beta-catenin, Ddo_020132 (mRNA) Dugesia dorotocephala

Overview
Namebeta-catenin
Unique NameDdo_020132
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length3339
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteBeta-catenin
Homology
BLAST of beta-catenin vs. uniprot
Match: gi|399056|sp|Q02453|ARM_MUSDO (RecName: Full=Armadillo segment polarity protein [Musca domestica])

HSP 1 Score: 467.233 bits (1201), Expect = 1.05459e-146
Identity = 304/792 (38.38%), Postives = 425/792 (53.66%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEK----SKRYASSHSYNVVPQNPNNLRNNLSISL 2501
WQQN YL+DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L S P S RL+ NCLWTLRNLSDAAT+++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH+++RH D+E AQ A+ GL +++K++ H P W LIKA IGL+RNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K KR + + N + + NN+ N + L
Sbjct: 25 WQQNSYLVDSGIHSGAVTQAPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLAEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAITNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-----------SNP--------------SPRLVQNCLWTLRNLSDAATKVDGLEPLLQSLVQVLAST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTTRHADSEMAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAAIGLVRNLALCPANAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTGSQQPAAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSIELTTNSLLREDNNIWGNADLGL 701
BLAST of beta-catenin vs. uniprot
Match: gi|221222436|sp|Q29I35|ARM_DROPS (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 466.077 bits (1198), Expect = 4.17922e-146
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. uniprot
Match: gi|114162|sp|P18824|ARM_DROME (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 465.307 bits (1196), Expect = 1.03161e-145
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. uniprot
Match: gi|461856|sp|P35224|CTNB_URECA (RecName: Full=Catenin beta; AltName: Full=Beta-catenin [Urechis caupo])

HSP 1 Score: 461.84 bits (1187), Expect = 1.10302e-144
Identity = 300/755 (39.74%), Postives = 421/755 (55.76%), Query Frame = 3
Query:  261 WQQNQYLIDSGINS-ALEXXXXXXXXXXGYDEMESEDQNKNSK---------------EWNYNASNNNVNDGLSNDI-CMLTPDTPGSSGCLRHGGE---GMADVNLSTCYDGKEENNRNPDFAI------DIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDKL----LEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQNQY+ DSGI S A SVSSKHG D+M++ + S+ + + N +N S + + P+T L G + D T E ++ A+ D A AIP+L KL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ AM E R AG ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QEG K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SY YEKLLWT +RVLKVLSVC++NKP I+ G ++ H SQRL+ NCLWTLRNLSDAAT+ + + LL++LVQ+L A+N D N++TCAAGILSNLTCNNQ NK+T ++GG+EA++RTI L + +DI EP +C LRH++SRH +AE AQ A+ GL +L+K++ H P W LIKA++GLIRNLA+ N P+RE G ++ L+ RA D + S + + +EEI+E + GALH++A++ RA I + + + + LL++ +++IQRVAAG+L E++A++ G E+ I Q T L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 41 WQQNQYMGDSGIQSGATTQAPPSVSSKHGLDDMDTGEGMDTSRMMFDFDQGFSTQAFTQEQVDEMNQQLNQTRSQRVRAAMFPET------LEEGVQIPSTQLDPGQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATRAIPELTKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHRQGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLLLQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLKVLSVCASNKPAIVEAGSAGPSMHL--------------------------GHQSQRLVQNCLWTLRNLSDAATKSSDIEGLLQMLVQLL--ASN---------DINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTI---------------LQAGDR--EDITEPAVCALRHLTSRHGEAEMAQNAVRLHYGLPVLVKLL-------------HPP-----------SRWPLIKAVVGLIRNLALCPANHAPLREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAYVDGVRMEEIVEGTVGALHIMAREAHNRAVIRGLN----------------CISLFAQLLYSPIDNIQRVAAGVLCELAADKEGAEM-IEQEGTTAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 693
BLAST of beta-catenin vs. uniprot
Match: gi|461855|sp|P35223|CTNB_TRIGR (RecName: Full=Catenin beta; AltName: Full=Beta-catenin [Tripneustes gratilla])

