slit, Ddo_016416 (mRNA) Dugesia dorotocephala

Overview
Nameslit
Unique NameDdo_016416
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length9630
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteSlit
Homology
BLAST of slit vs. uniprot
Match: gi|33302576|sp|P24014|SLIT_DROME (RecName: Full=Protein slit; Short=dSlit; Contains: RecName: Full=Protein slit N-product; Contains: RecName: Full=Protein slit C-product; Flags: Precursor)

HSP 1 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1549 (32.15%), Postives = 766/1549 (49.45%), Query Frame = 2
Query:   83 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLD------------------------LRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 4588
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +LRLN N ++ +P++ + + L +LD L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1504

HSP 2 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1549 (32.15%), Postives = 766/1549 (49.45%), Query Frame = -2
Query: 5043 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLD------------------------LRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 9548
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +LRLN N ++ +P++ + + L +LD L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1504
BLAST of slit vs. uniprot
Match: gi|45477220|sp|O88280|SLIT3_RAT (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 736.487 bits (1900), Expect = 0
Identity = 503/1584 (31.76%), Postives = 775/1584 (48.93%), Query Frame = 2
Query:  122 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNE--SSFKNLINLKTLV-LSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSL-------PVKSTICSKPGVCSNNG--------------VCHEVNEKN---RKYKC---------------VCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQ 4576
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + I + +C+ P L ++ + E+ C +E C + CP C+CS + IV+C GK LT IP +LP +E+ L+ NSI + G +YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS LS +P + TT L L+ NDI L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CVNN+TF L + +L L DN I+ I +F +L + L +N +C+C + WL W R + G+ P CQ P LK P+ ++ + F CEGN EE S C P+CP +C C T + CS L +P +P + TELYL+ N L + + S+F+ L TL+ LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG CS Y C CP + GK C IN C PC++GG C +++ + + C CP GF G +C N DDC + CEN ATCVD +N Y+C CP + G+ C+ YC + N C++ C L + ++C C G+ GK CE + DDC + C++ A+C D VNGY CIC G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + ++ + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S E + E T L P CS G C G +C + N+ +KC +C+ GF G C++ + C G+ R I+ + +C + K VC+G C S CCQP + K F+C +G + V C C+
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCEGN----EENS----------------CQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSH-GTCVATGNSYVCKCAEGYEGPLCDQKNDSANACSAFKCHHGQCHISDRGEPYCLCQPGFSGNHCEQE-NPCLGEIVREAIRRQKDYASCATASKVPIMVCRGGCG---------------------SQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGCR 1520

HSP 2 Score: 736.487 bits (1900), Expect = 0
Identity = 503/1584 (31.76%), Postives = 775/1584 (48.93%), Query Frame = -2
Query: 5055 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNE--SSFKNLINLKTLV-LSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSL-------PVKSTICSKPGVCSNNG--------------VCHEVNEKN---RKYKC---------------VCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQ 9509
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + I + +C+ P L ++ + E+ C +E C + CP C+CS + IV+C GK LT IP +LP +E+ L+ NSI + G +YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS LS +P + TT L L+ NDI L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CVNN+TF L + +L L DN I+ I +F +L + L +N +C+C + WL W R + G+ P CQ P LK P+ ++ + F CEGN EE S C P+CP +C C T + CS L +P +P + TELYL+ N L + + S+F+ L TL+ LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG CS Y C CP + GK C IN C PC++GG C +++ + + C CP GF G +C N DDC + CEN ATCVD +N Y+C CP + G+ C+ YC + N C++ C L + ++C C G+ GK CE + DDC + C++ A+C D VNGY CIC G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + ++ + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S E + E T L P CS G C G +C + N+ +KC +C+ GF G C++ + C G+ R I+ + +C + K VC+G C S CCQP + K F+C +G + V C C+
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCEGN----EENS----------------CQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSH-GTCVATGNSYVCKCAEGYEGPLCDQKNDSANACSAFKCHHGQCHISDRGEPYCLCQPGFSGNHCEQE-NPCLGEIVREAIRRQKDYASCATASKVPIMVCRGGCG---------------------SQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGCR 1520

HSP 3 Score: 286.96 bits (733), Expect = 1.96356e-76
Identity = 211/714 (29.55%), Postives = 321/714 (44.96%), Query Frame = 2
Query:  773 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVS------------------------TIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT 2695
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G +V +Q + C + + + CP CSCS+ IV+C G GL+ +P + + L N IK++ + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ + FS C +D+ CP KC+CE T +DCS +L IP+ +P TT+L L+ ND+ L + FK L NL+ + LS N I E+ + ++ L+L+ N+L+ +H F+ LS LK L+L+SN +S TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E++
Sbjct: 29 PPAAACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQ-FTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANS----LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFI-QYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSEDYRNR--------FSSECFMDL------VCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCEGNEENS 718

HSP 4 Score: 286.96 bits (733), Expect = 1.96356e-76
Identity = 211/714 (29.55%), Postives = 321/714 (44.96%), Query Frame = -2
Query: 6936 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVS------------------------TIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT 8858
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G +V +Q + C + + + CP CSCS+ IV+C G GL+ +P + + L N IK++ + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ + FS C +D+ CP KC+CE T +DCS +L IP+ +P TT+L L+ ND+ L + FK L NL+ + LS N I E+ + ++ L+L+ N+L+ +H F+ LS LK L+L+SN +S TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E++
Sbjct: 29 PPAAACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQ-FTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANS----LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFI-QYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSEDYRNR--------FSSECFMDL------VCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCEGNEENS 718

HSP 5 Score: 211.075 bits (536), Expect = 4.04708e-53
Identity = 141/440 (32.05%), Postives = 219/440 (49.77%), Query Frame = 2
Query:  119 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 1429
+CP+ C+CE V+C ++ +P+ L E TT L L N I V+ + F KL L+ + LSNNRI + GAFD + +L L N ++ + +F LS L+ L LR N + C+N F+ L ++ L L N++ IS A T L L + + SN +CNCH+ WL +L+ K I + R C P L +IPI ++ +F C NEEN+CQ + CP+QCTC + +V C+ + L +P+ +P + EL L+ N +T + P +QLT + L+ N++ + + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P S + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEENSCQLSPR-CPEQCTCVET-VVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAV-------------------------PKELSTFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIK-AGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPVDI 911

HSP 6 Score: 211.075 bits (536), Expect = 4.04708e-53
Identity = 141/440 (32.05%), Postives = 219/440 (49.77%), Query Frame = -2
Query: 8202 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 9512
+CP+ C+CE V+C ++ +P+ L E TT L L N I V+ + F KL L+ + LSNNRI + GAFD + +L L N ++ + +F LS L+ L LR N + C+N F+ L ++ L L N++ IS A T L L + + SN +CNCH+ WL +L+ K I + R C P L +IPI ++ +F C NEEN+CQ + CP+QCTC + +V C+ + L +P+ +P + EL L+ N +T + P +QLT + L+ N++ + + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P S + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEENSCQLSPR-CPEQCTCVET-VVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAV-------------------------PKELSTFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIK-AGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPVDI 911
BLAST of slit vs. uniprot
Match: gi|341942041|sp|Q9WVB4|SLIT3_MOUSE (RecName: Full=Slit homolog 3 protein; Short=Slit-3; Short=Slit3; Flags: Precursor)

HSP 1 Score: 732.635 bits (1890), Expect = 0
Identity = 496/1584 (31.31%), Postives = 772/1584 (48.74%), Query Frame = 2
Query:  122 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNE--SSFKNLINLKTLV-LSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEV-------PIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKN---RKYKC---------------VCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQG 4579
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + I + +C+ P L ++ + E+ C +E C + CP C+CS + IV+C GK LT IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L+ +P + TT L L+ NDI L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C + WL W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L +P +P + TELYL+ N L + + S+F+ L TL+ LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG CS Y C CP + GK C IN C PC +GG C ++N + + C CP GF G +C N DDC + CEN ATCVD +N Y+C CP + G+ C+ YC + N C++ C L + ++C C G+ GK CE N DDC + C++ A+C D VNGY CIC G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + ++ + L + ++ +L L + ++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + + K +C + N+ +KC +C+ GF G C++ + C G+ R I+ + +C + K C+G C S CCQP + K F+C +G + V C C+
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK--LQKQPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCRHGTCMATGDSYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQCHISDRGEPYCLCQPGFSGHHCEQE-NPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCG---------------------SQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGCRA 1521

HSP 2 Score: 732.635 bits (1890), Expect = 0
Identity = 496/1584 (31.31%), Postives = 772/1584 (48.74%), Query Frame = -2
Query: 5052 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNE--SSFKNLINLKTLV-LSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEV-------PIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKN---RKYKC---------------VCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQG 9509
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + I + +C+ P L ++ + E+ C +E C + CP C+CS + IV+C GK LT IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L+ +P + TT L L+ NDI L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C + WL W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L +P +P + TELYL+ N L + + S+F+ L TL+ LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG CS Y C CP + GK C IN C PC +GG C ++N + + C CP GF G +C N DDC + CEN ATCVD +N Y+C CP + G+ C+ YC + N C++ C L + ++C C G+ GK CE N DDC + C++ A+C D VNGY CIC G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + ++ + L + ++ +L L + ++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + + K +C + N+ +KC +C+ GF G C++ + C G+ R I+ + +C + K C+G C S CCQP + K F+C +G + V C C+
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK--LQKQPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCRHGTCMATGDSYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQCHISDRGEPYCLCQPGFSGHHCEQE-NPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCG---------------------SQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGCRA 1521

HSP 3 Score: 286.189 bits (731), Expect = 3.02308e-76
Identity = 211/714 (29.55%), Postives = 321/714 (44.96%), Query Frame = 2
Query:  773 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVS------------------------TIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT 2695
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G +V +Q + C + + + CP CSCS+ IV+C G GL+ +P + + L N IK++ + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ + FS C +D+ CP KC+CE T +DCS +L IP+ +P TT+L L+ ND+ L + FK L NL+ + LS N I E+ + ++ L+L+ N+L+ +H F+ LS+LK L+L+SN +S TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E +
Sbjct: 29 PPAAACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQ-FTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANS----LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSEDYRNR--------FSSECFMDL------VCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESS 718

