porcupine-like, Ddo_022473 (mRNA) Dugesia dorotocephala

Overview
Nameporcupine-like
Unique NameDdo_022473
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1860
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NotePorcupine-like
Homology
BLAST of porcupine-like vs. uniprot
Match: gi|82082193|sp|Q5ZKL6|MBOA2_CHICK (RecName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 234.572 bits (597), Expect = 2.18391e-67
Identity = 164/469 (34.97%), Postives = 241/469 (51.39%), Query Frame = 3
Query:  216 MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVG-------------YDKKW--------IPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVL 1550
M+ GST+L PL+N V +PVDQ+NF+VC L ++ R K S R ++ T G+ + LFCFG+ + ++QS +SY L+++ + LG+++V + R++ +DYG Y+ D SGP+MI TQK+TSLAF + DG R NE Q+ AVR++P +++ Y F GILAGP Y +Y +I G D K+ I A+K L L L + H +T P + +++ R+ + +S R KYYFAW++ +A ++G GF G ++NG W + N IE S K+ +D WNI T WL+ + YERA F TI F SA WHG YPGYY+ FLT L T AR +R +IR F+ SP Y +T + T +A++Y PF LL + F+ YF HI ++ +L
Sbjct: 1 MATSTTGSTLLQPLSNAVRLPVDQVNFVVCQLFALLAAIWFRTYLHSSKTSPFIRHVVATLLGLYLALFCFGWYALHFVIQSGISYYLMIIIGVENMHKYCFVFALGYLTVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAFEIHDGMFRKNEDLTPSQR---CLAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYQLQQSEANGKEDTKYEQTDPSPNIAVAQKLLICGLSL-LFHMTITK----TLPVEYNIDENFRATASWPVRVFYLYLSLMAARPKYYFAWTLADAINNAAGFGFRGYDKNGVTRWDLISNLRIQQIESSTSFKMFLDNWNIQTALWLKRVCYERAT-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAIRNNIRHYFVESPAVKLCYDIITWMTTQVAISYTVVPFVLLSVKPSFTFYSSCYFCLHIASILVLL 460
BLAST of porcupine-like vs. uniprot
Match: gi|81879081|sp|Q8R3I2|MBOA2_MOUSE (RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 2; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=Lysophosphatidylcholine acyltransferase; Short=LPCAT; Short=Lyso-PC acyltransferase; AltName: Full=Lysophosphatidylcholine acyltransferase 4; Short=Lyso-PC acyltransferase 4; Short=mLPCAT4; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 221.861 bits (564), Expect = 9.48865e-63
Identity = 147/447 (32.89%), Postives = 225/447 (50.34%), Query Frame = 3
Query:  252 PLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDK---------------KWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAM 1538
PL+N V +P+DQ+NF+VC L ++ R K S R ++ T G+ + FCFG+ + L+QS +SY ++++ + LG++SV + R++ +DYG Y+ D SGP+MI TQK+TSLA+ + DG R +E Q+ AVR++P +++ YT F GILAGP Y +Y +I G K P ++ L + + + ++ P + +Q + + +S R KYYFAW++ +A ++G GF G ++NG W + N IE S K+ +D WNI T WL+ + YERA F TI F SA WHG YPGYY+ FLT L T AR VR + R FL P FY +T + T + ++Y PF LL + F+ +Y+ H+ ++
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMQQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRG---LAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSI 456
BLAST of porcupine-like vs. uniprot
Match: gi|143811417|sp|Q6ZWT7|MBOA2_HUMAN (RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 2; AltName: Full=1-acylglycerophosphate O-acyltransferase; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=Lysophosphatidic acid acyltransferase; Short=LPAAT; Short=Lyso-PA acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 219.55 bits (558), Expect = 9.19239e-62
Identity = 151/443 (34.09%), Postives = 235/443 (53.05%), Query Frame = 3
Query:  252 PLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAK--------KQLSAALCLSVIHGVLTAYVAPQFPYIFVCST---DY---QRMHMT----RRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQ-FYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYF 1517
PL+N V +P+DQ+NF+VC L ++ R K S R ++ T G+ + LFCFG+ + L+QS +SY ++++ + + LG+++V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R +E Q++ AVR++P +++ Y F GILAGP Y +Y +I G + ++ + +V+ +L ++ F ++ +C+T +Y + T +I++ IS R KYYFAW++ +A ++G GF G +ENG W + N IE S K+ +D WNI T WL+ + YER F TI F SA WHG YPGYY+ FLT L T AR +R + R F + P L+ FY +T I T +A++Y PF LL + L F+ +Y+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRD---LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLF-HLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYF-IEPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450
BLAST of porcupine-like vs. uniprot
Match: gi|124015157|sp|Q3T1J2|MBOA2_RAT (RecName: Full=Membrane-bound O-acyltransferase domain-containing protein 2; Short=O-acyltransferase domain-containing protein 2)

HSP 1 Score: 219.164 bits (557), Expect = 1.06974e-61
Identity = 155/490 (31.63%), Postives = 240/490 (48.98%), Query Frame = 3
Query:  252 PLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDK---------------KWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFRPIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG 1667
PL+N V +P+DQ+NF+VC L ++ R K S R ++ T G+ + FCFG+ + L+QS +SY ++++ + LG++SV + R++ +DYG Y+ D SGP+MI TQK+TSLA+ + DG R +E Q+ AVR++P +++ YT F GILAGP Y +Y +I G K P ++ L + + + ++ P + +Q + + +S R KYYFAW++ +A ++G GF G ++NG W + N IE S K+ +D WNI T WL+ + YERA F T+ F SA WHG YPGYY+ FLT L T AR VR + R F+ P FY +T T + ++Y PF LL F++ +Y+ HI ++ +L L + K ++ N AQ K ++ + LG
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMHQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRG---LAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHMAQSGENGKEEQHGKAEPSPNAAVTEKLLVCGLSLLFHLTISSMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTVQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFVEPPQLKLFYDIITWAATQITISYTVVPFVLLSINPSFTFYRSWYYCLHICSILVLLLLPVKKSPRKKNTEEN------AQPSWAKKFDERENSLG 493
BLAST of porcupine-like vs. uniprot
Match: gi|81873769|sp|Q8BH98|MBOA1_MOUSE (RecName: Full=Lysophospholipid acyltransferase 1; Short=LPLAT 1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=1-acylglycerophosphoserine O-acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Lysophosphatidylserine acyltransferase; Short=LPSAT; Short=Lyso-PS acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 1; Short=O-acyltransferase domain-containing protein 1)

