pc2, Ddo_018155 (mRNA) Dugesia dorotocephala

Overview
Namepc2
Unique NameDdo_018155
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length2506
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NotePC2
Homology
BLAST of pc2 vs. uniprot
Match: gi|128003|sp|P21661|NEC2_MOUSE (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 689.878 bits (1779), Expect = 0
Identity = 376/628 (59.87%), Postives = 446/628 (71.02%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRF 2222
+ TN + V LH G+EE A +VA E GF V R G + F H L +A S H + L P++K A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + T+AC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +GL EW L+LHGTQ+ PY + + KL + K+Q +
Sbjct: 28 VFTNHFLVELHKDGEEE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEEL 622
BLAST of pc2 vs. uniprot
Match: gi|128004|sp|P28841|NEC2_RAT (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 689.108 bits (1777), Expect = 0
Identity = 375/628 (59.71%), Postives = 446/628 (71.02%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRF 2222
+ TN + V LH G+EE A +VA E GF V R G + F H L +A S H + L P++K A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + T+AC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +GL EW L+LHGTQ+ PY + + KL + K+Q +
Sbjct: 28 VFTNHFLVELHKDGEEE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEEL 622
BLAST of pc2 vs. uniprot
Match: gi|75061998|sp|Q5REC2|NEC2_PONAB (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 687.952 bits (1774), Expect = 0
Identity = 373/602 (61.96%), Postives = 437/602 (72.59%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPY 2144
+ TN + V LH G++E A +VA E GF V R G + F H L +A S H + L P+VK A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + TDAC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 29 VFTNHFLVELHKGGEDE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. uniprot
Match: gi|13124785|sp|P16519|NEC2_HUMAN (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 686.797 bits (1771), Expect = 0
Identity = 373/602 (61.96%), Postives = 436/602 (72.43%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPY 2144
+ TN + V LH G E+ A +VA E GF V R G + F H L +A S H + L P+VK A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + TDAC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 29 VFTNHFLVELHK-GGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. uniprot
Match: gi|417351|sp|Q03333|NEC2_PIG (RecName: Full=Neuroendocrine convertase 2; Short=NEC 2; AltName: Full=KEX2-like endoprotease 2; AltName: Full=Prohormone convertase 2; AltName: Full=Proprotein convertase 2; Short=PC2; Flags: Precursor)

HSP 1 Score: 686.411 bits (1770), Expect = 0
Identity = 373/602 (61.96%), Postives = 435/602 (72.26%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPY 2144
+ TN + V LH G+EE A +VA E GF V R G + F H L +A S H + L P+VK A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + TDAC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G EW L+LHG+Q+ PY
Sbjct: 29 VFTNHFLVELHKGGEEE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGAVKEWTLMLHGSQSAPY 599
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15019018 (SmedSxldir_c108536_g2_i2|m.79117|m.1373)

HSP 1 Score: 1166.37 bits (3016), Expect = 0
Identity = 588/650 (90.46%), Postives = 616/650 (94.77%), Query Frame = 3
Query:  285 MMFLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIK-NMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRFMQ* 2231
M WIL L Y++ GKIVTNQWHV LH P +E ANKVAQETGFSVLR HL +P EFVF HK +P S++PSW+ HK+LLAH VKNAKQVEGFLR+KRGYKPIKKQ R+PLPTINKKGIPG +DNIK ++ LPTDPLFSKEWYIRNTGQA+GVKDLDLNVLSAW+QGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEAN IGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAK+WVNVPERFHCIAGQIDKRYRFNV++ALILEIDTDACKSD GHRVNYLEHVQAFVSVK++RRGDITMFLTSPMGTTSMILSHRPKDDDS+RGFTKWPFMTTHTWGENPRGKW+LTVMF+TK+PLSQG+F+EWVLVLHGTQ+RPYDKLSSSLEKIIPKLGVVKRQHAS RF Q*
Sbjct: 1 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ* 650
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15036165 (SmedSxlregen_c89995_g1_i1|m.42695|m.12874)

HSP 1 Score: 381.333 bits (978), Expect = 3.82854e-120
Identity = 243/618 (39.32%), Postives = 345/618 (55.83%), Query Frame = 3
Query:  345 TNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRY-----TDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDA-GVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHC--IAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSSSLEK 2171
T+ W V ++ D+ A +A GF L + P + F H+ + + S PS + L P+V +Q +R KR ++ DP + K WY+ K+ +N++SAW +G G+ V +I+DDGI+ HPDL +NY+ +SYD SND P PRY T N HGTRCAG+++A +N ICGVGVAY + I G+RMLD ++D +E+ ++ +IDIYSASWGP DDG+TVDGP A +G+ KGR G GSI+VWAS G D+CNCDGY S++T+ +N+ + G+ Y E CSSTLA T+S+G S+D + T D+ +CT HSGTSA+AP AAG+ ALAL AN + WRDMQHL V+T++ R +W+ N AG E++H FG+G++DAG MV +A W VPE+ C +A +L I TDAC +S RV YLEHVQA +S+++T+RG++ ++L SP +TS +L+ R ++D +S GF WPFM+ H WGE G W+LT+ E W L+L+GT P + +S+ K
Sbjct: 27 TDTWAVQINGTVDD--ARILAATYGFVFLNEIM--PSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKR---------------------------------HIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGE-VSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSG----SMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITAR----KANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKR-RNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV----TLINWSLILYGTDTLPSHRQNSTHTK 588
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15033125 (SmedSxlregen_c82367_g1_i3|m.22377|m.8734)