HSP 4 Score: 286.189 bits (731), Expect = 3.02308e-76
Identity = 211/714 (29.55%), Postives = 321/714 (44.96%), Query Frame = -2
Query: 6936 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVS------------------------TIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT 8858
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G +V +Q + C + + + CP CSCS+ IV+C G GL+ +P + + L N IK++ + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ + FS C +D+ CP KC+CE T +DCS +L IP+ +P TT+L L+ ND+ L + FK L NL+ + LS N I E+ + ++ L+L+ N+L+ +H F+ LS+LK L+L+SN +S TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E +
Sbjct: 29 PPAAACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQ-FTLCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANS----LSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSEDYRNR--------FSSECFMDL------VCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESS 718

HSP 5 Score: 208.379 bits (529), Expect = 3.17499e-52
Identity = 138/440 (31.36%), Postives = 219/440 (49.77%), Query Frame = 2
Query:  119 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 1429
+CP+ C+CE V+C ++ +P+ L E TT L L N I V+ + F KL L+ + LSNNRI + GAFD + +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCH+ WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ + L +P+ +P + EL L+ N +T + P +QLT + L+ N++ + + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P S + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTCVET-VVRCSNRGLHALPKGMPKDVTELYLEGNHLTAV-------------------------PKELSAFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPVDI 911

HSP 6 Score: 208.379 bits (529), Expect = 3.17499e-52
Identity = 138/440 (31.36%), Postives = 219/440 (49.77%), Query Frame = -2
Query: 8202 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 9512
+CP+ C+CE V+C ++ +P+ L E TT L L N I V+ + F KL L+ + LSNNRI + GAFD + +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCH+ WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ + L +P+ +P + EL L+ N +T + P +QLT + L+ N++ + + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P S + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTCVET-VVRCSNRGLHALPKGMPKDVTELYLEGNHLTAV-------------------------PKELSAFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPVDI 911
BLAST of slit vs. uniprot
Match: gi|311033528|sp|O75094|SLIT3_HUMAN (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 723.005 bits (1865), Expect = 0
Identity = 488/1580 (30.89%), Postives = 768/1580 (48.61%), Query Frame = 2
Query:  122 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEVP-------------IKSTKSLPVKSTICSKPGVCSNNG---------VCH----EVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 4573
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + + + +C+ P L ++ + E+ C +E +C + CP CTCS + IV+C GK L IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L +P + T L L+ N++ L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C L WL +W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L+ +P +P + TELYL+ N L + L +L + LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG C+ Y C CP + GK C IN C PC++GG C +D+ + + C CP GF G +C N DDC + CEN ATCVD +N Y C CP + G+ C+ +C + N C++ C PL + + C C G+ GK CE + DDC + C++ A+C D +NGY C C G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + + + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + S K +C N CH ++++ Y C+C+ GF G C++ + C G+ R I+ + +C + K C+G C CCQP++ K F+C +G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPY-CLCQPGFSGEHCQQE-NPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQ---------------------CCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 723.005 bits (1865), Expect = 0
Identity = 488/1580 (30.89%), Postives = 768/1580 (48.61%), Query Frame = -2
Query: 5058 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEVP-------------IKSTKSLPVKSTICSKPGVCSNNG---------VCH----EVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 9509
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + + + +C+ P L ++ + E+ C +E +C + CP CTCS + IV+C GK L IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L +P + T L L+ N++ L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C L WL +W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L+ +P +P + TELYL+ N L + L +L + LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG C+ Y C CP + GK C IN C PC++GG C +D+ + + C CP GF G +C N DDC + CEN ATCVD +N Y C CP + G+ C+ +C + N C++ C PL + + C C G+ GK CE + DDC + C++ A+C D +NGY C C G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + + + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + S K +C N CH ++++ Y C+C+ GF G C++ + C G+ R I+ + +C + K C+G C CCQP++ K F+C +G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPY-CLCQPGFSGEHCQQE-NPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQ---------------------CCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 3 Score: 281.952 bits (720), Expect = 6.72506e-75
Identity = 216/739 (29.23%), Postives = 331/739 (44.79%), Query Frame = 2
Query:  773 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVI-CPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQS------------------------NDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT-YITAKCD---ACMKT--PCQNNG 2749
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G V +Q + C + + +C I CP C+CS+ IV+C G GL +P + + L N IK + + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ ++ FS C +D+ CP KC+CE T +DCS +L IP+ +P T+L L+ N++ L + FK L NL+ + LS N I E+ + +++ L+L+ N+L+ +H F+ LS LK L+L+S N ++TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E + ++ +C CM+T C N G
Sbjct: 29 PPAVACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ-FTLCMAPVHLRGFNVADVQKKEYVCPAP-----HSEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSED--------YRSRFSSECFMDL------VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKG 742

HSP 4 Score: 281.952 bits (720), Expect = 6.72506e-75
Identity = 216/739 (29.23%), Postives = 331/739 (44.79%), Query Frame = -2
Query: 6882 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVI-CPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQS------------------------NDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT-YITAKCD---ACMKT--PCQNNG 8858
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G V +Q + C + + +C I CP C+CS+ IV+C G GL +P + + L N IK + + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ ++ FS C +D+ CP KC+CE T +DCS +L IP+ +P T+L L+ N++ L + FK L NL+ + LS N I E+ + +++ L+L+ N+L+ +H F+ LS LK L+L+S N ++TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E + ++ +C CM+T C N G
Sbjct: 29 PPAVACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ-FTLCMAPVHLRGFNVADVQKKEYVCPAP-----HSEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSED--------YRSRFSSECFMDL------VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKG 742

HSP 5 Score: 201.445 bits (511), Expect = 4.21517e-50
Identity = 136/440 (30.91%), Postives = 217/440 (49.32%), Query Frame = 2
Query:  119 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 1429
+CP+ C+CE V+C ++ +P+ L E T L L N + V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCHL WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ K L +P+ +P + EL L+ N +T + P L+ LT + L+ N++ + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-------------------------PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDI 911

HSP 6 Score: 201.445 bits (511), Expect = 4.21517e-50
Identity = 136/440 (30.91%), Postives = 217/440 (49.32%), Query Frame = -2
Query: 8202 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 9512
+CP+ C+CE V+C ++ +P+ L E T L L N + V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCHL WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ K L +P+ +P + EL L+ N +T + P L+ LT + L+ N++ + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-------------------------PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDI 911
BLAST of slit vs. uniprot
Match: gi|45477219|sp|O88279|SLIT1_RAT (RecName: Full=Slit homolog 1 protein; Short=Slit-1; AltName: Full=Multiple epidermal growth factor-like domains protein 4; Short=Multiple EGF-like domains protein 4; Flags: Precursor)

HSP 1 Score: 705.286 bits (1819), Expect = 0
Identity = 488/1591 (30.67%), Postives = 747/1591 (46.95%), Query Frame = 2
Query:  122 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKH---LRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENT-----CQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI----KYDTH-DENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNF-GNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCH-DKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLK--SKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGC---------GDLISKTAQELPSSEVPT--------QDIEVPIKSTKSLPVK------------------STICSKPGVCSN--------NGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 4573
CP C C +V+C + +P + T RL L GN I I K+DF L L+VLQL N+I ++E GAFD++ L +LRLNRN +Q LP+ LF L +LDL EN LQ + F LK L L+ N++ I E ++ H LR R+ SN L C+CHL WL+ +L+ + I C P L + ++ + EF C+ + C CP C+CS +GIV+C GK LT IP +LP E+ L+ N I + G S Y+ L++I L+ N + +I P AF GL+ L +L L N + + R F GL +L L L+ N+I C+ F+ ++ L LL L +NK+ +L + L ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+++ D H + C V CPHKC C + +V CSG+ LS +PE+I STT L L++N+I L+ + S+L K++LSNN++ I+ TF +T + E++L++N+L+ C++N++F L + +L L DNHI+ I +F L L L N +C+C+L WL +W R + G+ P CQ+P L+ PL ++ F CE +EE + C P+CP +C C T + CS L+ +P IP N TELYLD N TL L+ + LS N I+ ++ T + L TL+LS+N LQCI AF+ L +L++L L NDVST+ F D+T+L+++A+G NP +CDC+++WL+ + + + GI+ CA P M+ K + + +F C + + AKCD C+ +PCQN G C Y C CP+ + G++CE +++C PC NGG C + + C CPSGF G C N DDC H C NG CVD + Y+C+CP + G+ CE +C D NPC++ C +C C G+ G NC +N DDCK + C+N A+C D +N Y C+C GY G CE P + C EC N CV++ + C+C PG+ GP C+ L S+ F +D++++ P+ NI+L+ T +G++LY G D ++ V L++GH+++SY+ G +S + +ND + H + + + + + ++G T+ K+ N L ++GG P + + A + N + F GCI +L IN + DF+K K V PGC + A P Q ++ P K + K +C++ G + +G C R CVC GF G C++ S+C G R F + + C + + + C+G C CCQ + K+ F+C +G + V P C C
Sbjct: 34 CPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAAQVPACTLSSGSCPAMCSCS-NGIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETT-GARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSGLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGATSVSELHLTANQLESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGN---PRCQNPDFLRQIPLQDVAFPDFRCE---EGQEE----------------VGCLPRPQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPEMEGKLLLTTPAKKFEC-QGPPSLAVQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRNCEVSLDSCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGLTCGMNTDDCVKHDCVNGGVCVDGIGNYTCQCPLQYTGRACEQLVDFCSPDLNPCQHEAQCVGTPEGP-RCECVPGYTGDNCSKNQDDCKDHQCQNGAQCVDEINSYACLCAEGYSGQLCEIPP------------------------------APRNSCEGTECQNGANCVDQG---SRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPGSYPSSAI-YSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDNFGKHYTLNSEAPL----YVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHGHKCVHGKCVPLDALAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQA--SATRGAHCVCSPGFSGELCEQE-SECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGACPGQG--------------------CCQGLRLKRRKLTFECSDGTSFAEEVEKPTKCGC 1527

