPPGPK
GNRGPPGDNGQPGATGVQGPPGPPGIDGDRGDPGDRGLPGPIGEPGKDGK
AGKVGVAGKDGPPGQDGPEGPRGAPGDVGEPGRQGPEGKPGLDGPEGPRG
QSGLQGKRGPSGNVGPIGKPGKQGKTGSPGTDGSLGRKGPAGARGPQGPR
GKDGPVGESGKTGSPGSDGFAGFPGPSGPQGAIGPEGKPGISGSPGEAGE
QGEFGDIGVPGPPGNDGLPGNAGPPGPMGVPGSLGERGPPGPIGKKGPMG
NTGFVGMPGPRGGRGKPGLLGPMGLVGGVGLQGPKGPPGEPGERGKDGVD
GKAGGAGRPGPPGNLGIKGARGLKGFTGPTGMRGNSGPSGYPGEDGMQGP
IGLIGERGPQGIAGARGERGDTGPSGLIGPTGNDGEYGRPGPQGPMGPVG
PPGPPGSATLMNLRTPKKNLIYGDDPSAALILGNSVIKTPRGTKEVPART
CKHLAEHNPKLTDGEYWIDPNGGRIADAVKVFCKIDKYQTCIESSTKKFK
LQTWVRKYPKGPIWFQTTNGIGEFEYDVPDDQLSYLKALSDKASQQITVK
CMAQAIIRDKNGQLLKSTPSLLGDDDTILTLDHPKRQYTIVKDDCQYEKN
SDAETILEMSGKSSRLPIKDIGLVIDSDKKVGIELSEVCFS*
>Pmo_027332 collagen
MGKDGVRGPPGLIGPAGKPGSDGKAGVAGVAGSPGPRGEPGLTGSMGQEG
VAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQ
GITGNRGITGPDGKVGPPGPQGKMGPKGPPGNPGEMGNKGEKGSEGRKGG
KGSSGKPGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMGSQGPSG
QRGSRGIIGNPGEVGPKGSEGDQGPIGLEGKPGNKGPNGLKGDRGRPGQI
GENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNGVLGKNGPPGTSGN
PGGTGPTGQPGPLGRPGPNGTPGPRGEPGPGGNDGMPGAKGSPGPPGPPG
QPGLAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDT
GPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGF
PGELGVHGKNGAPGNNGKPGKPGAPGPVGIIGAPGPDGDRGDNGPIGARG
ITGPSGVLGVPGTYGPNGAPGPEGTLGKQGPIGKSGLDGIPGLPGLPGPK
GPPGESGDPGPPGNPRISKPQPRGAGPAGPKGETGKPGLDGVPGEVGPSG
KPGATGPDGDAGDPGDAGAPGPDGEEGKSGALGAPGKPGLLGPMGLEGSV
GAPGPAGEAGDSGISGAPGPVGLPGRDGNLGLPGKQGKQGDPGKEGPVGK
PGGLGVPGVPGMNGANGRKGPLGLRGPQGDKGKTGAPGTDGKPGPDGTTG
DPGVMGSPGPSGPQGSLGKPGKPGLPGSEGLTGDYGELGVPGPVGMDGPP
GNPGTVGAPGPPGGPGGKGKPGAKGKPGKAGSGGFPGVPGSRGALGKPGP
SGDPGDAGELGPNGALGEAGLVGDKGVSGANGKPGQAGRPGSRGLPGVKG
PKGSPGFDGPTGSDGDRGPTGFSGPDGPPGPSGTEGPTGPTGVIGPRGDP
GVLGPIGVPGLPGRQGESGPIGQRGPIGPPGPPGPPGGVMAMQMRSPTKG
IMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWID
PNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLT
KKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSP
RLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIR
DVGVTIISKNDSQFGLKFEEVCFS*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.