HSP 1 Score: 211.46 bits (537), Expect = 3.67796e-59
Identity = 156/492 (31.71%), Postives = 253/492 (51.42%), Query Frame = 3
Query:  210 AAMSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYW-CLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESH--AVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVG-------YDKKWI---------PCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDY-QRMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFRPIINDKVSQMNDILTKKAQ 1622
A++S GST L PL+ ++GIP+DQ+NF+ C L ++ R P K S R + T GI V+FCFG+ +L + + Y + MV S H +++ +G++++ H+ R++ + YG T D SGP+MI TQK+T+LAF + DG G+K + + E H AV+ P +++ Y F ++AGP + +Y +I G + W P + LC++++ +L ++ FP F+ + + + R+ + + + KYYFAW++ +A ++G GF G + +G++ W + N + IE S K+ ++ WNI T+ WL+ + YER P + T+L F SA WHG YPGYY FLT T AR VR + R FL S Y VT T LA++Y PF +L + + +K +FF HI+ + +L L +P + S+ + + KKA
Sbjct: 7 ASLSYRTTGSTCLHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCYGV-MVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG----LGRKAEDLSAEQHRLAVKAKPSLLEYLSYHLNFMSVIAGPCNNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLPEPSPMGAVIQKLCVTLMSLLLFLTLSKSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGFNGMDTDGKSRWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVPWY-PTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQLAVSYTAAPFVMLAVEPTISLYKSVFFFLHIICLLIILFLPIKPHQPQRQSRSPNSVKKKAD 492
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15039044 (dd_smedV4_413_0_1|m.25695|m.4576)

HSP 1 Score: 838.565 bits (2165), Expect = 0
Identity = 415/483 (85.92%), Postives = 458/483 (94.82%), Query Frame = 3
Query:  216 MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFRPIINDKVSQMNDILTKKAQYRLKKIKNQIQRKL 1664
MS+FYGGSTILAPL+N++GIPVDQINFIVCSLLSIGLGQ+MRHKFPP KLSG+TRG+IE FFGILIVLFCFGYQVKYLLLQSTVSYV+L+ PS+I+AHLVTYWC+ FM++VHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHR+N+G KL Q+NHESHAV+KLPDA+KFFGYTFYFHG+LAGPFVFYNEYKEYI GYD K IPC+KKQLS+ALCLSVIHG+LTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWS+VEAGALS+GLG+ GK++NGEN+WSKVKNYDFMAIE G+SLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF SAFWHGFYPGYY+MFLTF LFTFCARTVRKHIRPLF+VSPI LQ YH +T IFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGH+LAMF VLTL+FRPIINDKV+ MN++ T+KAQYR +K+K +Q+KL
Sbjct: 1 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLLQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKL 483
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15001330 (Asxlregen_comp63653_c0_seq2|m.14305|m.9304)

HSP 1 Score: 322.013 bits (824), Expect = 1.77672e-101
Identity = 199/502 (39.64%), Postives = 287/502 (57.17%), Query Frame = 3
Query:  216 MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAK------KQLSAAL------------CLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHM-TRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILA-MFFVLTLRFRPIINDKVSQMNDILTKKAQYRLKKIKNQIQRK 1661
MS FY GS I P+++ VG+ VDQ NF+ C L++ G G + K+S R +IE G+ + +FCFG Q+ +LL QS Y+++ ++ A + + + L F+SV HL RM+YDYGGYT+DI+GP+MIQTQKL+SLAFNL DG R+ + + L++ H HA+ K P ++FF Y FYFHGI+ GPFVF +Y +I G ++ + K K S L CL + G+LT +V P F + + +Y + M + IM T++S FLVRQKYYFAWSI + SGLGF G +E + + VKN+DF IE G S K ++D WN+ T WLRE +Y+R P T+ VF S+ WHG+YPGYY+ F++ LFT +R RK+IRPL + +NL Y +T + LALNY PF LE Q W +F H+ + + + LT + P+ + + + K + N I+ +
Sbjct: 1 MSNFYSGSKIFQPVSDAVGLTVDQFNFMFCQLVASGFGFIFSRYLNTDKISPTFRHIIELVCGVSLTIFCFGSQIWHLLGQSISVYIMMNAMSTKSARYFILGFVLLFLSVAHLARMYYDYGGYTMDITGPLMIQTQKLSSLAFNLHDGQRIKKNEPLRRDYHRKHALLKYPTLLEFFSYMFYFHGIMVGPFVFLADYLRFIEGRQEEVLDNEKEKEYFRKNKSTILAGWPEIGFYVKSCL--VFGLLTIFVQPHFDPDYFKTDEYLQSGMFYKYIMLTIVS-FLVRQKYYFAWSIGSMSNIFSGLGFSGFSEERKPIYDVVKNFDFFKIELGTSTKSIIDNWNVGTIYWLRECVYDRIPRAYGTLAVFVCSSIWHGYYPGYYLCFMSLALFTEASRAGRKYIRPLVHKASLNLP-YDVLTSLLGMLALNYCAIPFTQLEVQLTFYIWSKMFFIVHVGSVLLYFLTPKLAPLFSSASGDHSPRVADKISGDDISVHNSIRNE 498
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15028343 (SmedSxldir_c96028_g2_i3|m.38137|m.41744)