HSP 1 Score: 447.203 bits (1149), Expect = 4.91956e-139
Identity = 263/620 (42.42%), Postives = 365/620 (58.87%), Query Frame = 3
Query:  594 AESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
A AIP+L KL++D DD VV+N+A MMV QLSK +A AI+NS +M++ ++ AM+ + AE R AG ++N+S + GL IF++ IP L+KLL +ESVLFYAITTLHNLLL+QEG K AVR++G + KMVALL +NN KFL I TDCLQILA+ +Q SKL IL GGP L+HI+++YDYEKLLWT +RVLKVLSVC NKP I+ GGM AL L H S RL+ NCLWTLRNLSD + + LL++LVQ+L A+N D NV+TCA GILSNLTCNN NK+ ++ GVEA+++T+ + + ++I EP +C LRH++SRH AE Q + G+ +++K++ H P W LIKA +GLIRNLA+ S N P+RE+G ++ L+ RA D +++ S + +E+I+E + GALH+LA+D RA I + + + LL+N++E+IQRVAAG+L E+S E+ G E+ I Q T L E++HS NE ++TYA+A+L R +++K + Y
Sbjct: 165 ATRAIPELTKLLND-DDLVVVNQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMSNSNDAETTRCAAGTLHNLSHHRAGLLQIFKSGGIPALIKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLSRNNPKFLAITTDCLQILAYGNQESKLIILASGGPAALVHIMRTYDYEKLLWTTSRVLKVLSVCHNNKPAIVEAGGMSALGLHLG-------------------------HHSNRLVQNCLWTLRNLSDCHRGTDDIEPLLQMLVQLL--ASN---------DINVVTCACGILSNLTCNNSRNKMIVSQMAGVEALVQTL---------------MKAGDR--EEITEPAVCALRHVTSRHPGAEMGQNTVRLNYGIPVIVKLL-------------HPP-----------SRWPLIKATVGLIRNLALCSANHAPLREQGALHRLVQLLMRAHQDTQRRSSMGSTGSQGGNYADGVRMEDIVEGTTGALHILARDSHNRALIQGLN----------------CIPLFVQLLYNNIENIQRVAAGVLSELSLEKQGAEM-IEQEGATAPLTELLHSRNEGVATYAAAVLYRMSDDKPQDY 689
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15031548 (SmedSxlregen_c67076_g1_i1|m.10982|m.22691)

HSP 1 Score: 1653.65 bits (4281), Expect = 0
Identity = 844/953 (88.56%), Postives = 901/953 (94.54%), Query Frame = 3
Query:  180 MMNESMNIVNSPQXXXXXXXXXXXXRSWQQNQYLIDSGINSALEXXXXXXXXXXGYDEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGSSGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDKLLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRYASSHSYNVVPQNPNNLRNNLSISLPNNQNTNPGYLSSILNSPILHNQSPCISHRHNTVAQCGDQTV-SNEPICQLNDVEVPDYHMNYSNTLQPQNRYPYNSNYIDPNYSLINQPGNSDLTMRHFKQLGPINISNECVNQDVQKNFSNTXXXXXXXXXXXXXXXXXXXXXXXKKEIMDVCMLDTDWIETCSEFSQGHSQKSWSP 3035
MMNESMNIVNSP D+FI DKT FTR+WQQNQYLIDSGINSALESHSHSVSSKHGYD+M+SEDQ+KN EW Y SN N NDGLSNDICMLTPDTPGS+ CLRHGGEGMADV+LS CYD K+ENNRNPDF IDIDKIEAESAIPDLIKLI+DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ+GGKEAVR SGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTN+E YPQV+P EN+ESYPHFSQRLLHNCLWTLRNLSDAATRLNFD+LLKVLVQIL+NA NSFQRQ+ HIDTNVITCAAGILSNLTCNNQYNKITF+KLGGVEAILRTIEWNLALTNP N PNK QNNYFPDDIFEPCICTLRHISSRHE+AEAAQA+ILH QGL ILI+IIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAM CNFVPIRERGF WPMIVLINRAQIDLLNKN+C++ISPKDKLLEEIIEVSCGALHMLAKDPGIR+QI SMKIWQRLI+YPQQIGIQ AVYVI+SLLFNHLESIQRV AGLLVEVSAERLGLELII+Q+VITNKLNEMVHSNNEAISTYASAILIRATEEK+KRY + H+YN++PQNP+NLRNNLSISLP NQ N GYL+SILNSPI+HNQ PC+SHRHN+V QCGDQ + +NE +C +NDV+V DYHM +SNTLQPQNRYPYN N++DPNYSLINQ GNS++ MRHFKQ+G INISNECVNQDVQK +SN+SFKSPSSHSLS+SGNLCSS++NSKK++MDVCMLD DWIETCS+FSQGHSQKSWSP
Sbjct: 1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKY-PSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNP-NAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSP 951
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15006664 (SmedAsxldir_c108529_g1_i1|m.90628|m.5971)

HSP 1 Score: 165.236 bits (417), Expect = 4.98611e-42
Identity = 159/582 (27.32%), Postives = 280/582 (48.11%), Query Frame = 3
Query:  687 SKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFS--CNFVPIRERGFCWPMIVLINRAQIDLLN----KNACSSISPKDKLLEEI-----IEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAIL 2396
S + +D + K+++SC NK AE + ++ ++S+ + G I N IP L+ LL + ++ I+TL NL+ + ++ +R S I K+V + +N++K LT+ +CL L FN+ +K +L G ++ I++ Y YEKLL+ A+++LKVLSVC+ANKP+++ G M+AL ++L S RL+ + LW++RNLSD ++ + + LL+ L+++L + D + C+ G L NLT N NK+ F + GGV+A+ + I + +++ EP + LRH++ + A+ A I+ L L +I Q PD ++P LIKAI+GL+RNL+M S C I + G + + R + + +N+ S+S + +E + +E++ AL LAKD + +++ISY ++ +Q V ++ ++ + + R GLL E+ E I+ +L+E++HS N+AISTYA+ ++
Sbjct: 115 SDIEVVDGL--KKKIVSCK----NKNTKAECI----SSVQHISKGEQGATNIVNVNFIPILLDLLSSNDLKIVECVISTLDNLMYFVNQSRDIIRNSHGIEKLVEQMDRNDVKLLTVVLNCLHKLTFNNYEAKKTMLLSHGSEKVVQILRQYTYEKLLFAASKLLKVLSVCNANKPILVETGAMEALHSLLRSG-------------------------SPRLVLSSLWSIRNLSDYSSHIADMQKLLQKLIELLGSD-----------DEHTSICSMGCLCNLTSGNTENKLAFIEYGGVQAVCQLICERVG-----------------QEEVVEPGVAALRHVTHNNHLAQQAIDIIIQSPLLSNLSVLIRGQ--PD--------KMLP------------LIKAIVGLLRNLSMISPQCRRSLI-DLGITNSLCEIFYRTSKGISDLSQQRNSIVSVSSELSFIEGVRLDDLLELTLAALQALAKD----------NLAKKIISYENRL-LQSVVQMV--MIKENSVPLHRACLGLLAEM-VEYADCARILEGEGFNTRLSELIHSTNKAISTYAAIVM 596
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15040734 (dd_smedV4_9667_0_1|m.42039|m.41887)