HSP 1 Score: 345.895 bits (886), Expect = 6.88595e-102
Identity = 229/639 (35.84%), Postives = 347/639 (54.30%), Query Frame = 3
Query:  300 ILTTLQIYLINGKIVTNQWHVS-----------LHHPGDEEVANKVAQETGFSVLRGHLKTPGEF-VFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFS--SNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRG---FTKWPFMTTHTWGENPRGKWRLTV-MFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSS 2159
I ++ ++I I+ NQ+H + + PG A VA + GF +L+ ++ +F VF ++ ++ S H L +V A+Q R KR + IK Q + +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVG+AY+S+I +RMLD +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP A +G+ GR G G+IYVWASG+GG D AS S+ ++ Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AAG+ AL +EAN + WRD+Q++ VLTS N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K+ + L + TD C ++VNY+EHV ++ + +RGD+ + L SP GT S IL +RP D +RG F WP M+ WGE G+W + + + TK S G+++ + L ++GT+ P +S+
Sbjct: 3 IRCIVKYFII---ILLNQFHFTFATKEHINEYVIQCPGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYR---YDNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIK-QIKF-------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15002657 (Asxlregen_comp67843_c0_seq3|m.34885|m.51170)

HSP 1 Score: 345.51 bits (885), Expect = 8.74521e-102
Identity = 229/639 (35.84%), Postives = 347/639 (54.30%), Query Frame = 3
Query:  300 ILTTLQIYLINGKIVTNQWHVS-----------LHHPGDEEVANKVAQETGFSVLRGHLKTPGEF-VFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFS--SNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRG---FTKWPFMTTHTWGENPRGKWRLTV-MFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSS 2159
I ++ ++I I+ NQ+H + + PG A VA + GF +L+ ++ +F VF ++ ++ S H L +V A+Q R KR + IK Q + +DPLF K+WY+ + K +D+NV AW G TGKGVT +I+DDGIDY H DL +NY+ E+S+D + NDP P + T+ N HGTRCAGE+SA+ +N CGVG+AY+S+I +RMLD +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP A +G+ GR G G+IYVWASG+GG D AS S+ ++ Y ESC+STLAST+S+G + + + + DL +C H+GTSA+AP AAG+ AL +EAN + WRD+Q++ VLTS N+ +NGA + ++L+G+G++D+G +VR+ + W +P C K+ + L + TD C ++VNY+EHV ++ + +RGD+ + L SP GT S IL +RP D +RG F WP M+ WGE G+W + + + TK S G+++ + L ++GT+ P +S+
Sbjct: 3 IRCIVKYFII---ILLNQFHFTFATKEHINEYVIQCPGGYSEAKTVAVQMGF-ILKHKMRGFDDFYVFKYR---YDNSENSKFHLHRLKRSVKVNWAEQQYKLTRVKRDFMKIK-QIKF-------------------------SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 591
BLAST of pc2 vs. Smed Unigenes AA
Match: SMU15000885 (Asxlregen_comp60502_c0_seq1|m.9253|m.45850)

HSP 1 Score: 315.464 bits (807), Expect = 1.82109e-95
Identity = 224/647 (34.62%), Postives = 334/647 (51.62%), Query Frame = 3
Query:  270 HYYLSMM----FLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVL------------RGHLKTPGEFVFSHKA----LPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFS-NGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQ-GLFTEWVLVLHGTQNRP 2141
H++L+ M L L ++L+ + QW ++ E A ++A + GF L R G F S K+ L + S I H +IL H Q +++K + + + IK+ + R K + + DP + EWY+ ++ K D+ V W ITG+GV AI+DDG+++ HPDL NY+ SS D + ND P P T N HGTRCA EI+ +N ICGVG+AY+ KI G+RMLD P + +IEA ++ ++ ++IDIYS+SWGP DDG+T++ P + G GR GKG+I+VWAS G D C+CDGY +S++ IS+NS T+D + + E C ST+ +T+S + ++ +SL A D+ G+CT HSGTSA+AP A+G+FAL LE NP + WRD++HL TS+ + W N AG N FG+G+L+A MV+ A+ W NVP C + N A I+ + CK +V ++E + +++ RG + + L SP G + +L+ R D S G WPF + H WGENP GKW + V + + + G T+ L +GT+ P
Sbjct: 9 HWFLNKMNDVQVFRNLLILCVFLVLTQ-AEYQWEWAVKIEDGETAAKEIADDFGFEYLGIIGNLDNMFHFRKESSKNGRFKRSVKSATRNLSKHSKISLVIHQRIL--HRQKRDSKITDHMIH----HNIIKR-------------LQHRR-----KVLEMFNDPKWPDEWYLFDSRFNSDQKSYDMRVTPVWYMNITGRGVKVAILDDGLEHTHPDLIDNYDPFSSTDLNDNDDDPSPDLTPGTSNEHGTRCASEIAMSANNKICGVGIAYNCKIGGIRMLDGP-VNGIIEAKSLGFNNNHIDIYSSSWGPLDDGKTMEQPSKLVQEVLRRGALSGRNGKGNIFVWASGNGGLYQDSCSCDGYVSSLYVISVNSITDDNKFPYFAEKCPSTMCATYSASSESKYSLIAA----DVKGKCTKKHSGTSASAPYASGIFALVLEMNPNLTWRDIKHLIAWTSE---YNWIKNNLGWKKNAAGFWVNEKFGFGLLNAYKMVKKAQNWKNVPPMTTCRVKVKSSKKISNKLPATIIAYG-NHCK----EKVAFIESIIILMNITYEVRGALLIKLQSPYGMNTTLLTTR-NLDKSKDGIINWPFHSVHNWGENPTGKWVVYVEDKINDDEDRSGEVTDCTLEFYGTKTTP 616
BLAST of pc2 vs. RefSeq Human
Match: gi|320118926|ref|NP_001188457.1| (neuroendocrine convertase 2 isoform 3 [Homo sapiens])