HSP 2 Score: 705.286 bits (1819), Expect = 0
Identity = 488/1591 (30.67%), Postives = 747/1591 (46.95%), Query Frame = -2
Query: 5058 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKH---LRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENT-----CQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI----KYDTH-DENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNF-GNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCH-DKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLK--SKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGC---------GDLISKTAQELPSSEVPT--------QDIEVPIKSTKSLPVK------------------STICSKPGVCSN--------NGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 9509
CP C C +V+C + +P + T RL L GN I I K+DF L L+VLQL N+I ++E GAFD++ L +LRLNRN +Q LP+ LF L +LDL EN LQ + F LK L L+ N++ I E ++ H LR R+ SN L C+CHL WL+ +L+ + I C P L + ++ + EF C+ + C CP C+CS +GIV+C GK LT IP +LP E+ L+ N I + G S Y+ L++I L+ N + +I P AF GL+ L +L L N + + R F GL +L L L+ N+I C+ F+ ++ L LL L +NK+ +L + L ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+++ D H + C V CPHKC C + +V CSG+ LS +PE+I STT L L++N+I L+ + S+L K++LSNN++ I+ TF +T + E++L++N+L+ C++N++F L + +L L DNHI+ I +F L L L N +C+C+L WL +W R + G+ P CQ+P L+ PL ++ F CE +EE + C P+CP +C C T + CS L+ +P IP N TELYLD N TL L+ + LS N I+ ++ T + L TL+LS+N LQCI AF+ L +L++L L NDVST+ F D+T+L+++A+G NP +CDC+++WL+ + + + GI+ CA P M+ K + + +F C + + AKCD C+ +PCQN G C Y C CP+ + G++CE +++C PC NGG C + + C CPSGF G C N DDC H C NG CVD + Y+C+CP + G+ CE +C D NPC++ C +C C G+ G NC +N DDCK + C+N A+C D +N Y C+C GY G CE P + C EC N CV++ + C+C PG+ GP C+ L S+ F +D++++ P+ NI+L+ T +G++LY G D ++ V L++GH+++SY+ G +S + +ND + H + + + + + ++G T+ K+ N L ++GG P + + A + N + F GCI +L IN + DF+K K V PGC + A P Q ++ P K + K +C++ G + +G C R CVC GF G C++ S+C G R F + + C + + + C+G C CCQ + K+ F+C +G + V P C C
Sbjct: 34 CPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAAQVPACTLSSGSCPAMCSCS-NGIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETT-GARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSGLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGATSVSELHLTANQLESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGN---PRCQNPDFLRQIPLQDVAFPDFRCE---EGQEE----------------VGCLPRPQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF-TLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPEMEGKLLLTTPAKKFEC-QGPPSLAVQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRNCEVSLDSCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGLTCGMNTDDCVKHDCVNGGVCVDGIGNYTCQCPLQYTGRACEQLVDFCSPDLNPCQHEAQCVGTPEGP-RCECVPGYTGDNCSKNQDDCKDHQCQNGAQCVDEINSYACLCAEGYSGQLCEIPP------------------------------APRNSCEGTECQNGANCVDQG---SRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPGSYPSSAI-YSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDNFGKHYTLNSEAPL----YVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHGHKCVHGKCVPLDALAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQA--SATRGAHCVCSPGFSGELCEQE-SECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGACPGQG--------------------CCQGLRLKRRKLTFECSDGTSFAEEVEKPTKCGC 1527
BLAST of slit vs. Smed Unigenes AA
Match: SMU15036778 (dd_smedV4_12111_0_1|m.4973|m.1592)

HSP 1 Score: 2139.77 bits (5543), Expect = 0
Identity = 1091/1537 (70.98%), Postives = 1293/1537 (84.12%), Query Frame = 2
Query:    8 MQFIFKDITXXXXXXXXXXXXXXXXTIWINDPSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANE-----ENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL--DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNK-QKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQ---ELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNC 4585
M FIFKDIT+K L+LL SLYCFSSTIWINDPS+E EICP GCQCEN+SVECKHRLF NVP IL EKTTRLNLLGNRI+VIRKSDF KLN LKVLQLSNNRI+SIE GAFDNL+NLIKLRLNRNLIQ+LPD LFSKL+KLQKLDLR+NQLQC+N+++F+KLGMLK LLLEGNK++WISEAI+KLKHL+ELRI NKL+CNCHL WLN FLK KS+I KP SV+C TP RLS IPIS+LS++EFQCA+E EN C D+KVC K+C CS DGIV C GK+L+NIPQDLPTN +ELDL++N+ITIL+QG+LSKYK LKKIILT+NGMVDIEPGAF+GL QLT++YLN NNL+TIR+NAF GL SLMFLYL N+IECLP T E KRL+LLHLSENKL++LK+E +P + LRYLYLVHNPL CDC++ W+V +K KE N TPVA+C+ P + G +++LQ YNFQCN E + KY+THDE CVPKV CP KC+CSS++VNCS GL SLPE IFPST TLI+SHN++K L IYS+H+A NL+KLDLS NQIE ++PD F++S+KL+EINL+SN+LKC+NNETFK+L ELEILQL++N ISCI T+SFK N NLKYLMLN N+ HCDC+LKW+SEWSRN+Y +LG+ RLPTCQSP ILK TP+ +LD+KYF+C+GN S SC + N +CC + +C K KCPSKCKCEST++DCS+LQLKEIP EIP +TTELYLDRN L++LNE+SFKNL+NLKTLVLSYNGITE+NK+VLTPLK+LETLVLSFNKLQCIHQDAFK+L NLKVLILQSNDVSTIP+QAF DL NLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPE+MKLKSIYHSKPT+FICSEETED YITAKCD+CMK PC++NGKCSLITHH+Y CDCP PFHGK+C+KRINACFGQPCRNGGICKN DN+GNYECVCP GFRGPKCT N+DDC G+ C NGATC D N YSCKC +GFRGK+C+ KFLYC+D NPC+NSG C+ L NNDYKC C+KGWEGK CE+N DDCKYN CK+E++C DL N YKC+CRPGY+G +CE PAWKP LKT +SRRDI++SE++ NEVISESVCAYHECLNNG+C+N D NK QKSYCKCKPGYSG CQYLNS+YF K+S+IEI PPSRGFLMP+GNISL F+TNSSSGLILYQG +++YLVVNL++GH++ISYN+GDK +GP+G+SM +VND++LH L+IEIVGENLTMYLNG+VH TLKSKYL +N+YMALDTGIFIGGAP KIL +AI H + DS+F GC+ESLLINRKKIDFSKY+ KS+NV PGCG LIS ++PS P + I ++TK P + +C +PG+C N GVC + +K++C+CKNGFVGRKCKKR S CHG T + I DPD+ C SI++FQYR+C GTCS +RMQ+D +NFY + D S S CCQP+KY+TH+IQFKC+NGR YRR+ LP++CKC NC
Sbjct: 1 MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETN-TPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTCCSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQSEMTYENLE-NEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGCGKLISTVVASDLKIPSIMQPIKQILT--QTTKKKP--NNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANC 1531

HSP 2 Score: 2139.77 bits (5543), Expect = 0
Identity = 1091/1537 (70.98%), Postives = 1293/1537 (84.12%), Query Frame = -2
Query: 5046 MQFIFKDITXXXXXXXXXXXXXXXSTIWINDPSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANE-----ENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL--DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNK-QKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQ---ELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNC 9623
M FIFKDIT+K L+LL SLYCFSSTIWINDPS+E EICP GCQCEN+SVECKHRLF NVP IL EKTTRLNLLGNRI+VIRKSDF KLN LKVLQLSNNRI+SIE GAFDNL+NLIKLRLNRNLIQ+LPD LFSKL+KLQKLDLR+NQLQC+N+++F+KLGMLK LLLEGNK++WISEAI+KLKHL+ELRI NKL+CNCHL WLN FLK KS+I KP SV+C TP RLS IPIS+LS++EFQCA+E EN C D+KVC K+C CS DGIV C GK+L+NIPQDLPTN +ELDL++N+ITIL+QG+LSKYK LKKIILT+NGMVDIEPGAF+GL QLT++YLN NNL+TIR+NAF GL SLMFLYL N+IECLP T E KRL+LLHLSENKL++LK+E +P + LRYLYLVHNPL CDC++ W+V +K KE N TPVA+C+ P + G +++LQ YNFQCN E + KY+THDE CVPKV CP KC+CSS++VNCS GL SLPE IFPST TLI+SHN++K L IYS+H+A NL+KLDLS NQIE ++PD F++S+KL+EINL+SN+LKC+NNETFK+L ELEILQL++N ISCI T+SFK N NLKYLMLN N+ HCDC+LKW+SEWSRN+Y +LG+ RLPTCQSP ILK TP+ +LD+KYF+C+GN S SC + N +CC + +C K KCPSKCKCEST++DCS+LQLKEIP EIP +TTELYLDRN L++LNE+SFKNL+NLKTLVLSYNGITE+NK+VLTPLK+LETLVLSFNKLQCIHQDAFK+L NLKVLILQSNDVSTIP+QAF DL NLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPE+MKLKSIYHSKPT+FICSEETED YITAKCD+CMK PC++NGKCSLITHH+Y CDCP PFHGK+C+KRINACFGQPCRNGGICKN DN+GNYECVCP GFRGPKCT N+DDC G+ C NGATC D N YSCKC +GFRGK+C+ KFLYC+D NPC+NSG C+ L NNDYKC C+KGWEGK CE+N DDCKYN CK+E++C DL N YKC+CRPGY+G +CE PAWKP LKT +SRRDI++SE++ NEVISESVCAYHECLNNG+C+N D NK QKSYCKCKPGYSG CQYLNS+YF K+S+IEI PPSRGFLMP+GNISL F+TNSSSGLILYQG +++YLVVNL++GH++ISYN+GDK +GP+G+SM +VND++LH L+IEIVGENLTMYLNG+VH TLKSKYL +N+YMALDTGIFIGGAP KIL +AI H + DS+F GC+ESLLINRKKIDFSKY+ KS+NV PGCG LIS ++PS P + I ++TK P + +C +PG+C N GVC + +K++C+CKNGFVGRKCKKR S CHG T + I DPD+ C SI++FQYR+C GTCS +RMQ+D +NFY + D S S CCQP+KY+TH+IQFKC+NGR YRR+ LP++CKC NC
Sbjct: 1 MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETN-TPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTCCSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQSEMTYENLE-NEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGCGKLISTVVASDLKIPSIMQPIKQILT--QTTKKKP--NNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANC 1531
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006317 (SmedAsxldir_c107934_g5_i1|m.86273|m.14433)