HSP 1 Score: 312.768 bits (800), Expect = 4.47557e-98
Identity = 182/452 (40.27%), Postives = 257/452 (56.86%), Query Frame = 3
Query:  216 MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVG----------------YDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFG 1523
MS F+ GS IL P + VG+ +DQ NF+ C + + G+G L K++ N + + E GIL+ LFCFG Q+ YLL QS YV++ V R A + + + L F+SV H+ RM+YDYG YTLDI+GP+MIQTQKL+SLAFNL+DG R+ +KL++ H+ HA+ P ++FF YTFYFHG++ GPFVF +Y +I G +K I A ++S L V + +L ++ P F F+ S ++ + +R + I+ FLVRQKYY AW++ L +GLGF G +E + + VKN+ F E G S K ++D WN+ T WLRE +Y+R P TI VF SA WHG+YPGYY+ F + L T AR R+ R F + + L Y T + LN+ PF LL+ + G + WK Y G
Sbjct: 32 MSNFHSGSKILLPFSEAVGLKIDQFNFLFCQISACGIGYLFSRYLSRAKINPNYKHISEIILGILLTLFCFGLQIWYLLAQSISVYVMMNVLSVRKARYCILIFVLFFLSVAHIGRMYYDYGSYTLDITGPLMIQTQKLSSLAFNLMDGQRVKNKEKLRKDYHQVHAINHYPTVLEFFSYTFYFHGLMVGPFVFLGDYLRFIEGRQDELLINEDDKNHFKRNKFQILSAWPEISFHLFSLVCYSLLFFFIEPYFKPEFLLSDEFYQNGFFKRYLLMTITMFLVRQKYYIAWTMGSITNLFAGLGFSGFDEKQQPKYHIVKNFHFSRTEFGTSAKTMIDHWNVGTAIWLRECVYDRVPHSIGTITVFTCSAIWHGYYPGYYLAFASVALMTNAARCGRRLFRTYFHNAGLKLP-YDITTATMSMFCLNFSIIPFALLDIRKGFMVWKSLYILG 482
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15014228 (SmedAsxldir_c93263_g1_i1|m.32754|m.42353)

HSP 1 Score: 287.73 bits (735), Expect = 1.30647e-88
Identity = 169/479 (35.28%), Postives = 269/479 (56.16%), Query Frame = 3
Query:  216 MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAKKQ----------------LSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNE-NGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQ---FYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFRPIINDKVSQ 1592
MS+FY G PL++ GI VDQ NF+ C + +G+ + K+ +S R G + LFCFG+Q+ +L + +SY ++ P + + ++V + + +++V HL R ++DYGGYTLDI+GP+M+ Q+L+ LAFNL DG ++ + +KL + HAV + P ++FF Y F I+ GPF+FY++Y +I G + ++ +K++ + +I G L +V P F F + ++ + +++F +I L+RQ+YYFAWS+ A L SGLGF G N+ +G+ ++ + N+D IE ++K ++DGWN +WLRE IY RAP T VF SA WHGFYPGYY+ F+T +F +R R++IRP FLV+ + Q FY +T + + A+NY PF LL + FW+ +YF GH+ ++ +RF P I ++ Q
Sbjct: 19 MSKFYAGVRFFEPLSSKFGIHVDQFNFVFCMFAACLMGRQFQTKYSIKNISAEQRHRFAFLGGFTLALFCFGHQIMHLFIPPIISYCIMYFLPYQHSRYIVLLFAMSYLAVTHLARQYWDYGGYTLDITGPLMVLVQRLSILAFNLYDGDQIKKKRKLDFDDAIKHAVLEHPTPLQFFSYVINFQTIMIGPFIFYSDYLRFIEGREIEYAETSKEKEYFVVHRTSILSPEDVTKKYFIIMLICGGLHLFVFPFFQPTFYLTPEFGQYSFINKVIFMLIVSPLLRQQYYFAWSLTSACCLCSGLGFSGFNKISGKPEYKLIDNFDMRNIEMAKNMKAIIDGWNKPANQWLRECIYNRAPKKFATPAVFICSAIWHGFYPGYYLFFVTAGIFLEISRMARRYIRPYFLVNFGDGQTSKFYDVLTTLISMFAINYMSVPFVLLGLSKSIQFWRQFYFCGHLAVPALLILIRFLPKIRTRIHQ 497
BLAST of porcupine-like vs. Smed Unigenes AA
Match: SMU15003924 (SmedAsxldir_c103283_g3_i5|m.58037|m.44976)

HSP 1 Score: 62.003 bits (149), Expect = 5.38639e-10
Identity = 66/272 (24.26%), Postives = 107/272 (39.34%), Query Frame = 3
Query:  612 MIQTQKLTSLAFNLLDGHRLNEGQK--LQQKNHESHAVRKL----------PDAVKFFGYTFYFHGILAGPFVFYNEYKE--------YIVGYDKKWIPCAKKQLSAALCLSVIHGVLTAYV-APQFPYI-FVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKN-------------------ENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFC-RTILVFATSAFWHGFYPG 1301
++ T KL AF + D K L E + + L D + F Y++ F G+L GP+ Y Y + Y+ Y + W +L A + V AY+ A F +I + S ++ R +F + FF+ R + YFAW I E + +G+G + ++ + +N + E S++ + WN+S WL +Y R P+ RT + SAFWHG +PG
Sbjct: 106 LVLTLKLVGAAFEIKDSLERERKLKILLNTIQMEDNEIEDLKLEIKYFNVKSDVIDLFTYSYCFIGLLTGPYFKYRVYLDCSQFSSTVYVNRYIEFW-----NRLKNAAFIGV------AYLFASHFYFIEYAKSDEFYNRSFFYRFVFMSVMFFVFRMRMYFAWLISECVCMCAGMGAYPASSVPVPGHGPTNLKGMEPIGDSIAVSYDTTRNLNISGCEWAPSVRDGMRSWNMSVQYWLATFVYRRFPIKAYRTFVTMLVSAFWHGVHPG 366
BLAST of porcupine-like vs. RefSeq Human
Match: gi|40548387|ref|NP_620154.2| (lysophospholipid acyltransferase 2 [Homo sapiens])