HSP 1 Score: 68.9366 bits (167), Expect = 1.11581e-11
Identity = 97/403 (24.07%), Postives = 178/403 (44.17%), Query Frame = 3
Query:  774 EAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQK------NNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLI--HIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQK-NTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKII--EMQLGPDLFHM----QSHQPIMPNLF---LSYYKINWSLIKAIIGLIRNL 1928
+ + +++G + +S+ G +++ + N L+ +L +++V+FY+ITTLHN+LL V ++ CI ++ + K K L IC DCL L++++ K++I +H + +I +++ + EKLL ++LK+LS + K I L L+ + K N+N+ TLRNLSD + D KV +L F + + ++ CA GIL+N +C+ NK K +++IL+T+ + T KL + + E L H+ S HE + L+++ K + +M + H+ S N+ L+ I+WS+++A +GL+R+L
Sbjct: 156 QMLYWVSGCFHYISRTPFGCEMLLKNNS-DILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVKIQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFAILVLNLFKSKSKMNSNVWLVM----------------------FLTLRNLSDILFQPKSD-FWKVYHDVLYQICLRFDEISCLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTL-------SVTTDKFKL-----WSGETLEAMYRCLHHLCSNHE------------RSLYVINKCLMSDMNFLTNASHIIILNSSKDISFANILSQSLTDIPISWSILRAWLGLVRHL 510
BLAST of beta-catenin vs. RefSeq Human
Match: gi|4503131|ref|NP_001895.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 436.032 bits (1120), Expect = 8.34319e-136
Identity = 263/617 (42.63%), Postives = 357/617 (57.86%), Query Frame = 3
Query:  594 AESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPK---DKLLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
A AIP+L KL++DED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ L + +DI EP IC LRH++SRH++AE AQ A+ GL +++K L H SH W LIKA +GLIRNLA+ N P+RE+G ++ L+ RA D + + + +EEI+E GALH+LA+D R I + + + LL++ +E+IQRVAAG+L E++ ++ I T L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV---------------LRAGDR--EDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLN----------------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148227672|ref|NP_001091680.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 436.032 bits (1120), Expect = 8.34319e-136
Identity = 263/617 (42.63%), Postives = 357/617 (57.86%), Query Frame = 3
Query:  594 AESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPK---DKLLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
A AIP+L KL++DED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ L + +DI EP IC LRH++SRH++AE AQ A+ GL +++K L H SH W LIKA +GLIRNLA+ N P+RE+G ++ L+ RA D + + + +EEI+E GALH+LA+D R I + + + LL++ +E+IQRVAAG+L E++ ++ I T L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV---------------LRAGDR--EDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLN----------------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148233338|ref|NP_001091679.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 436.032 bits (1120), Expect = 8.34319e-136
Identity = 263/617 (42.63%), Postives = 357/617 (57.86%), Query Frame = 3
Query:  594 AESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPK---DKLLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
A AIP+L KL++DED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ L + +DI EP IC LRH++SRH++AE AQ A+ GL +++K L H SH W LIKA +GLIRNLA+ N P+RE+G ++ L+ RA D + + + +EEI+E GALH+LA+D R I + + + LL++ +E+IQRVAAG+L E++ ++ I T L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV---------------LRAGDR--EDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLN----------------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|530371928|ref|XP_005264943.1| (PREDICTED: catenin beta-1 isoform X1 [Homo sapiens])

HSP 1 Score: 436.032 bits (1120), Expect = 8.34319e-136
Identity = 263/617 (42.63%), Postives = 357/617 (57.86%), Query Frame = 3
Query:  594 AESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPK---DKLLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
A AIP+L KL++DED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ L + +DI EP IC LRH++SRH++AE AQ A+ GL +++K L H SH W LIKA +GLIRNLA+ N P+RE+G ++ L+ RA D + + + +EEI+E GALH+LA+D R I + + + LL++ +E+IQRVAAG+L E++ ++ I T L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV---------------LRAGDR--EDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLN----------------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670
BLAST of beta-catenin vs. RefSeq Human
Match: gi|578805674|ref|XP_006713046.1| (PREDICTED: catenin beta-1 isoform X2 [Homo sapiens])