HSP 1 Score: 143.28 bits (360), Expect = 1.97303e-33
Identity = 82/190 (43.16%), Postives = 107/190 (56.32%), Query Frame = 2
Query: 2720 CMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE 3289
C PC+N G C DY C C N + GK+C+ N C PC+N G C++ N+ +Y+C+C GF G C +ID+C C NG +C++ + C C GF G CE C +K PC+N+ C L NNDY C C +G GKNCE NID+C N C N A+CED V G+ C C G+VG CE
Sbjct: 256 CELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESV-NYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENK-PCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE 441

HSP 2 Score: 143.28 bits (360), Expect = 1.97303e-33
Identity = 82/190 (43.16%), Postives = 107/190 (56.32%), Query Frame = -2
Query: 6342 CMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE 6911
C PC+N G C DY C C N + GK+C+ N C PC+N G C++ N+ +Y+C+C GF G C +ID+C C NG +C++ + C C GF G CE C +K PC+N+ C L NNDY C C +G GKNCE NID+C N C N A+CED V G+ C C G+VG CE
Sbjct: 256 CELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESV-NYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENK-PCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE 441

HSP 3 Score: 135.961 bits (341), Expect = 3.3491e-31
Identity = 101/307 (32.90%), Postives = 142/307 (46.25%), Query Frame = 2
Query: 2726 KTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINAC--FGQP-CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-------------------------------------NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE----EPAWKPYKLKTNLSRRDIDRS-EVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 3511
+ PC NGKC L + C C + G +C I+ C + P C NGG C NT G+Y+C C +GF G +C +I DC C+NG TC+D++ Y C CPN + G CE+K C K NPC+N+G CE ++ DYKC C +G+EGK CE +ID+C+ C N C +++ G KC C PG+ G CE E KP + + D + + + T N I+ C + CLN C ED + C+C G+ G C+
Sbjct: 140 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINT--VGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC--EDRVGGFT-CQCLQGFVGLRCE 441

HSP 4 Score: 135.961 bits (341), Expect = 3.3491e-31
Identity = 101/307 (32.90%), Postives = 142/307 (46.25%), Query Frame = -2
Query: 6120 KTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINAC--FGQP-CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-------------------------------------NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE----EPAWKPYKLKTNLSRRDIDRS-EVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 6905
+ PC NGKC L + C C + G +C I+ C + P C NGG C NT G+Y+C C +GF G +C +I DC C+NG TC+D++ Y C CPN + G CE+K C K NPC+N+G CE ++ DYKC C +G+EGK CE +ID+C+ C N C +++ G KC C PG+ G CE E KP + + D + + + T N I+ C + CLN C ED + C+C G+ G C+
Sbjct: 140 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINT--VGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC--EDRVGGFT-CQCLQGFVGLRCE 441

HSP 5 Score: 127.102 bits (318), Expect = 1.66518e-28
Identity = 98/318 (30.82%), Postives = 136/318 (42.77%), Query Frame = 2
Query: 2669 ICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCEN--------------------------------------SGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFC 3508
IC E + D C K C N G C + C+C F G +CE +N C +PC+N C + +N +Y C CP G G C NID+C + C NGA C D+V ++C+C GF G CE+K C PC+ +G C + NN+ KC C G+EG+ CE I++C N C++ ++C+DL N Y CIC PG+ G CE +INE CA++ C NG C++E + C+C YSGP C
Sbjct: 316 ICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGK-CNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDV-NNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCE---------------------------ININE------CAHNPCGLNGQCIDEVYGFR---CQCMLPYSGPTC 593

HSP 6 Score: 127.102 bits (318), Expect = 1.66518e-28
Identity = 98/318 (30.82%), Postives = 136/318 (42.77%), Query Frame = -2
Query: 6123 ICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCEN--------------------------------------SGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFC 6962
IC E + D C K C N G C + C+C F G +CE +N C +PC+N C + +N +Y C CP G G C NID+C + C NGA C D+V ++C+C GF G CE+K C PC+ +G C + NN+ KC C G+EG+ CE I++C N C++ ++C+DL N Y CIC PG+ G CE +INE CA++ C NG C++E + C+C YSGP C
Sbjct: 316 ICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGK-CNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDV-NNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCE---------------------------ININE------CAHNPCGLNGQCIDEVYGFR---CQCMLPYSGPTC 593

HSP 7 Score: 108.612 bits (270), Expect = 6.09202e-23
Identity = 86/264 (32.58%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 2732 PCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNND----YKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 3511
PC+N C + + C C F G+ CE IN C PC N C D+ +Y+C+C SGF G C N +DC C CVD+VN + CKC + G CE C D NPC N G C N Y C+C +G+ G CE +D C+ N C + C+ ++ +KC C Y+G CE + + + +S + F NE + +C +H G C N D C C+ GY G FC+
Sbjct: 705 PCRNGATCDNLA-DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPC-DSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCE------------IKKTETCKSYAVEKFK--NESLINKICKHH-----GNCFN-DPETGGFKCSCQSGYGGSFCE 944

HSP 8 Score: 108.612 bits (270), Expect = 6.09202e-23
Identity = 86/264 (32.58%), Postives = 119/264 (45.08%), Query Frame = -2
Query: 6120 PCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNND----YKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 6899
PC+N C + + C C F G+ CE IN C PC N C D+ +Y+C+C SGF G C N +DC C CVD+VN + CKC + G CE C D NPC N G C N Y C+C +G+ G CE +D C+ N C + C+ ++ +KC C Y+G CE + + + +S + F NE + +C +H G C N D C C+ GY G FC+
Sbjct: 705 PCRNGATCDNLA-DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPC-DSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCE------------IKKTETCKSYAVEKFK--NESLINKICKHH-----GNCFN-DPETGGFKCSCQSGYGGSFCE 944

HSP 9 Score: 107.457 bits (267), Expect = 1.44695e-22
Identity = 83/308 (26.95%), Postives = 139/308 (45.13%), Query Frame = 2
Query: 2714 DACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSG---FRGPKCTENIDDCGGHK--------------------CENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVIS-----------------ESVCAYHECLNNGVCVNEDMNKQKS--YCKCKPGYSGPFCQ 3511
+ C PC NG+C + + + C C P+ G +C +++ C C N IC + + +Y C C + + G KC +++D+C + C N C++ + CKC + + G+ CE K L NPC N C+ L++ ++C C G+ G+ CE I++C++N C N+AKC D +N Y+CIC+ G+ G CE ++ D S H +++V + C + CLN G C+N +N+ C C+ G++GP C+
Sbjct: 560 NECAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCE-KPLNNCRNNPCRNGATCDNLADG-FRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE------------INDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE 852

HSP 10 Score: 107.457 bits (267), Expect = 1.44695e-22
Identity = 83/308 (26.95%), Postives = 139/308 (45.13%), Query Frame = -2
Query: 6120 DACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSG---FRGPKCTENIDDCGGHK--------------------CENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVIS-----------------ESVCAYHECLNNGVCVNEDMNKQKS--YCKCKPGYSGPFCQ 6917
+ C PC NG+C + + + C C P+ G +C +++ C C N IC + + +Y C C + + G KC +++D+C + C N C++ + CKC + + G+ CE K L NPC N C+ L++ ++C C G+ G+ CE I++C++N C N+AKC D +N Y+CIC+ G+ G CE ++ D S H +++V + C + CLN G C+N +N+ C C+ G++GP C+
Sbjct: 560 NECAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCE-KPLNNCRNNPCRNGATCDNLADG-FRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE------------INDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE 852

HSP 11 Score: 107.071 bits (266), Expect = 1.83055e-22
Identity = 95/324 (29.32%), Postives = 130/324 (40.12%), Query Frame = 2
Query: 2672 CSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-------------HDKNPCENSGHCEPLSN-NDYKCSCTKGWEGKNCEQNIDDCKY------------NVCKNEAKCEDLVN-GYKCICRPGYVGTYCEEPAWK-------------PYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNS 3523
C ++ D C PC N G+C T Y C C F G +C+ N C+ C G K D N+ CVCP G G C +D C +C+NG C + + + C CP GF GK CE+ C + PC +G E L + CSC K + GK CE ID C+ +C N+ + E N + CIC GY G C+ + K P+++ +S + S V F I+ V + C +C NNG CVN K+ C C G G C+ S
Sbjct: 934 CQSGYGGSFCEVNIDDCASQPCINGGECGDGTGM-YFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYV---NECLSTKCYNNGSCVN---GFGKAICHCNKGSCGEKCEITGS 1247

HSP 12 Score: 107.071 bits (266), Expect = 1.83055e-22
Identity = 95/324 (29.32%), Postives = 130/324 (40.12%), Query Frame = -2
Query: 6108 CSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-------------HDKNPCENSGHCEPLSN-NDYKCSCTKGWEGKNCEQNIDDCKY------------NVCKNEAKCEDLVN-GYKCICRPGYVGTYCEEPAWK-------------PYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNS 6959
C ++ D C PC N G+C T Y C C F G +C+ N C+ C G K D N+ CVCP G G C +D C +C+NG C + + + C CP GF GK CE+ C + PC +G E L + CSC K + GK CE ID C+ +C N+ + E N + CIC GY G C+ + K P+++ +S + S V F I+ V + C +C NNG CVN K+ C C G G C+ S
Sbjct: 934 CQSGYGGSFCEVNIDDCASQPCINGGECGDGTGM-YFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYV---NECLSTKCYNNGSCVN---GFGKAICHCNKGSCGEKCEITGS 1247

HSP 13 Score: 105.916 bits (263), Expect = 3.64477e-22
Identity = 92/318 (28.93%), Postives = 130/318 (40.88%), Query Frame = 2
Query: 2699 ITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVD-QVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNID-----------------------------------------DCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEP----AWKPYKLKTNLSRRDIDRSEV-SKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 3511
I + C C+N C + Y+C+C + G CE++ N C PC+NGG CK GNY C C + + G C E +C C NG C +++KY C+CP + G CE C +NPC +G C ++ + KC C KG+ G C +ID DC + CKN C D + Y+C+C Y GT CE KP K D D + +T N ++ C + C NNG C E +N Q C C+ G+ G +C+
Sbjct: 17 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI--AGNYVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPN-SCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFC--ESVNYQDYKCICQRGFEGKWCE 327

