innexin, Ddo_023720 (mRNA) Dugesia dorotocephala

Overview
Nameinnexin
Unique NameDdo_023720
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1076
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Properties
Property NameValue
NoteInnexin
Homology
BLAST of innexin vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 145.976 bits (367), Expect = 2.81863e-38
Identity = 91/289 (31.49%), Postives = 160/289 (55.36%), Query Frame = 3
Query:  216 YATKYKWVDFVGMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+A+ K + F +D D+L++ +T+I+ + +++S K Y+ I C++P T + + ++YCWV T +P+H+ P E E +I YYQWVPFVLAL+ +LFY+P I+W+++++ SG ++ LV+MA + +++ + +A N+E L ++ + +L +L L + SG + Y+ +K LY +N GQ+ L+ FL G+ +G VL +++NG+EW ++ FPRVT C + +K +G + + QC L INM N
Sbjct: 8 FASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAERE------NRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNL------IICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFN 279
BLAST of innexin vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 139.813 bits (351), Expect = 1.77221e-35
Identity = 90/277 (32.49%), Postives = 157/277 (56.68%), Query Frame = 3
Query:  255 EDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLEN-LLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+DF D+L++ +T+IL +++S K Y+ I C++P T + + ++YCWV T +PM + +PR Y+ + +I YYQWVPF+LA++ +LFY+P I+W+ + Y SG +L+GLV+MA A + K TV +A ++++ + ++ + H + L + G+ G + + Y+ IK LY N Q L+ + L G ND ++G+++LK++++ EW T +FPRVT C + ++ +G + + QC L INM N
Sbjct: 139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQED--IPREI----YSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFN 402
BLAST of innexin vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 125.946 bits (315), Expect = 4.909e-31
Identity = 81/276 (29.35%), Postives = 144/276 (52.17%), Query Frame = 3
Query:  255 EDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA--GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+D DRLS+ + ++L ++++S K Y+ ++I C++P++ G ++ + + YC++ T + +P + + A+ I YYQWVP VLA+Q +FYLP IW + Y G D ++ A A +Q + + + VN++ + ++L + K +E ++C GK G + Y+ IK +YL N F Q I++ FL G+ +G+ ++ G+EW D+ +FPRVT C +++ + + Y QC L INM N
Sbjct: 21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSK------------NEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDF-SVRKLANVHRYTVQCVLMINMFN 275
BLAST of innexin vs. uniprot
Match: gi|10719983|sp|Q27295|EAT5_CAEEL (RecName: Full=Innexin eat-5; AltName: Full=Abnormal pharyngeal pumping eat-5)