HSP 1 Score: 435.647 bits (1119), Expect = 9.15066e-136
Identity = 263/617 (42.63%), Postives = 357/617 (57.86%), Query Frame = 3
Query:  594 AESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPK---DKLLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
A AIP+L KL++DED VV+N+A +MV QLSK +A AI+ S +M+S ++ M E R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR++G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL GGP L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L + D NV+TCAAGILSNLTCNN NK+ ++GG+EA++RT+ L + +DI EP IC LRH++SRH++AE AQ A+ GL +++K L H SH W LIKA +GLIRNLA+ N P+RE+G ++ L+ RA D + + + +EEI+E GALH+LA+D R I + + + LL++ +E+IQRVAAG+L E++ ++ I T L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 142 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV---------------LRAGDR--EDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLN----------------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 663
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45551205|ref|NP_726775.2| (armadillo, isoform C [Drosophila melanogaster])

HSP 1 Score: 466.077 bits (1198), Expect = 2.06701e-148
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------------------------GNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|17136376|ref|NP_476666.1| (armadillo, isoform A [Drosophila melanogaster])

HSP 1 Score: 465.307 bits (1196), Expect = 1.19084e-146
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|19549863|ref|NP_599100.1| (armadillo, isoform B [Drosophila melanogaster])

HSP 1 Score: 465.307 bits (1196), Expect = 1.19084e-146
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|24639204|ref|NP_476665.2| (armadillo, isoform D [Drosophila melanogaster])

HSP 1 Score: 465.307 bits (1196), Expect = 1.19084e-146
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45553932|ref|NP_996328.1| (armadillo, isoform E [Drosophila melanogaster])