HSP 14 Score: 105.916 bits (263), Expect = 3.64477e-22
Identity = 92/318 (28.93%), Postives = 130/318 (40.88%), Query Frame = -2
Query: 6120 ITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVD-QVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNID-----------------------------------------DCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEP----AWKPYKLKTNLSRRDIDRSEV-SKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 6932
I + C C+N C + Y+C+C + G CE++ N C PC+NGG CK GNY C C + + G C E +C C NG C +++KY C+CP + G CE C +NPC +G C ++ + KC C KG+ G C +ID DC + CKN C D + Y+C+C Y GT CE KP K D D + +T N ++ C + C NNG C E +N Q C C+ G+ G +C+
Sbjct: 17 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI--AGNYVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPN-SCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFC--ESVNYQDYKCICQRGFEGKWCE 327

HSP 15 Score: 99.7525 bits (247), Expect = 2.53231e-20
Identity = 123/452 (27.21%), Postives = 175/452 (38.72%), Query Frame = 2
Query: 2324 EINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQ-----NPFHCDCNIKWL--NQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFI-CSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCE-KRINAC-------------FGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEP--------AWKPYKLKTN-------------LSRRDIDRSEVSKHFTSINEVISESVCAYHE---------CLNNGVCVNEDMNK-QKSY---CKCKPGYSGPFCQ 3511
EIN+ P N + N QCI Q F + + ND D T + + GQ N F C CN ++ N L R D+ + C + + + + P C K D C PC + G C + C C + + G+ CE K+ C + C++ G C N G ++C C SG+ G C NIDDC C NG C D Y CKC GF+G C+ C+ N C N+G C NN + C C +G G+ CE +D CK C+N C++++ ++C C G+ G CE A L +N L R K+FT E+ Y E C NNG+C+N+ N+ ++Y C C GY G C+
Sbjct: 735 EINECQHNPCSNDAKCIDHINDYQCICQSGFSGKN------CEIND---------NDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDS--NPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCK-TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECY-SNSC-NTGKCIDQINN-FSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTG---KYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCK 1162

HSP 16 Score: 99.7525 bits (247), Expect = 2.53231e-20
Identity = 123/452 (27.21%), Postives = 175/452 (38.72%), Query Frame = -2
Query: 6120 EINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQ-----NPFHCDCNIKWL--NQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFI-CSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCE-KRINAC-------------FGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEP--------AWKPYKLKTN-------------LSRRDIDRSEVSKHFTSINEVISESVCAYHE---------CLNNGVCVNEDMNK-QKSY---CKCKPGYSGPFCQ 7307
EIN+ P N + N QCI Q F + + ND D T + + GQ N F C CN ++ N L R D+ + C + + + + P C K D C PC + G C + C C + + G+ CE K+ C + C++ G C N G ++C C SG+ G C NIDDC C NG C D Y CKC GF+G C+ C+ N C N+G C NN + C C +G G+ CE +D CK C+N C++++ ++C C G+ G CE A L +N L R K+FT E+ Y E C NNG+C+N+ N+ ++Y C C GY G C+
Sbjct: 735 EINECQHNPCSNDAKCIDHINDYQCICQSGFSGKN------CEIND---------NDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDS--NPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCK-TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECY-SNSC-NTGKCIDQINN-FSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTG---KYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCK 1162
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006140 (SmedAsxldir_c107649_g2_i1|m.84323|m.17798)

HSP 1 Score: 129.798 bits (325), Expect = 1.77737e-29
Identity = 104/336 (30.95%), Postives = 144/336 (42.86%), Query Frame = 2
Query: 2669 ICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK----------------------NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDI---DRSEVSKHFT---------SINEVISESVCAYHECLNNGVCVN-EDMNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSR 3571
+C Y + + C+ PC+NNG C+ + +DY C+C F GK+CE I AC QPC+NGG+C+ D Y C C +G+ G C C + C NGA C + C C F GK CE YC ++ N C G C + C C G+EG +CE +IDDCK N CKN C D +N ++CIC G+ G CEE Y +K+ + E+ F + + S+C + CLN G C +N + C C G+ G CQ+L HI+ P R
Sbjct: 453 LCQPGYTGKYCDKEINECVPNPCKNNGVCT-DSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDT--GYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERT--DYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ--CHCNQGWIGTVCQFL---------HIDFQPCRR 771

HSP 2 Score: 129.798 bits (325), Expect = 1.77737e-29
Identity = 104/336 (30.95%), Postives = 144/336 (42.86%), Query Frame = -2
Query: 6060 ICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK----------------------NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDI---DRSEVSKHFT---------SINEVISESVCAYHECLNNGVCVN-EDMNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSR 6962
+C Y + + C+ PC+NNG C+ + +DY C+C F GK+CE I AC QPC+NGG+C+ D Y C C +G+ G C C + C NGA C + C C F GK CE YC ++ N C G C + C C G+EG +CE +IDDCK N CKN C D +N ++CIC G+ G CEE Y +K+ + E+ F + + S+C + CLN G C +N + C C G+ G CQ+L HI+ P R
Sbjct: 453 LCQPGYTGKYCDKEINECVPNPCKNNGVCT-DSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDT--GYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERT--DYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ--CHCNQGWIGTVCQFL---------HIDFQPCRR 771

HSP 3 Score: 113.62 bits (283), Expect = 1.46227e-24
Identity = 81/280 (28.93%), Postives = 134/280 (47.86%), Query Frame = 2
Query: 2534 FHCDCNIKWLNQ-------FFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKC-------------DACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC-KNTDN-FGNYECVCPSGFRGPKC-TENIDDCGGHKCENGATC--VDQVNKYSCKCPNGFRGKFCES---KFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE 3289
F+C CN ++ + + + ++ C+ P+ + I H+ ++ E +C D C PC+N G C + + +++ C C N F GK+CE+R + C PC N G+C +++D + ++ C C + + G C C + C NG +C + +N + C C G+ G C+ F C KN C+N G C + ND+ C C G+EGK+C+ N ++C N C N KC D +N Y+CIC G+ G+ C+
Sbjct: 563 FYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC-IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQ 841

HSP 4 Score: 113.62 bits (283), Expect = 1.46227e-24
Identity = 81/280 (28.93%), Postives = 134/280 (47.86%), Query Frame = -2
Query: 6342 FHCDCNIKWLNQ-------FFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKC-------------DACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC-KNTDN-FGNYECVCPSGFRGPKC-TENIDDCGGHKCENGATC--VDQVNKYSCKCPNGFRGKFCES---KFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE 7097
F+C CN ++ + + + ++ C+ P+ + I H+ ++ E +C D C PC+N G C + + +++ C C N F GK+CE+R + C PC N G+C +++D + ++ C C + + G C C + C NG +C + +N + C C G+ G C+ F C KN C+N G C + ND+ C C G+EGK+C+ N ++C N C N KC D +N Y+CIC G+ G+ C+
Sbjct: 563 FYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC-IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQ 841

HSP 5 Score: 108.612 bits (270), Expect = 4.36083e-23
Identity = 100/351 (28.49%), Postives = 144/351 (41.03%), Query Frame = 2
Query: 2525 QNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMK-----TPCQNNGKCS--LITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATC-VDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSG-------HCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE-EPAWKPYKLKTNLSRRDIDRSEVSK---HFTSINEVISESVCAYHECLNNGVC--VNEDMNKQKSYCKCKPGYSGPFCQY 3514
+NP C C W F E MK H + + E+ + CD + PC+N G C L Y C CP+ F G+ CE I+ CF PC+ G K+ G + C C + G C ++ C + C+NG C D+ C C G++G CH PCENS + + DYKC C G+ GK C++ I++C N CKN C D +N YKC C + G CE A + K +++D K +T N I ++ C+ + CLN C +N+D YC C + G C++
Sbjct: 259 ENPGECRCRAGWQGTF--------------CDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSK---GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGS-------ECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDF-----YCHCNKEFWGKRCEH 578

HSP 6 Score: 108.612 bits (270), Expect = 4.36083e-23
Identity = 100/351 (28.49%), Postives = 144/351 (41.03%), Query Frame = -2
Query: 6117 QNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMK-----TPCQNNGKCS--LITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATC-VDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSG-------HCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCE-EPAWKPYKLKTNLSRRDIDRSEVSK---HFTSINEVISESVCAYHECLNNGVC--VNEDMNKQKSYCKCKPGYSGPFCQY 7106
+NP C C W F E MK H + + E+ + CD + PC+N G C L Y C CP+ F G+ CE I+ CF PC+ G K+ G + C C + G C ++ C + C+NG C D+ C C G++G CH PCENS + + DYKC C G+ GK C++ I++C N CKN C D +N YKC C + G CE A + K +++D K +T N I ++ C+ + CLN C +N+D YC C + G C++
Sbjct: 259 ENPGECRCRAGWQGTF--------------CDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSK---GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGS-------ECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDF-----YCHCNKEFWGKRCEH 578

HSP 7 Score: 107.842 bits (268), Expect = 8.00969e-23
Identity = 96/372 (25.81%), Postives = 154/372 (41.40%), Query Frame = 2
Query: 2528 NPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHS-----KPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDN---------------------------------------FGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 3511
+P+ C C W QF D ++ CA K I + +P + IC E + D C PC+ G C + + ++ C C + GK C++ + C C+NGG C +N G+Y+C+C G+ G C + I++C + C+N C D +N Y C C F+GK CE + C ++ PC+N G C+ + + Y C C G+ G NCE C N C N A C + + C C + G CE +PY + E + S+ ++++ S ++ C G C++ + K+K C+C PG+ G C+
Sbjct: 292 SPWTCSCENNWGGQF-----CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGR--DCEIDPCFPNPCKK-GTC-MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELN-IACQNQ-PCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHS--RPYCGN--------ESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHE--KEKFICRCMPGFEGDSCE 639