HSP 1 Score: 687.182 bits (1772), Expect = 0
Identity = 373/602 (61.96%), Postives = 436/602 (72.43%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPY 2144
+ TN + V LH G E+ A +VA E GF V R G + F H L +A S H + L P+VK A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + TDAC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 10 VFTNHFLVELHK-GGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 580
BLAST of pc2 vs. RefSeq Human
Match: gi|20336244|ref|NP_002585.2| (neuroendocrine convertase 2 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 686.797 bits (1771), Expect = 0
Identity = 373/602 (61.96%), Postives = 436/602 (72.43%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPY 2144
+ TN + V LH G E+ A +VA E GF V R G + F H L +A S H + L P+VK A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + TDAC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 29 VFTNHFLVELHK-GGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599
BLAST of pc2 vs. RefSeq Human
Match: gi|320118928|ref|NP_001188458.1| (neuroendocrine convertase 2 isoform 2 preproprotein [Homo sapiens])

HSP 1 Score: 663.685 bits (1711), Expect = 0
Identity = 363/602 (60.30%), Postives = 423/602 (70.27%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPY 2144
+ TN + V LH G E+ A +VA E GF V + VK A Q EGF RKKRGY+ IN+ I NMN DPLF+K+WY+ NTGQA+G LDLNV AW G TGKGVT IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+ IDIYSASWGPTD+G+TVDGPR T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+ + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN + WRDMQHLTVLTSK D H W NG GLEFNHLFGYGVLDAG MV++AK W VPERFHC+ G + + + L+L + TDAC+ V YLEHVQA ++V ATRRGD+ + +TSPMGT S++LS RP+DDDS GF KWPFMTTHTWGE+ RG W L + F P +G+ EW L+LHGTQ+ PY
Sbjct: 29 VFTNHFLVELHK-GGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYR-----------DINEIDI----------NMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 564
BLAST of pc2 vs. RefSeq Human
Match: gi|20336242|ref|NP_000430.3| (neuroendocrine convertase 1 isoform 1 preproprotein [Homo sapiens])

HSP 1 Score: 426.402 bits (1095), Expect = 2.15805e-135
Identity = 249/602 (41.36%), Postives = 361/602 (59.97%), Query Frame = 3
Query:  348 NQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KRWVNVPERFHCIAGQIDKRYR-FNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRP 2141
N+W + PG E A+ +A+E G+ +L ++F HK P+ S ++ K L +V A+Q R KR ++ A +NL DP+++++WY+++T + LDL+V+ W +GITGKGV ++DDG+++ H D+ NY+ E+SYDF+ ND PFPRY N HGTRCAGEI+ + +N CGVGVAY+SK+ G+RMLD +TD IEA+++ ++ ++DIYSASWGP DDG+TV+GP +A GV +GR+GKGSI+VWAS G D+C+CDGY S++TISI+SA+ G + Y E CSSTLA+++S+G D + + DL+ CT H+GTSA+AP AAG+FALALEANP + WRDMQHL V TS+ W NGAGL N FG+G+L+A +V +A + W +VPE+ C+ D R + +I+EI T AC+ + + LEHVQ +++ +RRGD+ + LTS GT++++L+ R + D S GF W FM+ HTWGENP G W L + + ++G W L+LHGT ++P
Sbjct: 33 NEWAAEI--PGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRS--ALRDSA-----------------------LNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQE-NAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 598
BLAST of pc2 vs. RefSeq Human
Match: gi|295424143|ref|NP_001171346.1| (neuroendocrine convertase 1 isoform 2 [Homo sapiens])

HSP 1 Score: 416.772 bits (1070), Expect = 2.75574e-132
Identity = 225/490 (45.92%), Postives = 321/490 (65.51%), Query Frame = 3
Query:  684 MNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KRWVNVPERFHCIAGQIDKRYR-FNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRP 2141
+NL DP+++++WY+++T + LDL+V+ W +GITGKGV ++DDG+++ H D+ NY+ E+SYDF+ ND PFPRY N HGTRCAGEI+ + +N CGVGVAY+SK+ G+RMLD +TD IEA+++ ++ ++DIYSASWGP DDG+TV+GP +A GV +GR+GKGSI+VWAS G D+C+CDGY S++TISI+SA+ G + Y E CSSTLA+++S+G D + + DL+ CT H+GTSA+AP AAG+FALALEANP + WRDMQHL V TS+ W NGAGL N FG+G+L+A +V +A + W +VPE+ C+ D R + +I+EI T AC+ + + LEHVQ +++ +RRGD+ + LTS GT++++L+ R + D S GF W FM+ HTWGENP G W L + + ++G W L+LHGT ++P
Sbjct: 71 LNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQE-NAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 551
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|17136192|ref|NP_477318.1| (amontillado [Drosophila melanogaster])