HSP 1 Score: 465.307 bits (1196), Expect = 1.19084e-146
Identity = 298/764 (39.01%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGS-------SGCLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLISDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILSNLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPDDIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCWPMIVLINRAQIDLLNKNACSSISPKDK--------LLEEIIEVSCGALHMLAKDPGIRAQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEVSAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY 2429
WQQN YL DSGI+S +E G+ D+M + S+ + +G+ P P + S L+H A VNL D E R AIP+LIKL++DED VV+++A MMV QLSK +A AI+NS +M++ ++ A++ + E+ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR++G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL GGP L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+ GGM AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L + D NV+TCAAGILSNLTCNNQ NK T ++GGV+A++RTI N ++ ++I EP +C LRH++SRH D+E AQ A+ GL +++K++ H P W LIKA+IGLIRNLA+ N P+RE G ++ L+ RA D + + + + + +EEI+E + GALH+LA++ RA I Q + + LLFN +E+IQRVAAG+L E++A++ G E II Q T L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct: 35 WQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKH-----AVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLG-------------------------NMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI---------INAGDR--------EEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683
The following BLAST results are available for this feature:
BLAST of beta-catenin vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|399056|sp|Q02453|ARM_MUSDO1.054590e-14638.38RecName: Full=Armadillo segment polarity protein [... [more]
gi|221222436|sp|Q29I35|ARM_DROPS4.179220e-14639.01RecName: Full=Armadillo segment polarity protein[more]
gi|114162|sp|P18824|ARM_DROME1.031610e-14539.01RecName: Full=Armadillo segment polarity protein[more]
gi|461856|sp|P35224|CTNB_URECA1.103020e-14439.74RecName: Full=Catenin beta; AltName: Full=Beta-cat... [more]
gi|461855|sp|P35223|CTNB_TRIGR4.919560e-13942.42RecName: Full=Catenin beta; AltName: Full=Beta-cat... [more]
back to top
BLAST of beta-catenin vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 3
Match NameE-valueIdentityDescription
SMU150315480.000000e+088.56SmedSxlregen_c67076_g1_i1|m.10982|m.22691[more]
SMU150066644.986110e-4227.32SmedAsxldir_c108529_g1_i1|m.90628|m.5971[more]
SMU150407341.115810e-1124.07dd_smedV4_9667_0_1|m.42039|m.41887[more]
back to top
BLAST of beta-catenin vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|4503131|ref|NP_001895.1|8.343190e-13642.63catenin beta-1 [Homo sapiens][more]
gi|148227672|ref|NP_001091680.1|8.343190e-13642.63catenin beta-1 [Homo sapiens][more]
gi|148233338|ref|NP_001091679.1|8.343190e-13642.63catenin beta-1 [Homo sapiens][more]
gi|530371928|ref|XP_005264943.1|8.343190e-13642.63PREDICTED: catenin beta-1 isoform X1 [Homo sapiens... [more]
gi|578805674|ref|XP_006713046.1|9.150660e-13642.63PREDICTED: catenin beta-1 isoform X2 [Homo sapiens... [more]
back to top
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|45551205|ref|NP_726775.2|2.067010e-14839.01armadillo, isoform C [Drosophila melanogaster][more]
gi|17136376|ref|NP_476666.1|1.190840e-14639.01armadillo, isoform A [Drosophila melanogaster][more]
gi|19549863|ref|NP_599100.1|1.190840e-14639.01armadillo, isoform B [Drosophila melanogaster][more]
gi|24639204|ref|NP_476665.2|1.190840e-14639.01armadillo, isoform D [Drosophila melanogaster][more]