HSP 8 Score: 107.842 bits (268), Expect = 8.00969e-23
Identity = 96/372 (25.81%), Postives = 154/372 (41.40%), Query Frame = -2
Query: 6120 NPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHS-----KPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDN---------------------------------------FGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 7103
+P+ C C W QF D ++ CA K I + +P + IC E + D C PC+ G C + + ++ C C + GK C++ + C C+NGG C +N G+Y+C+C G+ G C + I++C + C+N C D +N Y C C F+GK CE + C ++ PC+N G C+ + + Y C C G+ G NCE C N C N A C + + C C + G CE +PY + E + S+ ++++ S ++ C G C++ + K+K C+C PG+ G C+
Sbjct: 292 SPWTCSCENNWGGQF-----CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGR--DCEIDPCFPNPCKK-GTC-MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELN-IACQNQ-PCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHS--RPYCGN--------ESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHE--KEKFICRCMPGFEGDSCE 639

HSP 9 Score: 104.375 bits (259), Expect = 9.58634e-22
Identity = 93/294 (31.63%), Postives = 121/294 (41.16%), Query Frame = 2
Query: 2717 ACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNG-------------GICKN-TDNFGN--------YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSN---NDYKCSCTKGWEGKNCE-QNIDDCKYNVCKNEAKCEDL--VNGYKCICRPGYVGTYCE--EPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFC 3508
C PC N C I + D+ C C F GK CE C + C + GI N +G + C C GF G C +IDDC + C+NG C+D +N + C C NGF GK CE + YC K+PC N G C S+ ND+ C C W G+ C C N C N C L +NG++C C G++GT C+ ++P + K NL C N GVC+N N C CKPG+ G C
Sbjct: 544 GCSPNPCLNGAYCYTI-NQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYC-IKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRK-NL------------------------------CKNEGVCINVGYNDFT--CHCKPGFEGKHC 802

HSP 10 Score: 104.375 bits (259), Expect = 9.58634e-22
Identity = 93/294 (31.63%), Postives = 121/294 (41.16%), Query Frame = -2
Query: 6123 ACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNG-------------GICKN-TDNFGN--------YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSN---NDYKCSCTKGWEGKNCE-QNIDDCKYNVCKNEAKCEDL--VNGYKCICRPGYVGTYCE--EPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFC 6914
C PC N C I + D+ C C F GK CE C + C + GI N +G + C C GF G C +IDDC + C+NG C+D +N + C C NGF GK CE + YC K+PC N G C S+ ND+ C C W G+ C C N C N C L +NG++C C G++GT C+ ++P + K NL C N GVC+N N C CKPG+ G C
Sbjct: 544 GCSPNPCLNGAYCYTI-NQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYC-IKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRK-NL------------------------------CKNEGVCINVGYNDFT--CHCKPGFEGKHC 802

HSP 11 Score: 95.1301 bits (235), Expect = 5.65822e-19
Identity = 73/220 (33.18%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 2663 EFICSEETEDTYITAKCDACMKTPCQNNGKC---SLITHHDYICDCPNPFHGKSCE-KRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCT-ENIDDCGGHK---CENGATCVD-QVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHC-EPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEE 3292
E IC + D C+K+PC N G C S ++D+IC+C N + G+ C + + C PC NGG C ++C C G+ G C +ID + C+N C++ N ++C C GF GK C+ C + NPC N G C + L N Y+C C KG+ G NC+ N D+C C A C D ++ ++C C G G C+
Sbjct: 664 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNEC-NPNPCFNGGKCIDKL--NSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDH 880

HSP 12 Score: 95.1301 bits (235), Expect = 5.65822e-19
Identity = 73/220 (33.18%), Postives = 106/220 (48.18%), Query Frame = -2
Query: 6339 EFICSEETEDTYITAKCDACMKTPCQNNGKC---SLITHHDYICDCPNPFHGKSCE-KRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCT-ENIDDCGGHK---CENGATCVD-QVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHC-EPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEE 6968
E IC + D C+K+PC N G C S ++D+IC+C N + G+ C + + C PC NGG C ++C C G+ G C +ID + C+N C++ N ++C C GF GK C+ C + NPC N G C + L N Y+C C KG+ G NC+ N D+C C A C D ++ ++C C G G C+
Sbjct: 664 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNEC-NPNPCFNGGKCIDKL--NSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDH 880
BLAST of slit vs. Smed Unigenes AA
Match: SMU15037114 (dd_smedV4_13823_0_1|m.8312|m.39635)

HSP 1 Score: 127.487 bits (319), Expect = 7.39211e-29
Identity = 101/369 (27.37%), Postives = 150/369 (40.65%), Query Frame = 2
Query: 2531 PFHCDCNIKWLNQF--FLDRFLDNGISLCASP-ERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSL-ITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNV-CKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSY--------------CKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFL 3580
P C+C KW F + N ++C + E + +I ++ IC + + C+ C N GKC + + + YICDCP F+G C+ +C PC C TD ++C CP GF G C + D+C C NG C+D+ + + C CP GF G C+ C K C N C +N C CT GW G+ C QNI++C N C N C D Y+C C+ + G +C P +IN + E C + C N+G+C+ + + CKC PG++G C+ + + E + GFL
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQ-KLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVP----------------------NINYL--ERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFL 666

HSP 2 Score: 127.487 bits (319), Expect = 7.39211e-29
Identity = 101/369 (27.37%), Postives = 150/369 (40.65%), Query Frame = -2
Query: 6051 PFHCDCNIKWLNQF--FLDRFLDNGISLCASP-ERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSL-ITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNV-CKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSY--------------CKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFL 7100
P C+C KW F + N ++C + E + +I ++ IC + + C+ C N GKC + + + YICDCP F+G C+ +C PC C TD ++C CP GF G C + D+C C NG C+D+ + + C CP GF G C+ C K C N C +N C CT GW G+ C QNI++C N C N C D Y+C C+ + G +C P +IN + E C + C N+G+C+ + + CKC PG++G C+ + + E + GFL
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQ-KLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVP----------------------NINYL--ERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFL 666

HSP 3 Score: 68.1662 bits (165), Expect = 8.31556e-11
Identity = 80/291 (27.49%), Postives = 118/291 (40.55%), Query Frame = 2
Query: 2696 YITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNK----YSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPL----SNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNG--YKCICRPGYVGTYCE--------EPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 3511
Y +CD K G + ++ D IC + G C+K + C + C NG G +C C +G+ G C + I G C +G D+ K +C C + G FC YC ++ N CEN G C +N Y+C C G++G +CE+ +C N C N KC+ VN Y C C + G C+ P + T+ + + + F N I E C+ CLN G+C++ C C G+SG CQ
Sbjct: 231 YHGEECDKLCKPSANERGFYNCSSNGDRICH--TGYSGSYCDKVV--CLKK-CINGAC------VGPNQCRCQTGWTGDSCDQCIPYPG---CVHGGCRFDERTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITD--KTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDR---PSGFLCVCPVGFSGDRCQ 502

HSP 4 Score: 68.1662 bits (165), Expect = 8.31556e-11
Identity = 80/291 (27.49%), Postives = 118/291 (40.55%), Query Frame = -2
Query: 6120 YITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNK----YSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPL----SNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNG--YKCICRPGYVGTYCE--------EPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 6935
Y +CD K G + ++ D IC + G C+K + C + C NG G +C C +G+ G C + I G C +G D+ K +C C + G FC YC ++ N CEN G C +N Y+C C G++G +CE+ +C N C N KC+ VN Y C C + G C+ P + T+ + + + F N I E C+ CLN G+C++ C C G+SG CQ
Sbjct: 231 YHGEECDKLCKPSANERGFYNCSSNGDRICH--TGYSGSYCDKVV--CLKK-CINGAC------VGPNQCRCQTGWTGDSCDQCIPYPG---CVHGGCRFDERTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITD--KTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDR---PSGFLCVCPVGFSGDRCQ 502
BLAST of slit vs. Smed Unigenes AA
Match: SMU15036138 (SmedSxlregen_c89796_g1_i1|m.42552|m.12127)

HSP 1 Score: 108.612 bits (270), Expect = 1.47372e-23
Identity = 91/294 (30.95%), Postives = 124/294 (42.18%), Query Frame = 2
Query: 2696 YITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCV--DQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLV--------NGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECL------NNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLY 3529
++ CD + +PC NN C + + + C C FHGK CE + C PC N G C + G + C+CP + G C NI C KCENG +C D CKC GF G CE+ C +N C G C N+ +C C + G+ CE+ + DC+ N C N C +V C+C G+ G +CE + L +R K++ C C+ N GVCV+ + K CKC P G FCQY N Y
Sbjct: 280 FVKTTCD--LLSPCFNNATCVNLEYDSFKCQCLRGFHGKRCEIP-DHCVDNPCLNDGTCISKK--GRFYCMCPGEYSGRNCELNISKCP--KCENGGSCFTPDMGKNNFCKCLPGFIGHRCETPATKCETENQCLFEGSCFLNIKNEKQCFCPSIFNGRFCEK-LSDCR-NRCLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEFAHFCVQSLSPCKNRGACLILNYDKYYCECQTGFHGEKCEMKNCIKDADCQNGGVCVSGERVK----CKCSPSNIGEFCQYKNECY 560

HSP 2 Score: 108.612 bits (270), Expect = 1.47372e-23
Identity = 91/294 (30.95%), Postives = 124/294 (42.18%), Query Frame = -2
Query: 6102 YITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCV--DQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLV--------NGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECL------NNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLY 6935
++ CD + +PC NN C + + + C C FHGK CE + C PC N G C + G + C+CP + G C NI C KCENG +C D CKC GF G CE+ C +N C G C N+ +C C + G+ CE+ + DC+ N C N C +V C+C G+ G +CE + L +R K++ C C+ N GVCV+ + K CKC P G FCQY N Y
Sbjct: 280 FVKTTCD--LLSPCFNNATCVNLEYDSFKCQCLRGFHGKRCEIP-DHCVDNPCLNDGTCISKK--GRFYCMCPGEYSGRNCELNISKCP--KCENGGSCFTPDMGKNNFCKCLPGFIGHRCETPATKCETENQCLFEGSCFLNIKNEKQCFCPSIFNGRFCEK-LSDCR-NRCLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEFAHFCVQSLSPCKNRGACLILNYDKYYCECQTGFHGEKCEMKNCIKDADCQNGGVCVSGERVK----CKCSPSNIGEFCQYKNECY 560