HSP 1 Score: 709.909 bits (1831), Expect = 0
Identity = 383/629 (60.89%), Postives = 452/629 (71.86%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKTPG-EFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRF 2222
+ T+ + V D A+ VA + GF L + G E+ F H+ LP A + S TH + L +HP V A Q GF R KRG +P +P I+ + N + PTDP F +WY++NTGQ G LDLNV +AW+QGITGK VTTAIMDDG+DY+HPDL NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNGICGVGVAYDSKIAG+RMLDQPYMTDLIEA +M ++ I IYSASWGPTDDG+TVDGPRN TMRAIV+GVN+GR G G+IYVWASGDGG DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG + GV T DLYG+CT HSGTSAAAPEAAGVFALALEANP++ WRD+QHLTVLTSKRN L D R +WT+NG GLEFNHLFG+GVLDAG MV ++K+W +VP R+HC AG++ + + R+L EI TDACK + VNYLEHVQA +S A+RRGD+ +FLTSPMGT SMILS R DDD GFTKWPFMTTH+WGE P+G W+L F + + G EW LVLHGT+ PY L S KL +VK+ H K+
Sbjct: 39 VFTSSFLVRFRRGVDNSFAHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA-------VPAIHGMKFDLKVGEGNRIDEE-PTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKG-TDTEVNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQ-TRHGNLLEWSLVLHGTKEAPYRTLHPSSPH--SKLAIVKKAHEDKKM 653
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|281360987|ref|NP_001162774.1| (furin 2, isoform I [Drosophila melanogaster])