HSP 1 Score: 219.55 bits (558), Expect = 3.46928e-62
Identity = 151/443 (34.09%), Postives = 235/443 (53.05%), Query Frame = 3
Query:  252 PLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAK--------KQLSAALCLSVIHGVLTAYVAPQFPYIFVCST---DY---QRMHMT----RRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQ-FYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYF 1517
PL+N V +P+DQ+NF+VC L ++ R K S R ++ T G+ + LFCFG+ + L+QS +SY ++++ + + LG+++V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R +E Q++ AVR++P +++ Y F GILAGP Y +Y +I G + ++ + +V+ +L ++ F ++ +C+T +Y + T +I++ IS R KYYFAW++ +A ++G GF G +ENG W + N IE S K+ +D WNI T WL+ + YER F TI F SA WHG YPGYY+ FLT L T AR +R + R F + P L+ FY +T I T +A++Y PF LL + L F+ +Y+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRD---LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLF-HLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYF-IEPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450
BLAST of porcupine-like vs. RefSeq Human
Match: gi|767913127|ref|XP_011508611.1| (PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Homo sapiens])

HSP 1 Score: 193.356 bits (490), Expect = 6.77574e-54
Identity = 123/370 (33.24%), Postives = 194/370 (52.43%), Query Frame = 3
Query:  252 PLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAK--------KQLSAALCLSVIHGVLTAYVAPQFPYIFVCST---DY---QRMHMT----RRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPG 1301
PL+N V +P+DQ+NF+VC L ++ R K S R ++ T G+ + LFCFG+ + L+QS +SY ++++ + + LG+++V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R +E Q++ AVR++P +++ Y F GILAGP Y +Y +I G + ++ + +V+ +L ++ F ++ +C+T +Y + T +I++ IS R KYYFAW++ +A ++G GF G +ENG W + N IE S K+ +D WNI T WL+ + YER F TI F SA WHG YPG
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRD---LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLF-HLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPG 378
BLAST of porcupine-like vs. RefSeq Human
Match: gi|122937404|ref|NP_001073949.1| (lysophospholipid acyltransferase 1 [Homo sapiens])

HSP 1 Score: 195.667 bits (496), Expect = 7.36683e-54
Identity = 148/463 (31.97%), Postives = 235/463 (50.76%), Query Frame = 3
Query:  210 AAMSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYW-CLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESH--AVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWI-------------------PCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 1520
+++S GST L PL+ ++GIP+DQ+NF+VC L+++ R P S + R + T FGI V+FCFG+ +L + + Y +MV S H +++ +G++++ H+ R++ + YG T D SGP+MI TQK+T+LAF + DG G++ + + E H A++ P +++ Y F ++AGP N +K+YI + K I P + L ++++ +L + FP C D +H R+ + + + KYYFAW++ +A ++G GF G ++NG W + N + IE S K+ ++ WNI T WL+ + Y+R P + T+L F SA WHG YPGYY FLT L T AR VR + R FL S Y T T LA++Y PF +L + + +K YF+
Sbjct: 8 SSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYA-IMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG----LGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC---NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFP--VTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFY 459
BLAST of porcupine-like vs. RefSeq Human
Match: gi|578811432|ref|XP_006715062.1| (PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Homo sapiens])

HSP 1 Score: 172.17 bits (435), Expect = 7.3572e-46
Identity = 136/437 (31.12%), Postives = 216/437 (49.43%), Query Frame = 3
Query:  288 INFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYW-CLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESH--AVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWI-------------------PCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 1520
+NF+VC L+++ R P S + R + T FGI V+FCFG+ +L + + Y + MV S H +++ +G++++ H+ R++ + YG T D SGP+MI TQK+T+LAF + DG G++ + + E H A++ P +++ Y F ++AGP N +K+YI + K I P + L ++++ +L + FP C D +H R+ + + + KYYFAW++ +A ++G GF G ++NG W + N + IE S K+ ++ WNI T WL+ + Y+R P + T+L F SA WHG YPGYY FLT L T AR VR + R FL S Y T T LA++Y PF +L + + +K YF+
Sbjct: 2 VNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAI-MVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG----LGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC---NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFP--VTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFY 427
BLAST of porcupine-like vs. RefSeq Human
Match: gi|767913132|ref|XP_011508613.1| (PREDICTED: lysophospholipid acyltransferase 2 isoform X3 [Homo sapiens])

HSP 1 Score: 167.162 bits (422), Expect = 5.67347e-45
Identity = 108/342 (31.58%), Postives = 178/342 (52.05%), Query Frame = 3
Query:  252 PLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAK--------KQLSAALCLSVIHGVLTAYVAPQFPYIFVCST---DY---QRMHMT----RRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRE 1217
PL+N V +P+DQ+NF+VC L ++ R K S R ++ T G+ + LFCFG+ + L+QS +SY ++++ + + LG+++V + R++ +DYG Y+ D SGP+MI TQK+TSLA + DG R +E Q++ AVR++P +++ Y F GILAGP Y +Y +I G + ++ + +V+ +L ++ F ++ +C+T +Y + T +I++ IS R KYYFAW++ +A ++G GF G +ENG W + N IE S K+ +D WNI T WL+
Sbjct: 14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRD---LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLF-HLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKR 351
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|20129843|ref|NP_610546.1| (oysgedart, isoform A [Drosophila melanogaster])