gi|45553932|ref|NP_996328.1|1.190840e-14639.01armadillo, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_020132 ID=Ddo_020132|Name=beta-catenin|organism=Dugesia dorotocephala|type=mRNA|length=3339bp
TTTTTTTTCTTCTTTCGATTATTCTAAATATTTATTTTTCAAATTTTCTT
TTTATTTAATTATCGTTAATTTCAATGAAATAATTTTTCAAAAACTAAAA
TAAACATTATTCAGTTGACTTTTTACTGAAAGTTAAGACTGTTTCTTTCT
TTTTTTTTCGTTGCTTAAATGAGACATAAATGATGAACGAAAGTATGAAT
ATTGTAAATTCTCCTCAAACAGATGATTTTATTATTGACAAAACTACGTT
TACTCGATCTTGGCAGCAAAATCAATATTTAATTGATTCTGGAATCAATT
CAGCTTTGGAAAGTCACAGTCACAGTGTCAGTAGTAAACATGGTTACGAT
GAAATGGAATCAGAAGATCAAAATAAAAATTCAAAAGAATGGAATTATAA
TGCATCAAACAATAACGTTAATGATGGATTGTCGAATGACATTTGCATGC
TGACTCCAGATACCCCAGGAAGTTCTGGATGTCTTAGACACGGGGGTGAA
GGTATGGCCGACGTCAACTTGTCGACTTGTTACGATGGTAAAGAAGAAAA
CAATAGAAATCCAGATTTTGCAATAGACATCGATAAAATTGAAGCTGAAA
GTGCCATACCTGATCTTATCAAACTGATTAGCGATGAAGACGATGCTGTA
GTTATAAACGAGGCTACAATGATGGTTTTTCAGTTGAGTAAAACTGATGC
AATTGATGCAATAATAAATTCAAAAGAAATGATATCATGCATGATTGAAG
CAATGAATAAAGCCGAACACGCAGAAGCAGTTAGATTTTTAGCTGGTGCT
ATTTATAATATGTCTCAAAAGAAAAACGGACTAAAAATTATTTTCGAAGC
CAATGTCATACCGTGTTTGGTTAAATTGTTGGGATTTTCAATGGAATCTG
TGTTATTTTATGCAATCACCACCTTACACAATTTACTATTATATCAAGAA
GGCGGCAAAGAAGCTGTGAGAATTAGTGGCTGCATTCCTAAAATGGTTGC
TCTTTTGCAGAAAAATAACATCAAGTTTTTGACGATTTGTACTGATTGTT
TACAAATTTTGGCTTTCAATCATCAGCCGAGTAAATTAGAGATTTTAAAA
CACGGTGGTCCTTTGCATTTAATTCATATTATTAAAAGTTATGATTATGA
AAAACTTTTATGGACGGCAACAAGAGTTCTGAAAGTTTTAAGTGTTTGTT
CAGCTAATAAGCCAGTTATTATACGGGAAGGGGGAATGGATGCATTGACC
AATATTTTGTATCATACAATACAAAAAAACACAAACATTGAATCCTATCC
ACAAGTTGTACCAAATGAAAACAATGAATCATATCCACACTTTAGCCAGA
GACTTTTGCACAACTGTTTATGGACACTTAGAAATTTATCGGATGCAGCT
ACTCGTCTAAATTTCGATAATTTACTTAAAGTTTTGGTTCAAATTTTAGT
GAATGCTGCTAATTCATTTCAAAGACAAGCTCCTCATATTGATACAAATG
TTATTACATGTGCAGCTGGAATTTTATCTAATTTAACTTGCAACAATCAA
TATAATAAAATAACTTTTTATAAACTTGGTGGAGTGGAAGCTATTTTAAG
AACTATCGAATGGAATTTAGCATTGACAAATCCAACTAATGTTCCGAACA
AATTAACCCAAAACAATTATTTTCCTGATGACATTTTTGAGCCATGTATA
TGTACTTTAAGACATATTTCCAGTCGCCATGAAGATGCTGAGGCTGCCCA
AGCTGCAATATTACATTGTCAAGGATTACATATTCTCATCAAGATCATAG
AAATGCAACTCGGTCCGGATCTTTTTCATATGCAATCTCATCAACCAATT
ATGCCTAATCTATTTCTTTCGTACTATAAAATAAATTGGAGTCTCATAAA
AGCAATTATCGGCCTTATAAGAAATCTTGCAATGTTTTCATGCAATTTCG
TACCTATACGAGAACGAGGTTTTTGTTGGCCAATGATCGTTTTAATTAAT
CGAGCTCAAATTGATTTATTGAATAAAAATGCATGTTCTTCTATTTCGCC
GAAAGATAAATTGCTAGAAGAAATCATTGAAGTGTCTTGTGGAGCATTAC
ATATGCTTGCTAAAGATCCTGGTATTCGAGCACAAATAACGTCTATGAAG
ATATGGCAAAGGTTAATCAGTTATCCACAACAAATTGGTATTCAACCAGC
TGTATATGTAATTTCCAGCCTTTTGTTTAACCATTTAGAATCAATTCAAA
GAGTAGCAGCTGGTCTTTTGGTTGAAGTTTCAGCTGAGCGTTTAGGATTA
GAACTAATTATTAACCAATTGGTGATTACCAATAAACTTAATGAAATGGT
TCATTCTAATAATGAAGCAATATCAACATACGCTTCCGCTATTCTAATTA
GAGCAACTGAAGAGAAAAGTAAAAGATATGCTTCATCTCACAGCTATAAT
GTCGTTCCACAAAATCCAAACAATTTGAGAAATAATCTTTCGATTTCTTT
ACCGAATAATCAAAATACCAACCCTGGTTATTTGAGCTCTATATTAAATT
CTCCGATTTTACACAATCAGTCGCCATGTATAAGTCACAGACATAATACT
GTAGCACAATGTGGAGATCAAACTGTTTCAAATGAACCAATATGCCAGTT
AAATGATGTAGAAGTACCTGATTATCATATGAATTATTCTAATACTCTTC
AACCACAAAATCGATATCCATATAATTCTAACTACATTGATCCAAATTAC
AGTCTAATCAATCAACCGGGAAATTCAGATTTAACAATGAGACATTTTAA
GCAACTCGGTCCAATCAATATTTCGAATGAATGTGTTAATCAAGACGTTC
AAAAGAACTTTTCGAACACAAGTTTTAAAAGTCCCTCATCTCATTCTTTA
TCTCTTAGTGGTAACTTATGCTCGTCTAGTGACAATTCTAAGAAGGAAAT
AATGGACGTGTGCATGTTAGACACAGATTGGATAGAGACGTGTTCTGAGT
TTTCGCAAGGACATTCGCAAAAATCCTGGTCTCCGATTAATAAATGAATA
AAATTATTAATTGAAATTAATTTTTGTTGATTAGTTTGTTTTCGTTATTA
TTTCGTAATTAAATATGTGATTTCGAATTCAATGCAAAGCATCTTGGTAT
TAAAAATGTCTATTATGCATGTTTGTACTTTTTATTAGACTAGTTTTGTA
CATGATAATAAATATTTCTTTAAGTACGCGTGTCTCGTTGTGCCTTGACA
TTGGTTTTCGATATTTTATTATTATACAATTTTGTATTAAAGCAGATTAT
ATGTAATTTCGATTTCGGAAGTATGTTTAAATATTGCTT