HSP 1 Score: 427.172 bits (1097), Expect = 3.2151e-129
Identity = 266/629 (42.29%), Postives = 388/629 (61.69%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKT-PGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRG--YKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQ--IDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQ-GLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKL 2186
I TN++ V++ P +++A+ +A + GF + RG + + ++F H + + S S H L + +VK +Q +R+KR Y+ + I L + +++ E D + P DPLF ++WY+ N G +G LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAY++ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEANPE+ WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + D++ L +D + C + + + V YLEHVQ ++++ RG++ + LTSPMGTTS +L RP+D S F WPF++ H WGE G+W L V+ + ++Q G+ ++W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYKSISLASHSQR----MEYRDVSSHFIFP-DPLFKEQWYL-NGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 843
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642484|ref|NP_727963.1| (furin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 418.698 bits (1075), Expect = 3.40609e-126
Identity = 265/650 (40.77%), Postives = 390/650 (60.00%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKT-PGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRG-----------YKPIKKQARI---PLP-------TINKKGIPGREATDNIKNMNLPTDPLFSKEWYI--RNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQ--IDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQ-GLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKL 2186
I TN++ V++ P +++A+ +A + GF + RG + + ++F H + + S S H L + +VK +Q +R+KR Y +++ P P +I+ R ++ + + DPLF ++WY+ +N G +G LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAY++ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEANPE+ WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + D++ L +D + C + + + V YLEHVQ ++++ RG++ + LTSPMGTTS +L RP+D S F WPF++ H WGE G+W L V+ + ++Q G+ ++W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFPDPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642486|ref|NP_727964.1| (furin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 418.698 bits (1075), Expect = 3.40609e-126
Identity = 265/650 (40.77%), Postives = 390/650 (60.00%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKT-PGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRG-----------YKPIKKQARI---PLP-------TINKKGIPGREATDNIKNMNLPTDPLFSKEWYI--RNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQ--IDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQ-GLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKL 2186
I TN++ V++ P +++A+ +A + GF + RG + + ++F H + + S S H L + +VK +Q +R+KR Y +++ P P +I+ R ++ + + DPLF ++WY+ +N G +G LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAY++ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEANPE+ WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + D++ L +D + C + + + V YLEHVQ ++++ RG++ + LTSPMGTTS +L RP+D S F WPF++ H WGE G+W L V+ + ++Q G+ ++W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFPDPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Match: gi|24642488|ref|NP_727965.1| (furin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 418.698 bits (1075), Expect = 3.40609e-126
Identity = 265/650 (40.77%), Postives = 390/650 (60.00%), Query Frame = 3
Query:  339 IVTNQWHVSLHHPGDEEVANKVAQETGFSVLRGHLKT-PGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKKRG-----------YKPIKKQARI---PLP-------TINKKGIPGREATDNIKNMNLPTDPLFSKEWYI--RNTGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXX-XXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQ--IDKRYRFNVSRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMGTTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPLSQ-GLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKL 2186
I TN++ V++ P +++A+ +A + GF + RG + + ++F H + + S S H L + +VK +Q +R+KR Y +++ P P +I+ R ++ + + DPLF ++WY+ +N G +G LD+NV AW +G TGKGV +I+DDGI HPDL++NY+ E+S+D + ND P P+ D+ N HGTRCAGE++A N CGVGVAY++ I G+RMLD + D++EA A+S + +IDIYSASWGP DDG TVDGP RA + GV GR+GKGSI+VWASG+GG D CNCDGY S++T+SI+SAT G Y E CSSTLA+T+S+G D V TVD+ G CT+ H+GTSA+AP AAG+ ALALEANPE+ WRDMQ+L V TS+ ++ + WT+NG +++H FGYG++DAG MV +A++W +VP + C + + D++ L +D + C + + + V YLEHVQ ++++ RG++ + LTSPMGTTS +L RP+D S F WPF++ H WGE G+W L V+ + ++Q G+ ++W L+ +GT +P +L S L P+L
Sbjct: 238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFPDPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGC-AGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870
The following BLAST results are available for this feature:
BLAST of pc2 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|128003|sp|P21661|NEC2_MOUSE0.000000e+059.87RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|128004|sp|P28841|NEC2_RAT0.000000e+059.71RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|75061998|sp|Q5REC2|NEC2_PONAB0.000000e+061.96RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|13124785|sp|P16519|NEC2_HUMAN0.000000e+061.96RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
gi|417351|sp|Q03333|NEC2_PIG0.000000e+061.96RecName: Full=Neuroendocrine convertase 2; Short=N... [more]
back to top
BLAST of pc2 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150190180.000000e+090.46SmedSxldir_c108536_g2_i2|m.79117|m.1373[more]
SMU150361653.828540e-12039.32SmedSxlregen_c89995_g1_i1|m.42695|m.12874[more]
SMU150331256.885950e-10235.84SmedSxlregen_c82367_g1_i3|m.22377|m.8734[more]
SMU150026578.745210e-10235.84Asxlregen_comp67843_c0_seq3|m.34885|m.51170[more]
SMU150008851.821090e-9534.62Asxlregen_comp60502_c0_seq1|m.9253|m.45850[more]
back to top
BLAST of pc2 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|320118926|ref|NP_001188457.1|0.000000e+061.96neuroendocrine convertase 2 isoform 3 [Homo sapien... [more]
gi|20336244|ref|NP_002585.2|0.000000e+061.96neuroendocrine convertase 2 isoform 1 preproprotei... [more]
gi|320118928|ref|NP_001188458.1|0.000000e+060.30neuroendocrine convertase 2 isoform 2 preproprotei... [more]
gi|20336242|ref|NP_000430.3|2.158050e-13541.36neuroendocrine convertase 1 isoform 1 preproprotei... [more]
gi|295424143|ref|NP_001171346.1|2.755740e-13245.92neuroendocrine convertase 1 isoform 2 [Homo sapien... [more]
back to top
BLAST of pc2 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136192|ref|NP_477318.1|0.000000e+060.89amontillado [Drosophila melanogaster][more]
gi|281360987|ref|NP_001162774.1|3.215100e-12942.29furin 2, isoform I [Drosophila melanogaster][more]
gi|24642484|ref|NP_727963.1|3.406090e-12640.77furin 2, isoform A [Drosophila melanogaster][more]
gi|24642486|ref|NP_727964.1|3.406090e-12640.77furin 2, isoform B [Drosophila melanogaster][more]
gi|24642488|ref|NP_727965.1|3.406090e-12640.77furin 2, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_018155 ID=Ddo_018155|Name=pc2|organism=Dugesia dorotocephala|type=mRNA|length=2506bp
GATTGTCGAGGACAAAAATAAAACAGGAGACCGTGCATATATTGTTATTC
CTTCTCGACTTAGGTTGTATGTTTTGTTGTAGCTGGAAATAATTGATGCT
TGCCCATATTTCTGGGCATTATCGATCTATTCTCTCCCCGAGTCGTAGAG
TTTGTATATCGTTTCTACAAATACGGATTCTTCTGTGTAGGTGGGAAACA
GATAAATAATAACAACAAAAACACAAAAATTATCGTTTTAAAAACTCTCG
AATTTTTTTTAGTTTTCATCATTATTATTTATCAATGATGTTTTTGTGGA
TTTTAACGACACTGCAAATTTATTTAATTAATGGGAAGATTGTCACCAAT
CAATGGCATGTAAGTCTACATCATCCTGGAGACGAAGAGGTAGCTAATAA
AGTAGCCCAAGAAACGGGGTTTTCAGTTTTACGAGGTCATCTAAAAACCC
CCGGAGAATTCGTGTTCAGCCATAAAGCATTACCACAAGCTAGCGCTATT
CCAAGTTGGACACATCACAAAATTCTTTTGGCTCATCCTCAAGTAAAAAA
TGCAAAACAAGTAGAAGGGTTTTTAAGAAAGAAAAGAGGTTATAAGCCGA
TTAAAAAACAAGCACGTATTCCACTTCCGACAATAAATAAAAAAGGAATT
CCTGGAAGAGAAGCTACAGATAACATTAAAAATATGAATTTACCAACTGA
TCCTCTATTTTCAAAGGAATGGTATATTCGGAACACTGGTCAAGCAGAAG
GAGTAAAAGACTTAGATCTTAACGTTCTTTCAGCATGGTCTCAAGGCATT
ACTGGTAAAGGTGTTACTACTGCAATTATGGATGACGGTATAGATTATCT
TCACCCGGATCTGTCTAAAAATTATAATGCTGAAAGTAGCTATGATTTCA
GCAGTAACGATCCATATCCATTTCCTCGTTACACCGACGACTGGTTTAAC
AGTCATGGAACGCGATGTGCAGGTGAAATTTCAGCTGAGAGAGACAATGG
AATCTGCGGTGTTGGGGTTGCATATGATTCTAAGATCGCCGGACTACGAA
TGCTTGACCAACCATATATGACAGATCTAATCGAGGCAGCTGCAATGAGC
TATGACAGGGATAATATTGATATTTATTCTGCAAGTTGGGGACCCACAGA
TGACGGTAGAACGGTAGATGGACCCAGAAATGAAACGATGAGAGCAATTG
TTGAAGGTGTAAATAAAGGTCGGAAAGGTAAAGGAAGTATTTATGTGTGG
GCTTCCGGAGATGGAGGAGCTGCAGATGATTGCAATTGTGATGGGTATGC
AGCGAGCATGTGGACAATAAGTATTAATTCAGCGACTAATGATGGAGAGA
CAGCAAGTTATGATGAATCATGTTCATCAACTCTTGCATCTACATTTTCC
AATGGCAAGGCTTGGTTTAGTCTTGATGCAGGAGTAGGTACAGTAGATTT
ATATGGACAATGTACACTTCATCATTCCGGAACATCAGCTGCTGCTCCTG
AAGCTGCTGGAGTGTTTGCATTGGCTTTAGAAGCTAACCCAGAAATTGGA
TGGCGAGATATGCAACACTTAACAGTTTTAACTAGTAAAAGAAATCACTT
ACATGACAGAGACCGCCGACATAATTGGACAATAAATGGAGCAGGATTGG
AATTTAATCATCTCTTTGGTTACGGAGTTCTTGATGCTGGAGATATGGTC
CGAGTAGCAAAAAGATGGGTTAATGTCCCAGAACGATTCCACTGTATAGC
AGGACAAATCGATAAGCGCTACCGATTTAACGTCAGCAGAGCGCTAATAT
TAGAAATCGATACTGATGCCTGTAAGTCAGACTCGGGGCATCGAGTCAAC
TATTTGGAACATGTCCAAGCATTTGTTTCAGTCAAAGCTACTCGAAGAGG
AGATATAACAATGTTTCTTACCAGTCCTATGGGTACAACTTCAATGATTC
TTAGTCATCGACCAAAAGATGATGATTCTTCTCGTGGTTTTACTAAATGG
CCATTTATGACAACGCATACGTGGGGAGAAAATCCACGTGGTAAATGGCG
ATTAACAGTAATGTTTGAAACAAAAGAGCCACTGAGTCAAGGATTATTTA
CTGAGTGGGTCCTTGTTTTACATGGAACACAAAATCGTCCGTATGATAAA
TTGTCGAGTTCGTTGGAAAAAATTATACCGAAACTTGGAGTCGTAAAAAG
ACAACATGCTTCGAAAAGATTCATGCAGTAGGAAAACTAAAACTTGATTA
GTTTTGACGATATGTGACATTCGAGGATTTTAGTCTGACTGAAGATTTTG
TGATCGTATTTTTGTAAACTTTTGTCCAGTAAGATTGTGAAATATTGCTA
TTACATTAATATCAAAGAATAAATATTTGTCTTGTATTTCATAATCAAAT
TTGATTAACTTTAAGTCTCTCAACATTTCATCTTGTTATTCGATAGTTTC
TACACATTTCTTATTTTATTTATTCAAAAATAAATGTGTTTTGCTTTTAA
AAACAA