HSP 3 Score: 72.4034 bits (176), Expect = 3.41657e-12
Identity = 70/211 (33.18%), Postives = 98/211 (46.45%), Query Frame = 2
Query: 2702 TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICK----NTDNFGNYE--CVCPSGFRGPKC------TENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNV-CKNEAKCEDLVNG--YKCICRPGYVGTYCE 3289
KC+ + C G C L ++ C CP+ F+G+ CEK ++ C + C NGG C NT + E C+CP GF G C +++ C GA + +KY C+C GF G+ CE K C C+N G C +S KC C+ G+ C Q ++C NV C KCE V G KC C G++G C+
Sbjct: 397 ATKCET--ENQCLFEGSCFLNIKNEKQCFCPSIFNGRFCEK-LSDCRNR-CLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEFAHFCVQSLSPCKNR----GACLILNYDKYYCECQTGFHGEKCEMK--NCIKDADCQNGGVC--VSGERVKCKCSPSNIGEFC-QYKNECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACD 594

HSP 4 Score: 72.4034 bits (176), Expect = 3.41657e-12
Identity = 70/211 (33.18%), Postives = 98/211 (46.45%), Query Frame = -2
Query: 6342 TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICK----NTDNFGNYE--CVCPSGFRGPKC------TENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNV-CKNEAKCEDLVNG--YKCICRPGYVGTYCE 6929
KC+ + C G C L ++ C CP+ F+G+ CEK ++ C + C NGG C NT + E C+CP GF G C +++ C GA + +KY C+C GF G+ CE K C C+N G C +S KC C+ G+ C Q ++C NV C KCE V G KC C G++G C+
Sbjct: 397 ATKCET--ENQCLFEGSCFLNIKNEKQCFCPSIFNGRFCEK-LSDCRNR-CLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCEFAHFCVQSLSPCKNR----GACLILNYDKYYCECQTGFHGEKCEMK--NCIKDADCQNGGVC--VSGERVKCKCSPSNIGEFC-QYKNECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACD 594

HSP 5 Score: 69.707 bits (169), Expect = 2.40338e-11
Identity = 55/163 (33.74%), Postives = 76/163 (46.63%), Query Frame = 2
Query: 2726 KTPCQNNGKCSLITHH-------DYICDCPNPFHGKSCEKRINACFGQ--PCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDY-KCSCTKGWEGKNCEQNI 3184
+ C N G CSL+ + + +C CP F+G+ CE + C PC+N G C N+ Y C C +GF G KC E + C+NG CV + CKC G+FC+ K C+ C +G CE + KC C +GW GK C+ I
Sbjct: 440 RNRCLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCE-FAHFCVQSLSPCKNRGACL-ILNYDKYYCECQTGFHGEKC-EMKNCIKDADCQNGGVCVSG-ERVKCKCSPSNIGEFCQYK-NECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACDIQI 597

HSP 6 Score: 69.707 bits (169), Expect = 2.40338e-11
Identity = 55/163 (33.74%), Postives = 76/163 (46.63%), Query Frame = -2
Query: 6447 KTPCQNNGKCSLITHH-------DYICDCPNPFHGKSCEKRINACFGQ--PCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDY-KCSCTKGWEGKNCEQNI 6905
+ C N G CSL+ + + +C CP F+G+ CE + C PC+N G C N+ Y C C +GF G KC E + C+NG CV + CKC G+FC+ K C+ C +G CE + KC C +GW GK C+ I
Sbjct: 440 RNRCLNGGFCSLVVFNTTDLPTAEIVCLCPYGFYGRFCE-FAHFCVQSLSPCKNRGACL-ILNYDKYYCECQTGFHGEKC-EMKNCIKDADCQNGGVCVSG-ERVKCKCSPSNIGEFCQYK-NECYKNVQCGTNGKCETDVEGKFLKCKCNEGWLGKACDIQI 597

HSP 7 Score: 61.2326 bits (147), Expect = 9.32978e-09
Identity = 50/182 (27.47%), Postives = 74/182 (40.66%), Query Frame = 2
Query: 2966 HKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 3511
++C + C NK +C C + + G +C+ C +PC N+ C L + +KC C +G+ GK CE D C N C N+ C + C+C Y G CE N+S+ +C N G C DM K ++CKC PG+ G C+
Sbjct: 250 YQCSDRGFCEKDGNKINCLCVSPYYGPYCQFVKTTCDLLSPCFNNATCVNLEYDSFKCQCLRGFHGKRCEIP-DHCVDNPCLNDGTCISKKGRFYCMCPGEYSGRNCE----------LNISK-------------------------CPKCENGGSCFTPDMGKN-NFCKCLPGFIGHRCE 394

HSP 8 Score: 61.2326 bits (147), Expect = 9.32978e-09
Identity = 50/182 (27.47%), Postives = 74/182 (40.66%), Query Frame = -2
Query: 6120 HKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQ 6665
++C + C NK +C C + + G +C+ C +PC N+ C L + +KC C +G+ GK CE D C N C N+ C + C+C Y G CE N+S+ +C N G C DM K ++CKC PG+ G C+
Sbjct: 250 YQCSDRGFCEKDGNKINCLCVSPYYGPYCQFVKTTCDLLSPCFNNATCVNLEYDSFKCQCLRGFHGKRCEIP-DHCVDNPCLNDGTCISKKGRFYCMCPGEYSGRNCE----------LNISK-------------------------CPKCENGGSCFTPDMGKN-NFCKCLPGFIGHRCE 394
BLAST of slit vs. RefSeq Human
Match: gi|11321571|ref|NP_003053.1| (slit homolog 3 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 723.391 bits (1866), Expect = 0
Identity = 488/1580 (30.89%), Postives = 768/1580 (48.61%), Query Frame = 2
Query:  122 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEVP-------------IKSTKSLPVKSTICSKPGVCSNNG---------VCH----EVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 4573
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + + + +C+ P L ++ + E+ C +E +C + CP CTCS + IV+C GK L IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L +P + T L L+ N++ L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C L WL +W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L+ +P +P + TELYL+ N L + L +L + LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG C+ Y C CP + GK C IN C PC++GG C +D+ + + C CP GF G +C N DDC + CEN ATCVD +N Y C CP + G+ C+ +C + N C++ C PL + + C C G+ GK CE + DDC + C++ A+C D +NGY C C G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + + + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + S K +C N CH ++++ Y C+C+ GF G C++ + C G+ R I+ + +C + K C+G C CCQP++ K F+C +G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPY-CLCQPGFSGEHCQQE-NPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQ---------------------CCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 723.391 bits (1866), Expect = 0
Identity = 488/1580 (30.89%), Postives = 768/1580 (48.61%), Query Frame = -2
Query: 5058 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEVP-------------IKSTKSLPVKSTICSKPGVCSNNG---------VCH----EVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 9509
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + + + +C+ P L ++ + E+ C +E +C + CP CTCS + IV+C GK L IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L +P + T L L+ N++ L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C L WL +W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L+ +P +P + TELYL+ N L + L +L + LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG C+ Y C CP + GK C IN C PC++GG C +D+ + + C CP GF G +C N DDC + CEN ATCVD +N Y C CP + G+ C+ +C + N C++ C PL + + C C G+ GK CE + DDC + C++ A+C D +NGY C C G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + + + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + S K +C N CH ++++ Y C+C+ GF G C++ + C G+ R I+ + +C + K C+G C CCQP++ K F+C +G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPY-CLCQPGFSGEHCQQE-NPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQ---------------------CCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 3 Score: 281.952 bits (720), Expect = 2.34892e-75
Identity = 216/739 (29.23%), Postives = 331/739 (44.79%), Query Frame = 2
Query:  773 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVI-CPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQS------------------------NDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT-YITAKCD---ACMKT--PCQNNG 2749
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G V +Q + C + + +C I CP C+CS+ IV+C G GL +P + + L N IK + + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ ++ FS C +D+ CP KC+CE T +DCS +L IP+ +P T+L L+ N++ L + FK L NL+ + LS N I E+ + +++ L+L+ N+L+ +H F+ LS LK L+L+S N ++TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E + ++ +C CM+T C N G
Sbjct: 29 PPAVACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ-FTLCMAPVHLRGFNVADVQKKEYVCPAP-----HSEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSED--------YRSRFSSECFMDL------VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKG 742

HSP 4 Score: 281.952 bits (720), Expect = 2.34892e-75
Identity = 216/739 (29.23%), Postives = 331/739 (44.79%), Query Frame = -2
Query: 6882 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVI-CPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQS------------------------NDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT-YITAKCD---ACMKT--PCQNNG 8858
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G V +Q + C + + +C I CP C+CS+ IV+C G GL +P + + L N IK + + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ ++ FS C +D+ CP KC+CE T +DCS +L IP+ +P T+L L+ N++ L + FK L NL+ + LS N I E+ + +++ L+L+ N+L+ +H F+ LS LK L+L+S N ++TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E + ++ +C CM+T C N G
Sbjct: 29 PPAVACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ-FTLCMAPVHLRGFNVADVQKKEYVCPAP-----HSEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSED--------YRSRFSSECFMDL------VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKG 742

HSP 5 Score: 201.445 bits (511), Expect = 1.48663e-50
Identity = 136/440 (30.91%), Postives = 217/440 (49.32%), Query Frame = 2
Query:  119 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 1429
+CP+ C+CE V+C ++ +P+ L E T L L N + V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCHL WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ K L +P+ +P + EL L+ N +T + P L+ LT + L+ N++ + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-------------------------PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDI 911

HSP 6 Score: 201.445 bits (511), Expect = 1.48663e-50
Identity = 136/440 (30.91%), Postives = 217/440 (49.32%), Query Frame = -2
Query: 8202 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDI 9512
+CP+ C+CE V+C ++ +P+ L E T L L N + V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCHL WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ K L +P+ +P + EL L+ N +T + P L+ LT + L+ N++ + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P + + + FQC DI
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-------------------------PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDI 911
BLAST of slit vs. RefSeq Human
Match: gi|429836873|ref|NP_001258875.1| (slit homolog 3 protein isoform 1 precursor [Homo sapiens])