Design Primers for beta-catenin

back to top

protein sequence

>Ddo_020132-protein ID=Ddo_020132-protein|Name=beta-catenin|organism=Dugesia dorotocephala|type=polypeptide|length=956bp
MMNESMNIVNSPQTDDFIIDKTTFTRSWQQNQYLIDSGINSALESHSHSV
SSKHGYDEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGSSG
CLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLI
SDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEA
VRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLH
NLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQP
SKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIRE
GGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTL
RNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILS
NLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPD
DIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFH
MQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCW
PMIVLINRAQIDLLNKNACSSISPKDKLLEEIIEVSCGALHMLAKDPGIR
AQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEV
SAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY
ASSHSYNVVPQNPNNLRNNLSISLPNNQNTNPGYLSSILNSPILHNQSPC
ISHRHNTVAQCGDQTVSNEPICQLNDVEVPDYHMNYSNTLQPQNRYPYNS
NYIDPNYSLINQPGNSDLTMRHFKQLGPINISNECVNQDVQKNFSNTSFK
SPSSHSLSLSGNLCSSSDNSKKEIMDVCMLDTDWIETCSEFSQGHSQKSW
SPINK*
back to top

coding sequence

>Ddo_020132.180.3047 ID=Ddo_020132.180.3047|Name=Ddo_020132.180.3047|organism=Dugesia dorotocephala|type=CDS|length=2868bp
ATGATGAACGAAAGTATGAATATTGTAAATTCTCCTCAAACAGATGATTT
TATTATTGACAAAACTACGTTTACTCGATCTTGGCAGCAAAATCAATATT
TAATTGATTCTGGAATCAATTCAGCTTTGGAAAGTCACAGTCACAGTGTC
AGTAGTAAACATGGTTACGATGAAATGGAATCAGAAGATCAAAATAAAAA
TTCAAAAGAATGGAATTATAATGCATCAAACAATAACGTTAATGATGGAT
TGTCGAATGACATTTGCATGCTGACTCCAGATACCCCAGGAAGTTCTGGA
TGTCTTAGACACGGGGGTGAAGGTATGGCCGACGTCAACTTGTCGACTTG
TTACGATGGTAAAGAAGAAAACAATAGAAATCCAGATTTTGCAATAGACA
TCGATAAAATTGAAGCTGAAAGTGCCATACCTGATCTTATCAAACTGATT
AGCGATGAAGACGATGCTGTAGTTATAAACGAGGCTACAATGATGGTTTT
TCAGTTGAGTAAAACTGATGCAATTGATGCAATAATAAATTCAAAAGAAA
TGATATCATGCATGATTGAAGCAATGAATAAAGCCGAACACGCAGAAGCA
GTTAGATTTTTAGCTGGTGCTATTTATAATATGTCTCAAAAGAAAAACGG
ACTAAAAATTATTTTCGAAGCCAATGTCATACCGTGTTTGGTTAAATTGT
TGGGATTTTCAATGGAATCTGTGTTATTTTATGCAATCACCACCTTACAC
AATTTACTATTATATCAAGAAGGCGGCAAAGAAGCTGTGAGAATTAGTGG
CTGCATTCCTAAAATGGTTGCTCTTTTGCAGAAAAATAACATCAAGTTTT
TGACGATTTGTACTGATTGTTTACAAATTTTGGCTTTCAATCATCAGCCG
AGTAAATTAGAGATTTTAAAACACGGTGGTCCTTTGCATTTAATTCATAT
TATTAAAAGTTATGATTATGAAAAACTTTTATGGACGGCAACAAGAGTTC
TGAAAGTTTTAAGTGTTTGTTCAGCTAATAAGCCAGTTATTATACGGGAA
GGGGGAATGGATGCATTGACCAATATTTTGTATCATACAATACAAAAAAA
CACAAACATTGAATCCTATCCACAAGTTGTACCAAATGAAAACAATGAAT
CATATCCACACTTTAGCCAGAGACTTTTGCACAACTGTTTATGGACACTT
AGAAATTTATCGGATGCAGCTACTCGTCTAAATTTCGATAATTTACTTAA
AGTTTTGGTTCAAATTTTAGTGAATGCTGCTAATTCATTTCAAAGACAAG
CTCCTCATATTGATACAAATGTTATTACATGTGCAGCTGGAATTTTATCT
AATTTAACTTGCAACAATCAATATAATAAAATAACTTTTTATAAACTTGG
TGGAGTGGAAGCTATTTTAAGAACTATCGAATGGAATTTAGCATTGACAA
ATCCAACTAATGTTCCGAACAAATTAACCCAAAACAATTATTTTCCTGAT
GACATTTTTGAGCCATGTATATGTACTTTAAGACATATTTCCAGTCGCCA
TGAAGATGCTGAGGCTGCCCAAGCTGCAATATTACATTGTCAAGGATTAC
ATATTCTCATCAAGATCATAGAAATGCAACTCGGTCCGGATCTTTTTCAT
ATGCAATCTCATCAACCAATTATGCCTAATCTATTTCTTTCGTACTATAA
AATAAATTGGAGTCTCATAAAAGCAATTATCGGCCTTATAAGAAATCTTG
CAATGTTTTCATGCAATTTCGTACCTATACGAGAACGAGGTTTTTGTTGG
CCAATGATCGTTTTAATTAATCGAGCTCAAATTGATTTATTGAATAAAAA
TGCATGTTCTTCTATTTCGCCGAAAGATAAATTGCTAGAAGAAATCATTG
AAGTGTCTTGTGGAGCATTACATATGCTTGCTAAAGATCCTGGTATTCGA
GCACAAATAACGTCTATGAAGATATGGCAAAGGTTAATCAGTTATCCACA
ACAAATTGGTATTCAACCAGCTGTATATGTAATTTCCAGCCTTTTGTTTA
ACCATTTAGAATCAATTCAAAGAGTAGCAGCTGGTCTTTTGGTTGAAGTT
TCAGCTGAGCGTTTAGGATTAGAACTAATTATTAACCAATTGGTGATTAC
CAATAAACTTAATGAAATGGTTCATTCTAATAATGAAGCAATATCAACAT
ACGCTTCCGCTATTCTAATTAGAGCAACTGAAGAGAAAAGTAAAAGATAT
GCTTCATCTCACAGCTATAATGTCGTTCCACAAAATCCAAACAATTTGAG
AAATAATCTTTCGATTTCTTTACCGAATAATCAAAATACCAACCCTGGTT
ATTTGAGCTCTATATTAAATTCTCCGATTTTACACAATCAGTCGCCATGT
ATAAGTCACAGACATAATACTGTAGCACAATGTGGAGATCAAACTGTTTC
AAATGAACCAATATGCCAGTTAAATGATGTAGAAGTACCTGATTATCATA
TGAATTATTCTAATACTCTTCAACCACAAAATCGATATCCATATAATTCT
AACTACATTGATCCAAATTACAGTCTAATCAATCAACCGGGAAATTCAGA
TTTAACAATGAGACATTTTAAGCAACTCGGTCCAATCAATATTTCGAATG
AATGTGTTAATCAAGACGTTCAAAAGAACTTTTCGAACACAAGTTTTAAA
AGTCCCTCATCTCATTCTTTATCTCTTAGTGGTAACTTATGCTCGTCTAG
TGACAATTCTAAGAAGGAAATAATGGACGTGTGCATGTTAGACACAGATT
GGATAGAGACGTGTTCTGAGTTTTCGCAAGGACATTCGCAAAAATCCTGG
TCTCCGATTAATAAATGA
back to top
Gene Groups
beta-catenin is similar in sequence to the genes of this group: GG5233
Gene NameGene ID
SMU15031548SMU15031548
beta-cateninDdo_020132
beta-cateninGsp_006976
Pgr_020799Pgr_020799
beta-cateninPgr_027642
beta-cateninPmo_016711