Design Primers for pc2

back to top

protein sequence

>Ddo_018155-protein ID=Ddo_018155-protein|Name=pc2|organism=Dugesia dorotocephala|type=polypeptide|length=649bp
MMFLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVLR
GHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKK
RGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRN
TGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSK
IAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNE
TMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKRNHLHDRDRRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNV
SRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMG
TTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPL
SQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRFMQ*
back to top

coding sequence

>Ddo_018155.285.2231 ID=Ddo_018155.285.2231|Name=Ddo_018155.285.2231|organism=Dugesia dorotocephala|type=CDS|length=1947bp
ATGATGTTTTTGTGGATTTTAACGACACTGCAAATTTATTTAATTAATGG
GAAGATTGTCACCAATCAATGGCATGTAAGTCTACATCATCCTGGAGACG
AAGAGGTAGCTAATAAAGTAGCCCAAGAAACGGGGTTTTCAGTTTTACGA
GGTCATCTAAAAACCCCCGGAGAATTCGTGTTCAGCCATAAAGCATTACC
ACAAGCTAGCGCTATTCCAAGTTGGACACATCACAAAATTCTTTTGGCTC
ATCCTCAAGTAAAAAATGCAAAACAAGTAGAAGGGTTTTTAAGAAAGAAA
AGAGGTTATAAGCCGATTAAAAAACAAGCACGTATTCCACTTCCGACAAT
AAATAAAAAAGGAATTCCTGGAAGAGAAGCTACAGATAACATTAAAAATA
TGAATTTACCAACTGATCCTCTATTTTCAAAGGAATGGTATATTCGGAAC
ACTGGTCAAGCAGAAGGAGTAAAAGACTTAGATCTTAACGTTCTTTCAGC
ATGGTCTCAAGGCATTACTGGTAAAGGTGTTACTACTGCAATTATGGATG
ACGGTATAGATTATCTTCACCCGGATCTGTCTAAAAATTATAATGCTGAA
AGTAGCTATGATTTCAGCAGTAACGATCCATATCCATTTCCTCGTTACAC
CGACGACTGGTTTAACAGTCATGGAACGCGATGTGCAGGTGAAATTTCAG
CTGAGAGAGACAATGGAATCTGCGGTGTTGGGGTTGCATATGATTCTAAG
ATCGCCGGACTACGAATGCTTGACCAACCATATATGACAGATCTAATCGA
GGCAGCTGCAATGAGCTATGACAGGGATAATATTGATATTTATTCTGCAA
GTTGGGGACCCACAGATGACGGTAGAACGGTAGATGGACCCAGAAATGAA
ACGATGAGAGCAATTGTTGAAGGTGTAAATAAAGGTCGGAAAGGTAAAGG
AAGTATTTATGTGTGGGCTTCCGGAGATGGAGGAGCTGCAGATGATTGCA
ATTGTGATGGGTATGCAGCGAGCATGTGGACAATAAGTATTAATTCAGCG
ACTAATGATGGAGAGACAGCAAGTTATGATGAATCATGTTCATCAACTCT
TGCATCTACATTTTCCAATGGCAAGGCTTGGTTTAGTCTTGATGCAGGAG
TAGGTACAGTAGATTTATATGGACAATGTACACTTCATCATTCCGGAACA
TCAGCTGCTGCTCCTGAAGCTGCTGGAGTGTTTGCATTGGCTTTAGAAGC
TAACCCAGAAATTGGATGGCGAGATATGCAACACTTAACAGTTTTAACTA
GTAAAAGAAATCACTTACATGACAGAGACCGCCGACATAATTGGACAATA
AATGGAGCAGGATTGGAATTTAATCATCTCTTTGGTTACGGAGTTCTTGA
TGCTGGAGATATGGTCCGAGTAGCAAAAAGATGGGTTAATGTCCCAGAAC
GATTCCACTGTATAGCAGGACAAATCGATAAGCGCTACCGATTTAACGTC
AGCAGAGCGCTAATATTAGAAATCGATACTGATGCCTGTAAGTCAGACTC
GGGGCATCGAGTCAACTATTTGGAACATGTCCAAGCATTTGTTTCAGTCA
AAGCTACTCGAAGAGGAGATATAACAATGTTTCTTACCAGTCCTATGGGT
ACAACTTCAATGATTCTTAGTCATCGACCAAAAGATGATGATTCTTCTCG
TGGTTTTACTAAATGGCCATTTATGACAACGCATACGTGGGGAGAAAATC
CACGTGGTAAATGGCGATTAACAGTAATGTTTGAAACAAAAGAGCCACTG
AGTCAAGGATTATTTACTGAGTGGGTCCTTGTTTTACATGGAACACAAAA
TCGTCCGTATGATAAATTGTCGAGTTCGTTGGAAAAAATTATACCGAAAC
TTGGAGTCGTAAAAAGACAACATGCTTCGAAAAGATTCATGCAGTAG
back to top
Gene Groups
pc2 is similar in sequence to the genes of this group: GG3186
Gene NameGene ID
SMU15019018SMU15019018
pc2Ddo_018155
pc2Gsp_010792
pc2Pgr_003685
Pgr_007588Pgr_007588
pc2Pmo_008419
Pmo_028616Pmo_028616