HSP 1 Score: 121.324 bits (303), Expect = 1.95087e-29
Identity = 82/276 (29.71%), Postives = 148/276 (53.62%), Query Frame = 3
Query:  252 MEDFG-DRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
++D G DRL++ ST I++ +++ I+ + Y+ + + C++P Q T ++ + + YC+V+ T + N +P T E +++ YYQW PF++A++ FYLP I W M++ SG ++ LVE A A + + + ++ + ++ N L RK RN + K+++ + F G + G+ + Y+ K +Y+ N+F Q FL G ND +G +L +IL G +W + FPR+ C + ++ +G Y QC L +NM N
Sbjct: 15 LDDLGTDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKA-WEQYAEDYCFVYNTYWVKPNDKVPLTVEE----RVSQQLIYYQWAPFIMAIEAAFFYLPVIFWSMLSTK-SGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNL---RKRRNEEETT--KMAKIQRIF--GMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFL--GQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQ-VRVLGNLQRYSIQCVLTLNMFN 274
BLAST of innexin vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 115.161 bits (287), Expect = 2.2064e-27
Identity = 90/284 (31.69%), Postives = 145/284 (51.06%), Query Frame = 3
Query:  249 GMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAA------SNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
G +D DRL++ + IL + +VIS K Y I C++ + +++++SYCW+ T IPM+ N P T E ++I YYQWVPF+L + ++F LP I W++ ++ SG +++ L+ A A S++ +A T N V NL +L + +IR + +K S SG+ + + Y F K LY +N Q ++ L FG+ VL +I G+ W +T FPRVT C + ++++ N Y QCAL IN++N
Sbjct: 19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVD-NL-DLQSPNGRIRARGWIARIKFSRF--------LSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIIN 282
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 466.848 bits (1200), Expect = 7.52747e-163
Identity = 236/295 (80.00%), Postives = 260/295 (88.14%), Query Frame = 3
Query:  192 MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
MVLSEFIDYATKYKW DFVGMEDF D+LSF++STSILLLLT+VI+VKSYLL SIACYIPI P+G DFDDFLKSYCWVHGTIP+ N P P E+ WE D+ RINYYQWVPFVLALQG+LFYLPRIIWQMITYNLSGTDLEGLVEMAN+ASNQTG+AK+ETV+Q+AMNLENLLFSHRKI H K IM KLS AKSW C+ KRSGRQL QYMFIK LY+INAFGQL LMQYFL+FGH +SFGY VLKNIL G+EWNDT+IFPRVTYCY+KNI+HV I N+YLAQC LPINMLN
Sbjct: 1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP-PDIES-WEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLN 293
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 300.827 bits (769), Expect = 5.30114e-98
Identity = 150/295 (50.85%), Postives = 208/295 (70.51%), Query Frame = 3
Query:  198 LSEFIDYATKYKWVDFVGMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHN--DSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+ F+ T ++ +VG+ED D+ SF S IL++ +V++S K Y+ A I+CYIP+ +G D D ++K+YCWVHGTIP + N +P+T++EW AD +INYYQWVPFVL LQGVLFYLPR+IW+ I YNLSG DLEGLV A ASNQ G+ + ET+ QVA LE+ LF R++ H K +L+ + S C G+R+G I Y+ IK LYL NA Q+ILMQ FL +G + +++FG+T+LK+IL+GK+WND L+FPRV++C++ +I V N ++AQCALPINMLN
Sbjct: 1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLN 292
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 295.049 bits (754), Expect = 1.56335e-95
Identity = 144/296 (48.65%), Postives = 202/296 (68.24%), Query Frame = 3
Query:  192 MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA-GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
MV EF++ ++K +VG+EDF D+LSF S ++L+L +V+++KSYL +ACY P G +F+++L++YCWVHGTI +P+ + +W AD RINYYQWVPF+L LQ ++FY+P+IIWQ+I YN SGT+LE +V ANAA+N + + + ++A +E++LF HR R + + FC K G LI+ Y+ IKFLY +N GQL +M+ FL F + SSFGYTVL N+++GKEW+ T IFPRVTYCYV+NIKHVG+ N Y+AQCALP+NMLN
Sbjct: 1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLN 296
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 290.041 bits (741), Expect = 6.29122e-94
Identity = 146/280 (52.14%), Postives = 196/280 (70.00%), Query Frame = 3
Query:  243 FVGMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHN--DSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+VG+ED D+ SF S IL++ TV++S K Y+ IACYIPI TG +D++++YCW HGTIP N +P+ +W AD R+NYYQWVPFVL LQGVLFYLPR+IW+ I YNLSG DLEGLV A ASNQ G+ + ET+ QVA LE+ LF R++ H K +L+ + S C G+R+G I Y+ IK LYL NA Q+ILMQ FL +G + +++FG+T+LK+IL+GK+WND L+FPRV++C++ +I V N ++AQCALPINMLN
Sbjct: 16 YVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLN 292
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 259.61 bits (662), Expect = 6.82156e-82
Identity = 128/296 (43.24%), Postives = 183/296 (61.82%), Query Frame = 3
Query:  192 MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNXXXXXXXXXXXXXXXKSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA-GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
MV EF+ ++K + G+EDF DRL+F S IL L V+++ K+Y ++CY+ P+G +FD ++++YCWVHGTIP N +P +W D +RI YYQWVPF+L LQ +LFY+P+++W++I YN GT+LE L+ A +S + +N + +E+LL+ HR R + + FC K G L+ Y FIK LY IN GQL LM+ FL F + SSFGYT+L +I++GK W++T FPRV+YCY +IKH+G N Y+AQC LP+NMLN
Sbjct: 1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLN 296
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 67.3958 bits (163), Expect = 3.72728e-12
Identity = 65/260 (25.00%), Postives = 107/260 (41.15%), Query Frame = 3
Query:  330 KSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMH------NNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLK-NILNGKEWNDTL--IFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+ Y+ I C + P G + +YCW++ T +P + P + E D+++ YYQWV FVL Q +LFY+PR +W+ + G L+ LV N+ VN + +N RK I++ +F ++ + L +N GQ+ + +FL+ S++G VLK L E D + +FP+VT C G + C LP+N++N
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSP----------IVND-------------ECKNDRKKILV------DYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVN 264
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 67.3958 bits (163), Expect = 3.72728e-12