Gene Group Protein Sequences

>SMU15031548

MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSV
SSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSC
LRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPM
IVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSA
ERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVA
PHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVS
HRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPN
FVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKS
PSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWS
PINK*
>Ddo_020132 beta-catenin
MMNESMNIVNSPQTDDFIIDKTTFTRSWQQNQYLIDSGINSALESHSHSV
SSKHGYDEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGSSG
CLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLI
SDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEA
VRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLH
NLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQP
SKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIRE
GGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTL
RNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILS
NLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPD
DIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFH
MQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCW
PMIVLINRAQIDLLNKNACSSISPKDKLLEEIIEVSCGALHMLAKDPGIR
AQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEV
SAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY
ASSHSYNVVPQNPNNLRNNLSISLPNNQNTNPGYLSSILNSPILHNQSPC
ISHRHNTVAQCGDQTVSNEPICQLNDVEVPDYHMNYSNTLQPQNRYPYNS
NYIDPNYSLINQPGNSDLTMRHFKQLGPINISNECVNQDVQKNFSNTSFK
SPSSHSLSLSGNLCSSSDNSKKEIMDVCMLDTDWIETCSEFSQGHSQKSW
SPINK*
>Gsp_006976 beta-catenin
MMNESMNIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSAIESHSHSV
SSKHGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSC
LRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNVPNKINQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPM
IVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSA
ERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYTA
SHNYNVPQNPNNLRNNLSISLPANQVSNPGYLNSILNSPIMHNQPSCVGH
RHNSVTQCGDQNISTNETCQINDVDVSDYHMTFSNTLQPQNRYSYASNYL
DPNYSLLNQTVNPEISMRQHFKQLGPINISNECINQDIQKTFTNPSFKNP
TSHQMPLTGNLCPSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSP
INK*
>Pgr_020799 Pgr_020799
MSEQMSAMNSPLSEDLINDKTMLTRAWQQNQYLVDSGINSAFETQTHSVS
SRNCCDEMESEDHNKTDWKCLSNINVHDNFLNDVCMLTPDSSSSNLCGRQ
RVDSVSETYSTLNCHITKSGFEKKISLEIDKNEAESAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSQEMISCIIGAMNKADHAETIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLY
QEGGKEAVRLNGCIPKLVTHLQKNNIKFLTICTDCLQILAFNHQPSKIEI
LNNGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHSVQRNSTSSSCQVEVSYEFDESHPQFSQRLLHNCLWTLRNLSD
AATRINFDDLLKILVQILMGSYNSFQKQNMHIDTNAVTCAAGILSNLTCN
NPFNKMALFKVGGVEALIRVIEWNYASLANPYHQNKMNANSNFSEDILEP
CICALRHLTSRHEEAESVQASLIQYQGLSILLRIIEMQLGPDLFHMQPNQ
AVMSNLFISYYEINWNLIKAIIGLIRNMGMSQCNFGFIREKGFVWPMVVL
INRAHIDSVNKNVSSSGTSKDKLLDEIIEVACGALHLLAKDPGIRTQIIS
IKLWQRFINCPQQVGIQSGIYVIASLLYSHLESIQRVAVGLLVELSADRM
ALEMIMSHMVINNKLNEMVHSKSEAVSTYVSAILIRFSEEKNKRYAQIHN
YNVALPNSSNTRTNLAVPLTNNPPNNSTGFLNSILHSPILHNQSTCIGHR
RMPSQCEDQNYINNELLVQINDMDVADIHMNLMSPEDNNRYSYNPNYADI
TCNVVNQPSSVDMRYFKQLSSICPGNENHIRDAVVPYSNATKGRLNNQNV
SNTMNIITTITDNSKMKVSMDMNMYDVDWGETCSEFSHTNSH*
>Pgr_027642 beta-catenin
MNEQMNIVNSPLSDDINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSS
RHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQG
GEAMADVNLTSGYDANKSECDKEFGLDIDKLEAESAIPDLIKLIKDEDDA
VVINGATRMVFQLSKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAG
TIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ
EGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEIL
KNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEAL
TNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDA
ATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNN
QYNKIALFKLGGVEALIRVIEWNFASLNNPNPPNKINSNNTFSEDILEPC
ICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQP
VTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLIN
RAQIDATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIK
LWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMAL
EMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRYTPCHNYN
APLQNSACSRPNLSIALSNNQSHNSPGFLNSILHSPVMHNQPPCVSHRHI
PSQCGDQNYINSELLGQIGDMDVSDMQMNYGPPMTPQTRYPYNPGYMDSG
GGCPSSGSSSGIQADMRYFKQTGDCHLQDTQKGGPYASKSKGKDSMDLCM
AEGPDWPDSGSDFSQAHSHKP*
>Pmo_016711 beta-catenin
MNEQMNIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVS
SRHGYDEMDSEDHNKKDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQ
GGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSNEMISCIIEAMNKAEHADAIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLY
QEGGKEAVRSSSCIPKLVTLLLKNNTKFLTICTDCLQILAFNHQPSKIEI
LKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSD
AATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCN
NQFNKIALFKLGGVEALIKVIEWNFASLNNPNAQNKNNSNNAFSEDILEP
CICALRHLTSRHEEAEAVQTALVQLQGLSLLIRLLEMQLGQDLYYMQTQQ
PVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLI
NRAQIDVANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIIS
IKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERM
ALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEKK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.