HSP 1 Score: 253.062 bits (645), Expect = 2.19463e-73
Identity = 155/464 (33.41%), Postives = 242/464 (52.16%), Query Frame = 3
Query:  219 SEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAKKQLSA-------------ALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1556
++ Y GS L ++VG+ VD +NF++C + ++ L L R P K+S R G+ FCFG Q ++ + Y+++ RI V + ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG G + K + HA+RK+P A+++F Y ++F ILAGP VFY +Y E++ GY+ P L + A+ V+ ++ A++ +F I+ + M M + M++ +R KYY AW + +A +SGLGF G +++G + W + N + ++ E +++ ++ WN T RWLR L+YER P T+L FA SA WHGFYPGYY+ F T + ART R+ R F + + FY +T + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 10 NDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399947|ref|NP_001286265.1| (oysgedart, isoform B [Drosophila melanogaster])

HSP 1 Score: 253.062 bits (645), Expect = 2.19463e-73
Identity = 155/464 (33.41%), Postives = 242/464 (52.16%), Query Frame = 3
Query:  219 SEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAKKQLSA-------------ALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1556
++ Y GS L ++VG+ VD +NF++C + ++ L L R P K+S R G+ FCFG Q ++ + Y+++ RI V + ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG G + K + HA+RK+P A+++F Y ++F ILAGP VFY +Y E++ GY+ P L + A+ V+ ++ A++ +F I+ + M M + M++ +R KYY AW + +A +SGLGF G +++G + W + N + ++ E +++ ++ WN T RWLR L+YER P T+L FA SA WHGFYPGYY+ F T + ART R+ R F + + FY +T + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 10 NDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399951|ref|NP_001286267.1| (oysgedart, isoform E [Drosophila melanogaster])

HSP 1 Score: 253.062 bits (645), Expect = 2.19463e-73
Identity = 155/464 (33.41%), Postives = 242/464 (52.16%), Query Frame = 3
Query:  219 SEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAKKQLSA-------------ALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1556
++ Y GS L ++VG+ VD +NF++C + ++ L L R P K+S R G+ FCFG Q ++ + Y+++ RI V + ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG G + K + HA+RK+P A+++F Y ++F ILAGP VFY +Y E++ GY+ P L + A+ V+ ++ A++ +F I+ + M M + M++ +R KYY AW + +A +SGLGF G +++G + W + N + ++ E +++ ++ WN T RWLR L+YER P T+L FA SA WHGFYPGYY+ F T + ART R+ R F + + FY +T + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 10 NDCYNGSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 471
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|665399949|ref|NP_001286266.1| (oysgedart, isoform D [Drosophila melanogaster])

HSP 1 Score: 240.35 bits (612), Expect = 7.16091e-69
Identity = 148/443 (33.41%), Postives = 230/443 (51.92%), Query Frame = 3
Query:  282 DQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKWIPCAKKQLSA-------------ALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIM-----FTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATSAFWHGFYPGXXXXXXXXXXXXXCARTVRKHIRPLFLVSPINLQFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTL 1556
D +NF++C + ++ L L R P K+S R G+ FCFG Q ++ + Y+++ RI V + ++ VHL R YDYG Y LDI+GP+MI TQK+TSLAF++ DG G + K + HA+RK+P A+++F Y ++F ILAGP VFY +Y E++ GY+ P L + A+ V+ ++ A++ +F I+ + M M + M++ +R KYY AW + +A +SGLGF G +++G + W + N + ++ E +++ ++ WN T RWLR L+YER P T+L FA SA WHGFYPGYY+ F T + ART R+ R F + + FY +T + T + L Y PF LLEF + + +Y HI+++ + L
Sbjct: 11 DLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDG--FVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTLLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHIISLVTIFIL 451
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Match: gi|24666648|ref|NP_524157.2| (nessy, isoform A [Drosophila melanogaster])