Gene Group Protein Sequences

>SMU15019018

MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLR
NHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRK
RGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFN
VTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP
LSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Ddo_018155 pc2
MMFLWILTTLQIYLINGKIVTNQWHVSLHHPGDEEVANKVAQETGFSVLR
GHLKTPGEFVFSHKALPQASAIPSWTHHKILLAHPQVKNAKQVEGFLRKK
RGYKPIKKQARIPLPTINKKGIPGREATDNIKNMNLPTDPLFSKEWYIRN
TGQAEGVKDLDLNVLSAWSQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSK
IAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNE
TMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAGVFALALEANPEIGWRDMQHLTVLTSKRNHLHDRDRRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKRWVNVPERFHCIAGQIDKRYRFNV
SRALILEIDTDACKSDSGHRVNYLEHVQAFVSVKATRRGDITMFLTSPMG
TTSMILSHRPKDDDSSRGFTKWPFMTTHTWGENPRGKWRLTVMFETKEPL
SQGLFTEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASKRFMQ*
>Gsp_010792 pc2
MYRISLLFLIQIYTIYGKIVTNQWHVRLHDPGTHDLANKVAQETGFSLLR
NHIQSPNEFVYHHKAVPHVSSIPSWNHHKVLLSHPLVKEAKQVEGFIRKK
RGFKPIKKQDRIPLPTINKKGIPGRGKTENIKENMKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYNS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQINKRYRFN
VTKALILEIDTDACKSDTGHRVNYLEHVQAFISVKASRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWRLTIMFDTKDP
LSQGIFSEWVLVLHGTQNRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
>Pgr_003685 pc2
MKFYLTIWICLIAASKRSWAGIHTNQWHVHLHEPGENMAKKVAAETGFSL
LRSHFKSPNEFIFTHKAIPEVSAVPSWSHHMNLVAHPMVKQANQAEGYLR
KKRGYKPVKRDRIPLPSINKKGIPDREKVKNENIKLPTDPLFAKEWYIRN
TGQAEGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAE
SSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYDSK
VVGLRMLDQPYMTDLIESAAMSHDRDSIHIYSASWGPTDDGRTVDGPRNE
TMKAIVDGVNKGRHGKGNIYVWASGDGGVADDCNCDGYAASMWTISINSA
TNDGETASYDESCSSTLASTFSNGKAWYSLDAGVGTVDLYGQCTLHHSGT
SAAAPEAAAVFALALEANTNIGWRDMQHLSVLTSKRNHLHDRDQRHNWTI
NGAGLEFNHLFGYGVLDAGDMVRVAKQWVNVPERFHCIAGTIDKRMIFNV
SKALVLEIDTDACKLDEAHMVNYLEHVQAFVTVKASRRGDITMFLTSPMG
TTSMILSRREKDDDPSRGFTKWPFMTTHTWGENPRGKWRLTVMFDTEDAL
SQGLFSEWILVLHGTQTPPYDKLSASLETIIPKLAAVKRQHASKTFLQ*
>Pgr_007588 Pgr_007588
MHFYLIFWLFVLSGVRESLAKIHSNQWYVRLHESGDDAAKRVASETGFVY
LRNHLQSPHEFIFTHRGIADASAAPSVSHQMNLLAHPMVKQASQMEGFLR
RKRGYKPVKKLPLQLTNINKKGIPDREKNSTDAHSQRRLPRDPLFSKEWY
ILNTGQAEGVKDLDLNVLSAWDQGVTGKGITTAIMDDGIDYLHPDLSKNY
NAENSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNDICGVGIAY
NSKVAGLRMLDQPYMTDLIEASAMSHDRDMIDIYSASWGPTDDGRTVDGP
RNETMRAIVDGVNKGRNGRGSIYVWASGDGGMSDDCNCDGYAASMWTISI
NSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLLH
SGTSAAAPEAAAVFALALEANREIGWRDMQHLSVLTSKRNHLHDRDGRHN
WTINGAGLEFNHLFGYGVLDAGDMVRVAKKWINVPERFHCIAGEISERSR
FNISKALILEINTDACKSSDGHRVNYLEHVQAFVTVRASRRGDVTLFLTS
PMGTTSMILSRRVKDGDSMQGFTKWPFMTTHTWGENPRGKWRLMAMFDTD
DALSQGVLSEWILVLHGTQERPYDKLSSSLEKILPKLAVIKRQHASKNFL
Q*
>Pmo_008419 pc2
MRVAILVSVIVVLLSHRLTATIHSNQWHVHLQQPGEHVAEQVASETGFSL
LRNHLRSPNEFIFTHRALPPASAVASLSHHMNLVAHPLVKQATQMEGFLR
KKRGYKPIKRQRVPLPSIDKKGIPDRLKERSNKESIKLPTDPLFEKEWYI
RNTGQAEGVKDLDLNVLSAWSQGITGKGITTAIMDDGIDYLHSDLSRNYN
AESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGVCGVGIAYN
SQVAGLRMLDQPYMTDLIEAAAMSHDRDNIHIYSASWGPTDDGRTVDGPR
NETMRAIVDGVNKGRNGKGNIYVWASGDGGASDDCNCDGYAASMWTISIN
SATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHS
GTSAAAPEAAAVFALALEANGEMGWRDMQHLSVLTSKRNHLHDRDGRHNW
TINGAGLEFNHLFGYGVLDAGDMVRVAKMWANVPERFHCIAGEINQKSRF
NISKALVLEIDTDACKSDDNHRVNYLEHVQAFVTVKASRRGDITMFLTSP
MGTTSMILSRREKDSDSIRGFTKWPFMTTHTWGETPRGKWRLTVMFDTED
ALIQGLLSEWV
>Pmo_028616 Pmo_028616
MDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGE
ISAERDNGVCGVGIAYNSQVVGLRMLDQPYMTDLIESAAMSHERDSIDIY
SASWGPTDDGRTVDGPRNETMKAIVDGVNKGRRGKGNIYVWASGDGGVAD
DCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWYSLD
AGVGTVDLYGQCTLHHSGTSAAAPEAAAVFALALEANTNIGWRDMQHLSV
LTSKRNHLHDRDQRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKQWVNV
PERFHCIAGQIDHKARFNVTKALILEIDTDACKSDDGHRVNYLEHVQAFV
TVKASRRGDTTMFLTSPMGTTSMILSRREKDSDSIRGFTKWPFMTTHTWG
ENPRGKWRLTVMFDTEDALSQGMFSEWILLLHGTQIPPYDKLSTSLEKII
PKLAAVKRQHASKKFLE*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.