Identity = 65/260 (25.00%), Postives = 107/260 (41.15%), Query Frame = 3
Query:  330 KSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMH------NNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLK-NILNGKEWNDTL--IFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+ Y+ I C + P G + +YCW++ T +P + P + E D+++ YYQWV FVL Q +LFY+PR +W+ + G L+ LV N+ VN + +N RK I++ +F ++ + L +N GQ+ + +FL+ S++G VLK L E D + +FP+VT C G + C LP+N++N
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSP----------IVND-------------ECKNDRKKILV------DYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVN 264
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 67.3958 bits (163), Expect = 3.72728e-12
Identity = 65/260 (25.00%), Postives = 107/260 (41.15%), Query Frame = 3
Query:  330 KSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMH------NNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLK-NILNGKEWNDTL--IFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+ Y+ I C + P G + +YCW++ T +P + P + E D+++ YYQWV FVL Q +LFY+PR +W+ + G L+ LV N+ VN + +N RK I++ +F ++ + L +N GQ+ + +FL+ S++G VLK L E D + +FP+VT C G + C LP+N++N
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSP----------IVND-------------ECKNDRKKILV------DYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVN 264
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 67.3958 bits (163), Expect = 3.72728e-12
Identity = 65/260 (25.00%), Postives = 107/260 (41.15%), Query Frame = 3
Query:  330 KSYLLASIACYIPIQPTGHDFDDFLKSYCWVHGT--IPMH------NNRPMPRTENEWEYADKMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLK-NILNGKEWNDTL--IFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+ Y+ I C + P G + +YCW++ T +P + P + E D+++ YYQWV FVL Q +LFY+PR +W+ + G L+ LV N+ VN + +N RK I++ +F ++ + L +N GQ+ + +FL+ S++G VLK L E D + +FP+VT C G + C LP+N++N
Sbjct: 45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSP----------IVND-------------ECKNDRKKILV------DYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVN 264
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 63.5438 bits (153), Expect = 7.86602e-11
Identity = 62/242 (25.62%), Postives = 94/242 (38.84%), Query Frame = 3
Query:  393 DDFLKSYCWVHGTIPM--------HNNRPMPRTENEWEYAD-KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANAASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCAGKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKNILNGKEWNDTL-----IFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN 1076
+D L +YCW+H T + + P P N ++ YYQWV F L Q +LFY PR +W+ + G + L+ + + K + + ENL R H +W+ +Y + L LIN GQ+ LM F F +FG V+ + +E D + IFPR+T C G + A C LP+N++N
Sbjct: 66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------RYH------------NWWA----------YRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQE--DRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVN 270
The following BLAST results are available for this feature:
BLAST of innexin vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL2.818630e-3831.49RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.772210e-3532.49RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|12643734|sp|Q19746|INX3_CAEEL4.909000e-3129.35RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|10719983|sp|Q27295|EAT5_CAEEL1.950870e-2929.71RecName: Full=Innexin eat-5; AltName: Full=Abnorma... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR2.206400e-2731.69RecName: Full=Innexin-19[more]
back to top
BLAST of innexin vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150009187.527470e-16380.00Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150036485.301140e-9850.85SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150008371.563350e-9548.65Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150036496.291220e-9452.14SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150006576.821560e-8243.24Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of innexin vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|3.727280e-1225.00innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|3.727280e-1225.00innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|3.727280e-1225.00innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|3.727280e-1225.00innexin 2, isoform D [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|7.866020e-1125.62shaking B, isoform G [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_023720 ID=Ddo_023720|Name=innexin|organism=Dugesia dorotocephala|type=mRNA|length=1076bp
TTCCGATCTCAAAACCACACTTATTGTATTTGATGTTAATGTAAATACTT
CGTCTACGGTTTATTCGATGACATTTAAGTGAAGTTATTACTCACATTTG
AAGGTCTACTCAACACAATTTTCAAACACGATCAGTTTATCAGAAATTAA
AACTAAATTTATTTTTTCCAGGAACAATCTCGATCATAGCTATGGTTCTG
TCAGAGTTCATTGATTACGCTACCAAATACAAATGGGTGGATTTTGTGGG
CATGGAAGACTTTGGCGACCGGTTAAGTTTCAACCTTTCCACTTCGATAT
TATTGCTTCTCACTGTTGTTATATCAGTTAAAAGTTATTTGTTAGCTTCA
ATTGCTTGTTATATTCCTATTCAACCAACCGGTCATGATTTTGATGATTT
TTTGAAGAGTTATTGTTGGGTACATGGAACCATACCGATGCATAATAATC
GTCCCATGCCACGAACTGAAAATGAATGGGAATATGCAGACAAAATGGAA
AGAATAAATTATTATCAATGGGTTCCTTTTGTACTTGCTTTACAAGGGGT
CCTTTTTTATTTACCGAGAATCATATGGCAAATGATCACTTACAACTTAT
CTGGGACAGATCTGGAAGGACTCGTGGAAATGGCGAATGCTGCTAGTAAT
CAAACTGGTCAAGCGAAAGCAGAAACTGTAAATCAAGTCGCAATGAATCT
GGAAAATCTGTTGTTTTCCCATAGAAAAATTCGAAATCATAGAAAATTAA
TAATGTTGAAACTTTCTGAAGCTAAATCTTGGTTTTGTGCTGGAAAAAGA
AGTGGTCGGCAATTAATCGTTCAATATATGTTCATTAAATTCTTATATTT
AATTAATGCTTTCGGACAACTTATACTCATGCAATACTTCTTGAATTTCG
GTCACAATGACTCGAGCTTTGGTTACACGGTTCTTAAGAACATACTAAAC
GGGAAAGAATGGAATGATACTTTAATATTTCCAAGGGTCACATATTGTTA
TGTAAAAAATATTAAACATGTTGGAATAACAAATGATTACTTAGCTCAAT
GCGCTCTACCAATAAATATGTTAAAT