HSP 1 Score: 77.0258 bits (188), Expect = 1.713e-14
Identity = 72/360 (20.00%), Postives = 154/360 (42.78%), Query Frame = 3
Query:  243 ILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKLSGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHLVTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKEYIVGYDKKW---IPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEXXXXXXXXXXXXKNENGENDWSKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFATS----AFWHGFYPG 1301
++ + + VG+PV+ + ++ L + L + KF + G + F +G + L+ +Y L+++ + L + MS + L + Y + + P I ++ F++ DG L E +L + E+ A++K P ++ ++++ G L GP + YK ++ G ++ + ++ A ++ V Y+ P + + ++ ++ +RI KY W + E + GL + G+++NG+ DWS N +E GN+++ V +N++T +W+ + IY+R + + + A WHG++ G
Sbjct: 13 LMDGIASGVGVPVEALRLLLTILAGYPVAALYQ-KFISVIADKTVHHMFFAGCGAGLCYFNYGLDTYHSLIAILTTYFLVLLLRKKTQIFLAINFVF-HMSYLLLGYFYTSSNDYDILWTMPHCILVLRMIGYGFDITDG--LKEESELSKDQKET-ALKKPPSLLELLAFSYFPSGFLVGPQFPFRRYKAFVDGEFRQHEGNVEAGVRRFGAGAFYLIVCQVGLRYL----PDSYFLTPEFAQVSFVKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGCSNVKLKLLETGNTMEHYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFLAVWHGYHSG 363
The following BLAST results are available for this feature:
BLAST of porcupine-like vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|82082193|sp|Q5ZKL6|MBOA2_CHICK2.183910e-6734.97RecName: Full=Membrane-bound O-acyltransferase dom... [more]
gi|81879081|sp|Q8R3I2|MBOA2_MOUSE9.488650e-6332.89RecName: Full=Lysophospholipid acyltransferase 2; ... [more]
gi|143811417|sp|Q6ZWT7|MBOA2_HUMAN9.192390e-6234.09RecName: Full=Lysophospholipid acyltransferase 2; ... [more]
gi|124015157|sp|Q3T1J2|MBOA2_RAT1.069740e-6131.63RecName: Full=Membrane-bound O-acyltransferase dom... [more]
gi|81873769|sp|Q8BH98|MBOA1_MOUSE3.677960e-5931.71RecName: Full=Lysophospholipid acyltransferase 1; ... [more]
back to top
BLAST of porcupine-like vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150390440.000000e+085.92dd_smedV4_413_0_1|m.25695|m.4576[more]
SMU150013301.776720e-10139.64Asxlregen_comp63653_c0_seq2|m.14305|m.9304[more]
SMU150283434.475570e-9840.27SmedSxldir_c96028_g2_i3|m.38137|m.41744[more]
SMU150142281.306470e-8835.28SmedAsxldir_c93263_g1_i1|m.32754|m.42353[more]
SMU150039245.386390e-1024.26SmedAsxldir_c103283_g3_i5|m.58037|m.44976[more]
back to top
BLAST of porcupine-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|40548387|ref|NP_620154.2|3.469280e-6234.09lysophospholipid acyltransferase 2 [Homo sapiens][more]
gi|767913127|ref|XP_011508611.1|6.775740e-5433.24PREDICTED: lysophospholipid acyltransferase 2 isof... [more]
gi|122937404|ref|NP_001073949.1|7.366830e-5431.97lysophospholipid acyltransferase 1 [Homo sapiens][more]
gi|578811432|ref|XP_006715062.1|7.357200e-4631.12PREDICTED: lysophospholipid acyltransferase 1 isof... [more]
gi|767913132|ref|XP_011508613.1|5.673470e-4531.58PREDICTED: lysophospholipid acyltransferase 2 isof... [more]
back to top
BLAST of porcupine-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|20129843|ref|NP_610546.1|2.194630e-7333.41oysgedart, isoform A [Drosophila melanogaster][more]
gi|665399947|ref|NP_001286265.1|2.194630e-7333.41oysgedart, isoform B [Drosophila melanogaster][more]
gi|665399951|ref|NP_001286267.1|2.194630e-7333.41oysgedart, isoform E [Drosophila melanogaster][more]
gi|665399949|ref|NP_001286266.1|7.160910e-6933.41oysgedart, isoform D [Drosophila melanogaster][more]
gi|24666648|ref|NP_524157.2|1.713000e-1420.00nessy, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_022473 ID=Ddo_022473|Name=porcupine-like|organism=Dugesia dorotocephala|type=mRNA|length=1860bp
GTTCTACTACGAAGATTTGATTCGATTAACAGAGATGTAATATTGATAAA
GTATTACAAGTTCATTGATTGAAAGAAAACCAATAGGAGTAGAGTGGTTC
GATGTCATGTGAACATGCATGCAACCAATGAAATTCGAATGACTCATTTT
TCAATATGTAATACCGTATTCACTAACAAGTTGATCACTTTTTGATTTTT
TTTGTTGAAGCAGCGATGTCAGAATTCTATGGCGGATCAACGATTCTTGC
CCCATTGACGAATATTGTCGGCATTCCGGTCGATCAAATCAATTTTATCG
TTTGTAGTTTATTGTCAATTGGTCTCGGACAATTGATGCGTCATAAATTT
CCGCCTCATAAATTATCAGGGAATACTCGAGGGTTAATTGAAACGTTTTT
TGGAATTTTAATCGTTCTATTTTGTTTCGGTTATCAGGTAAAATATTTGT
TACTCCAATCGACCGTCTCGTATGTATTATTAATGGTTTTCCCGTCAAGA
ATTGCAGCCCATCTTGTCACTTACTGGTGTTTAGGGTTCATGTCAGTCGT
TCATTTATACCGAATGCACTATGATTACGGTGGTTACACACTCGACATTT
CGGGACCGGTGATGATTCAAACACAGAAACTGACGAGTCTTGCATTTAAT
TTACTCGACGGACATCGATTAAACGAAGGACAAAAATTACAACAGAAAAA
CCACGAATCACACGCCGTTCGAAAACTCCCCGACGCCGTTAAGTTTTTCG
GTTATACGTTCTATTTCCACGGAATATTAGCCGGTCCGTTTGTGTTTTAT
AATGAGTACAAAGAATACATTGTTGGTTACGACAAGAAATGGATTCCATG
CGCCAAGAAACAATTGTCGGCGGCGTTATGTTTATCGGTGATTCACGGAG
TTCTGACGGCATATGTCGCCCCACAATTTCCATATATTTTCGTTTGTAGT
ACCGATTATCAACGAATGCATATGACCCGACGTATTATGTTTACGATGAT
TTCCTTTTTTCTAGTGAGACAGAAATACTATTTTGCCTGGTCGATTGTTG
AAGCCGGTGCGTTAAGTTCCGGTTTGGGATTCGGAGGAAAAAACGAGAAC
GGAGAAAATGATTGGTCTAAGGTGAAAAATTACGATTTTATGGCAATTGA
ACGCGGTAATAGCTTGAAAGTATTAGTCGACGGTTGGAACATTTCAACGA
CGAGATGGTTGAGAGAGTTGATTTACGAACGGGCTCCGTTGTTTTGTCGG
ACGATTTTAGTGTTTGCGACCAGTGCATTTTGGCATGGATTCTATCCTGG
TTATTATATGATGTTTTTAACGTTCTTTCTCTTTACGTTTTGCGCTCGGA
CCGTTCGGAAACATATTCGACCGTTGTTTTTAGTTAGCCCGATCAATCTT
CAGTTTTATCATTTTGTGACGATAATTTTTACGAATTTGGCTTTAAATTA
CGGTCAGGGGCCATTTTATTTACTGGAATTCCAATCCGGGCTTTTGTTTT
GGAAGCCTTATTACTTTTTTGGACATATTTTAGCGATGTTTTTTGTTCTT
ACTCTACGATTCAGGCCGATTATTAATGATAAAGTCAGCCAAATGAATGA
TATTCTGACGAAAAAAGCCCAATATCGATTAAAGAAAATAAAAAATCAAA
TACAACGAAAATTGGGTTGAAAAAATGTTCCTATTGTTTTTTTTTCGATT
ATAATAGAATTTATTTTCATGTACATACTATTGATTTTTCTGGTTGTTAC
ATGAAGAGATAATTTACTATAAGATTGAAGAAGAAACCTGAAGTAAAATT
CTTTGTTTTATTTTTCAATAAAATCTATTTTGTTAAAAAAAAATCAAATA
CAACGAAAAT

Design Primers for porcupine-like

back to top

protein sequence

>Ddo_022473-protein ID=Ddo_022473-protein|Name=porcupine-like|organism=Dugesia dorotocephala|type=polypeptide|length=485bp
MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKL
SGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHL
VTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKE
YIVGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNENGENDW
SKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
ATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINLQFYHF
VTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFR
PIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
back to top

coding sequence

>Ddo_022473.216.1670 ID=Ddo_022473.216.1670|Name=Ddo_022473.216.1670|organism=Dugesia dorotocephala|type=CDS|length=1455bp
ATGTCAGAATTCTATGGCGGATCAACGATTCTTGCCCCATTGACGAATAT
TGTCGGCATTCCGGTCGATCAAATCAATTTTATCGTTTGTAGTTTATTGT
CAATTGGTCTCGGACAATTGATGCGTCATAAATTTCCGCCTCATAAATTA
TCAGGGAATACTCGAGGGTTAATTGAAACGTTTTTTGGAATTTTAATCGT
TCTATTTTGTTTCGGTTATCAGGTAAAATATTTGTTACTCCAATCGACCG
TCTCGTATGTATTATTAATGGTTTTCCCGTCAAGAATTGCAGCCCATCTT
GTCACTTACTGGTGTTTAGGGTTCATGTCAGTCGTTCATTTATACCGAAT
GCACTATGATTACGGTGGTTACACACTCGACATTTCGGGACCGGTGATGA
TTCAAACACAGAAACTGACGAGTCTTGCATTTAATTTACTCGACGGACAT
CGATTAAACGAAGGACAAAAATTACAACAGAAAAACCACGAATCACACGC
CGTTCGAAAACTCCCCGACGCCGTTAAGTTTTTCGGTTATACGTTCTATT
TCCACGGAATATTAGCCGGTCCGTTTGTGTTTTATAATGAGTACAAAGAA
TACATTGTTGGTTACGACAAGAAATGGATTCCATGCGCCAAGAAACAATT
GTCGGCGGCGTTATGTTTATCGGTGATTCACGGAGTTCTGACGGCATATG
TCGCCCCACAATTTCCATATATTTTCGTTTGTAGTACCGATTATCAACGA
ATGCATATGACCCGACGTATTATGTTTACGATGATTTCCTTTTTTCTAGT
GAGACAGAAATACTATTTTGCCTGGTCGATTGTTGAAGCCGGTGCGTTAA
GTTCCGGTTTGGGATTCGGAGGAAAAAACGAGAACGGAGAAAATGATTGG
TCTAAGGTGAAAAATTACGATTTTATGGCAATTGAACGCGGTAATAGCTT
GAAAGTATTAGTCGACGGTTGGAACATTTCAACGACGAGATGGTTGAGAG
AGTTGATTTACGAACGGGCTCCGTTGTTTTGTCGGACGATTTTAGTGTTT
GCGACCAGTGCATTTTGGCATGGATTCTATCCTGGTTATTATATGATGTT
TTTAACGTTCTTTCTCTTTACGTTTTGCGCTCGGACCGTTCGGAAACATA
TTCGACCGTTGTTTTTAGTTAGCCCGATCAATCTTCAGTTTTATCATTTT
GTGACGATAATTTTTACGAATTTGGCTTTAAATTACGGTCAGGGGCCATT
TTATTTACTGGAATTCCAATCCGGGCTTTTGTTTTGGAAGCCTTATTACT
TTTTTGGACATATTTTAGCGATGTTTTTTGTTCTTACTCTACGATTCAGG
CCGATTATTAATGATAAAGTCAGCCAAATGAATGATATTCTGACGAAAAA
AGCCCAATATCGATTAAAGAAAATAAAAAATCAAATACAACGAAAATTGG
GTTGA
back to top
Gene Groups
porcupine-like is similar in sequence to the genes of this group: GG1535
Gene NameGene ID
SMU15039044SMU15039044
porcupine-likeDdo_022473
Ddo_027705Ddo_027705
porcupine-likeGsp_005554
Pgr_005179Pgr_005179
porcupine-likePgr_029656
Pmo_003187Pmo_003187
Pmo_015173Pmo_015173
Pmo_032921Pmo_032921