Design Primers for innexin

back to top

protein sequence

>Ddo_023720-protein ID=Ddo_023720-protein|Name=innexin|organism=Dugesia dorotocephala|type=polypeptide|length=295bp
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
back to top

coding sequence

>Ddo_023720.192.1076 ID=Ddo_023720.192.1076|Name=Ddo_023720.192.1076|organism=Dugesia dorotocephala|type=CDS|length=885bp
ATGGTTCTGTCAGAGTTCATTGATTACGCTACCAAATACAAATGGGTGGA
TTTTGTGGGCATGGAAGACTTTGGCGACCGGTTAAGTTTCAACCTTTCCA
CTTCGATATTATTGCTTCTCACTGTTGTTATATCAGTTAAAAGTTATTTG
TTAGCTTCAATTGCTTGTTATATTCCTATTCAACCAACCGGTCATGATTT
TGATGATTTTTTGAAGAGTTATTGTTGGGTACATGGAACCATACCGATGC
ATAATAATCGTCCCATGCCACGAACTGAAAATGAATGGGAATATGCAGAC
AAAATGGAAAGAATAAATTATTATCAATGGGTTCCTTTTGTACTTGCTTT
ACAAGGGGTCCTTTTTTATTTACCGAGAATCATATGGCAAATGATCACTT
ACAACTTATCTGGGACAGATCTGGAAGGACTCGTGGAAATGGCGAATGCT
GCTAGTAATCAAACTGGTCAAGCGAAAGCAGAAACTGTAAATCAAGTCGC
AATGAATCTGGAAAATCTGTTGTTTTCCCATAGAAAAATTCGAAATCATA
GAAAATTAATAATGTTGAAACTTTCTGAAGCTAAATCTTGGTTTTGTGCT
GGAAAAAGAAGTGGTCGGCAATTAATCGTTCAATATATGTTCATTAAATT
CTTATATTTAATTAATGCTTTCGGACAACTTATACTCATGCAATACTTCT
TGAATTTCGGTCACAATGACTCGAGCTTTGGTTACACGGTTCTTAAGAAC
ATACTAAACGGGAAAGAATGGAATGATACTTTAATATTTCCAAGGGTCAC
ATATTGTTATGTAAAAAATATTAAACATGTTGGAATAACAAATGATTACT
TAGCTCAATGCGCTCTACCAATAAATATGTTAAAT
back to top
Gene Groups
innexin is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.