Gene Group Protein Sequences

>SMU15039044

MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKL
SGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHL
VTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RINQGIKLLQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKE
YITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
TVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHV
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR
PIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR*
>Ddo_022473 porcupine-like
MSEFYGGSTILAPLTNIVGIPVDQINFIVCSLLSIGLGQLMRHKFPPHKL
SGNTRGLIETFFGILIVLFCFGYQVKYLLLQSTVSYVLLMVFPSRIAAHL
VTYWCLGFMSVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFYNEYKE
YIVGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNENGENDW
SKVKNYDFMAIERGNSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
ATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINLQFYHF
VTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLRFR
PIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
>Ddo_027705 Ddo_027705
MGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRLNQG
IKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKEYIIGY
NDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR
RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSRVKN
YDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVFTVSAF
WHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHILTKIF
TNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHI
>Gsp_005554 porcupine-like
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQLMRYKFPPNKV
SGNIRGLIETFFGILIVLFCYGYQVKYLLLQSTVSYILLLLLPSKISAHL
VTYWCMGFMAVVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RLNQGIKLIQKNHESHAVKKLPDAIKFFGYTFYFHGILAGPFVFYNEYKE
YIIGYNDKHIPCAKKQLSAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SRVKNYDFMAIESGSSLKILVDGWNISTTRWLRELIYERAPLFCRTIMVF
TVSAFWHGFYPGYYMMFLTFSLFTFCARTVRKHIRPLFLVNPITLQLYHI
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFFVLTLQFR
PIINDKVNQMNFVFTKKAHYRLQKLKNHLQRKLG*
>Pgr_005179 Pgr_005179
MSKFYGGSRILSPLSDLFGIPVDQINFVVCSLVSILLGQIMRHVFPPKKT
SANVRGFIETGFGFLIVIFCYGGQIKYLFLQSMVAYVILMLLPPRIAAHL
VTYWSMGFLAVVHLYRMHFDYGGYTIDISGPVMIQTQKLTSLAFNLLDGY
RINKGIDLSQKYHEQHAVKKFPDALKYFSYLMYFHGIQVGPFMFYNEYKE
YLIGYGNKTIPCANKQIRAALCMSVIFGLLTAYVAPQFPYIFTCSVDYQR
MAMSRRIMFTMISFFLTRQKYYFAWTIVEVGSLSAGMGYGGKNENNENDW
SRVKNYNFMAIESGSSLKLITDGWNISTARWLRELVYERAPLFCRTLLVY
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFVANPVTLQLYHI
ITKIITNLSFNYGQAPFFLLEFQLGLVFWKPYYFFGHVIAISVILIFQVK
PIFNNRVGHVDVADLRKKGDHLISQAATVTKF*
>Pgr_029656 porcupine-like
MSQFYGGSTILAPLSEILGLPIDQINFVVCSLLSILLGQLMRHIFPPNKT
SANVRGFIETIFGFLIVIFCYGYQIKYLLLQSVVSYLMLIILPAGLAAHL
VTFWSLGFMGVVHMYRIHFDYGGYTMDISGPVMIQTQKLTSLAFNLLDGW
RLNHGYTLPQKKHETHAVKELPNAVNYFSYLMYFHGIQAGPFTFYNEYRE
YLTGYDIKAIPCAKKQIRAALCLSIIHGLLTAYVAPQFPYIFIYSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSISEAASLSAGLGYSGKTKNMENDW
SRIKNYDFMAIESGSCLKVIGDGWNMSTTRWLRELVYERSPLFCRTLLVF
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHV
ITKIITNLALNYGQAPFYLLEFQTALLFWKPYYFFGHVIAISIILMFQVR
PIINDKVGQINFNLTKKANLNFLLLKERLLLKLQ*
>Pmo_003187 Pmo_003187
MSQFYGGSTILSPLSDIVGLPVDQINFVICGLLSILLGQLMRHVFPPNKI
SSNVRGLIETFFGVLIVIFCYGYQIKYLLLQSMISYIILLIMPPRVAAHL
VTFWSLGFMGVVHLYRIHFDYGGYTMDISGPVMIQTQKLSSLAFNLLDGY
RLNQGNQLNNKKHEAHAVKRIPNLFSYMSYLIYFHGIQAGPFIFYNEYEE
YLGGYDNQAIPCAKKQIRAALCLSAIHGLLTAYVAPQFPYIFVCSTDYQR
MHMSRRIVFTMISFFLVRQKYYFAWSIAEAGSLSAGLGYGGKNENLENDW
SRVKNYDFMAIESGSSLKVVTDGWNMSTTRWLRELVYERSPLFCRTLLVF
TVSAFWHGFYPGYYLMFGTFAIFTFCARTARKFIRPMFMTNPVTFQLYHI
VTKILTNLSLNYGQAPFYLLEFQSALLFWKPYYFFAHVITISIILIFQFR
PIINDKVGQINFRITKKANLNFLNFKQCLKIKLR*
>Pmo_015173 Pmo_015173
LLDGHRLNEGQKLQQKNHESHAVRKLPDAVKFFGYTFYFHGILAGPFVFY
NEYKEYIIGYDKKWIPCAKKQLSAALCLSVIHGVLTAYVAPQFPYIFVCS
TDYQRMHMTRRIMFTMISFFLVRQKYYFAWSIVEAGALSSGLGFGGKNEN
GENDWSKVKNYDFKAIESGNSLKVLVDGWNISTTRWLRELIYERAPLFCR
TILVFATSAFWHGFYPGYYMMFLTFFLFTFCARTVRKHIRPLFLVSPINL
QFYHFVTIIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHILAMFLVL
TLRFRPIINDKVSQMNDILTKKAQYRLKKIKNQIQRKLG*
>Pmo_032921 Pmo_032921
MSNFYGGSTILNPLSNVLGIPVDQVNFVVCCLLSIVFGQMMRHLFPPRNT
SANVRGIIEASAGLLIVLFCYGNQVKYLLLQSMVAYVMLMVLPPRIAAHF
VTYWSMGFLAVVHLYRMHYDYGGYTIDISGPVMIQTQRLTCLAFNLLDGH
RINNGLPLSNERHKLHAVKKLPDAVKFFSYLMYFHGVQVGPFTFYSEYKE
YLIGYGNKSIPCAKQQIRSALCLSVIFGLLTAYVAPQFPYLFTCSIEYQR
MTMTRRIVFTMISFFLTRQKYYFAWSIVEVGSLSAGLGYGGKTENLENDW
SRIRNYDFKAIESGSCLKLITDGWNMSTARWLRELVYERSPLFCRTLLVY
ATSAFWHGFYPGYYLMFGTFAIFTFCARTVRKHVRPLFMTNPVTFQLYHI
ITKIITNLSFNYGQAPFFLLEFQLGLLFWKPYYFFGHVIAISAILIFQCR
PIFNDKSAQISPRSIKTTDFLKSQSIVTTKIH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.