HSP 1 Score: 723.391 bits (1866), Expect = 0
Identity = 489/1587 (30.81%), Postives = 770/1587 (48.52%), Query Frame = 2
Query:  122 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEF------ICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEVP-------------IKSTKSLPVKSTICSKPGVCSN--------------NGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 4573
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + + + +C+ P L ++ + E+ C +E +C + CP CTCS + IV+C GK L IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L +P + T L L+ N++ L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C L WL +W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L+ +P +P + TELYL+ N L + L +L + LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG C+ Y C CP + GK C IN C PC++GG C +D+ + + C CP GF G +C N DDC + CEN ATCVD +N Y C CP + G+ C+ +C + N C++ C PL + + C C G+ GK CE + DDC + C++ A+C D +NGY C C G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + + + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + S K +C N +G CH ++++ Y C+C+ GF G C++ + C G+ R I+ + +C + K C+G C CCQP++ K F+C +G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCH-ISDQGEPY-CLCQPGFSGEHCQQE-NPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQ---------------------CCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGC 1526

HSP 2 Score: 723.391 bits (1866), Expect = 0
Identity = 489/1587 (30.81%), Postives = 770/1587 (48.52%), Query Frame = -2
Query: 5058 CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA----------------------ITKLKHL---RELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA---NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLK------------------------CVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEF------ICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGN-YECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDG--FSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLI-------------SKTAQELPSSEVPTQDIEVP-------------IKSTKSLPVKSTICSKPGVCSN--------------NGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKC 9509
CP C C SV+C R VP + RL+L N I I K DF L L+VL L +N++S IE GAF +L L +LRLN+N +Q LP+ LF KL +LDL ENQ+Q + F + +K L L+ N + I + +T H+ R LR+ SN L+C+CHL WL+ +L+ + + + +C+ P L ++ + E+ C +E +C + CP CTCS + IV+C GK L IP +LP +E+ L+ NSI + G ++YK LK+I +++N + DI P AF GL+ LT+L L N + I + F+GL SL L L+ N+I CL TF+ ++ L LL L +NKL + + + PL ++ L+L NP CDC + WL L+ + T A C P + +++ F+C+ D + E C ++CP KC C IV+CS L +P + T L L+ N++ L+ + NL K++LSNN+I+ ++ F + ++E+ L+ N+L+ CV+N+TF L + +L L DN I+ I +F +L + L +N +C+C L WL +W R + G+ P CQ P LK P+ ++ + F C+GN EE+S C P+CP +C C T + CS L+ +P +P + TELYL+ N L + L +L + LS N I+ + + + +L TL+LS+N+L+CI AF L +L+VL L ND+S++P +F DLT+L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ +PC+NNG C+ Y C CP + GK C IN C PC++GG C +D+ + + C CP GF G +C N DDC + CEN ATCVD +N Y C CP + G+ C+ +C + N C++ C PL + + C C G+ GK CE + DDC + C++ A+C D +NGY C C G+ G +CE P P L + S C +EC N C+ + +Q+ C+C PG++GP C+ L ++ F GKDS++E+ + + P+ NISL+ T+ +G++LY+G D L + L++GH+++ Y D P +S++ VND + H + + + + L + ++ +L L + +++ +++GG P +A++ F GCI + IN + DF +S+ V PGC S + P P D E + + S K +C N +G CH ++++ Y C+C+ GF G C++ + C G+ R I+ + +C + K C+G C CCQP++ K F+C +G + V C C
Sbjct: 34 CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIE-TSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSE-CFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGN---PRCQKPFFLKEIPIQDVAIQDFTCDGN----EESS----------------CQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPP--PMVL------------------------LQTSPCDQYECQNGAQCI---VVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGK--LQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCH-ISDQGEPY-CLCQPGFSGEHCQQE-NPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQ---------------------CCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGC 1526

HSP 3 Score: 281.952 bits (720), Expect = 2.68879e-75
Identity = 216/739 (29.23%), Postives = 331/739 (44.79%), Query Frame = 2
Query:  773 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVI-CPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQS------------------------NDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT-YITAKCD---ACMKT--PCQNNG 2749
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G V +Q + C + + +C I CP C+CS+ IV+C G GL +P + + L N IK + + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ ++ FS C +D+ CP KC+CE T +DCS +L IP+ +P T+L L+ N++ L + FK L NL+ + LS N I E+ + +++ L+L+ N+L+ +H F+ LS LK L+L+S N ++TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E + ++ +C CM+T C N G
Sbjct: 29 PPAVACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ-FTLCMAPVHLRGFNVADVQKKEYVCPAPH-----SEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSED--------YRSRFSSECFMDL------VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKG 742

HSP 4 Score: 281.952 bits (720), Expect = 2.68879e-75
Identity = 216/739 (29.23%), Postives = 331/739 (44.79%), Query Frame = -2
Query: 6882 PDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRT------------------------IRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVI-CPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINL------------------------SSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESS-FKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQS------------------------NDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDT-YITAKCD---ACMKT--PCQNNG 8858
P CP +CTCS V+C G L +P+ +P N LDL N+IT + + + K L+ + L N + IE GAF L+QL L LN N L+ I R AF G++ + L L NN I C+ G F ++ L +L L+ N +S + + K+R L L N LYCDC + WL L+ + C+ P G V +Q + C + + +C I CP C+CS+ IV+C G GL +P + + L N IK + + Q L ++D+S NQI +I PD F L + L ++NK+ C+ TF+ L L +L L DN + I F +++ L L N CDC LKWL+++ ++N R C SP L + + K F C G++ ++ FS C +D+ CP KC+CE T +DCS +L IP+ +P T+L L+ N++ L + FK L NL+ + LS N I E+ + +++ L+L+ N+L+ +H F+ LS LK L+L+S N ++TI AF L +L+ I L NPF+C+C++ WL ++ R + +G C P +K I +F C E + ++ +C CM+T C N G
Sbjct: 29 PPAVACPTKCTCSA-ASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQ-FTLCMAPVHLRGFNVADVQKKEYVCPAPH-----SEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPA-GAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGAR---CSSPRRLANKRISQIKSKKFRCSGSED--------YRSRFSSECFMDL------VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKG 742

HSP 5 Score: 198.364 bits (503), Expect = 1.36482e-49
Identity = 134/434 (30.88%), Postives = 215/434 (49.54%), Query Frame = 2
Query:  119 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQC 1411
+CP+ C+CE V+C ++ +P+ L E T L L N + V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCHL WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ K L +P+ +P + EL L+ N +T + P L+ LT + L+ N++ + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P + + + FQC
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-------------------------PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPEPMADRLLLTTPTHRFQC 905

HSP 6 Score: 198.364 bits (503), Expect = 1.36482e-49
Identity = 134/434 (30.88%), Postives = 215/434 (49.54%), Query Frame = -2
Query: 8220 ICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFF-KLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISE-AITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQC-ANEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQC 9512
+CP+ C+CE V+C ++ +P+ L E T L L N + V+ + F KL L+ + LSNN+I + GAFD ++ +L L N ++ + +F LS L+ L LR N + C++ F+ L ++ L L N++ I+ A T L L + + SN +CNCHL WL +L+ K I + R C P L +IPI ++ +F C NEE++CQ + CP+QCTC + +V C+ K L +P+ +P + EL L+ N +T + P L+ LT + L+ N++ + F+ +S L L L N + C+P F G++ L +L L N +S++ E L L +L L NPL+CDC + WL + +K +A C P + + + FQC
Sbjct: 504 VCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLR-KRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGNEESSCQLSPR-CPEQCTC-METVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-------------------------PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVK-AGYKEPGIARCSSPEPMADRLLLTTPTHRFQC 905
BLAST of slit vs. RefSeq Human
Match: gi|574281382|ref|NP_001276065.1| (slit homolog 2 protein isoform 3 precursor [Homo sapiens])

HSP 1 Score: 707.212 bits (1824), Expect = 0
Identity = 469/1476 (31.78%), Postives = 732/1476 (49.59%), Query Frame = 2
Query:  116 EICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQ------------------------CLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPDRKV--CPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNEL------------------------HCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC--KNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQY 4378
+ CP C C +V+C R+VP + T RL+L GN I I K+DF L +L+VLQL N+IS+IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL ENQ+Q C+ + F L L+ L L N + +S A + LR R+ SN L+C+CHL WL+ +L+ + + C+ P L ++ + EF C+ ++ P V CP CTCS + IV+C GK LT IP +LP E+ L+ N+I ++ G S YK L++I L+ N + ++ P AF GL+ L +L L N + + ++ F GL SL L L+ N+I CL F+ + L LL L +NKL + + PL ++ ++L NP CDC + WL L + T A C P + +++ F+C+ D + + C + CP KC C V+CS L+ +PE I T L L++N+ L+ + L K++ SNN+I +I+ F ++ + EI L+SN+L+ V ++ FK L L+ L L N I+C+G +SF ++++ L L +N++ +C+C L WL EW R + G+ P CQ P LK P+ ++ + F C+ D C+ + +CP++C C T + CS LK +P IP + TELYLD N TL N +L + LS N I+ ++ + + L TL+LS+N+L+CI F L +L++L L ND+S +P AF DL+ L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + +F C D I AKC+ C+ PC+N+G C+ Y C CP F G+ C+ I+AC PC++GG C K + G + C+C GF G C N+DDC + CEN +TCVD +N Y+C CP + G+ CE K +C D NPC++ C L+ +KC CT G+ G++C+ + DDC+ N CKN A C D VNGY CIC GY G +CE F+ + S C +C N C+ + + C+C PGY G C+ L S+ F K+S+++I P ++ + P+ NI+L+ T+ SG++LY+G DK ++ V L+RG ++ SY+ G +S++ +ND H + + + ++L++ ++G + + L + D+ +++GG P K +++ N + F GCI +L IN + DF K + + PGC P +C+ +G C ++ + C C+ G++G C +R T + + H CL I F Y
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIE-TSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGD-CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCDDGND-------------------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKC-ILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE--------------------------FSPPMVLPRTSPCDNFDCQNGAQCI---VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE------------------------------PCHKKVCA-------HGTCQPSSQAG--FTCECQEGWMGPLCDQR-------TNDPCLGNKCVHGTCLPINAFSY 1385

HSP 2 Score: 707.212 bits (1824), Expect = 0
Identity = 469/1476 (31.78%), Postives = 732/1476 (49.59%), Query Frame = -2
Query: 5253 EICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQ------------------------CLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPDRKV--CPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNEL------------------------HCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC--KNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQY 9515
+ CP C C +V+C R+VP + T RL+L GN I I K+DF L +L+VLQL N+IS+IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL ENQ+Q C+ + F L L+ L L N + +S A + LR R+ SN L+C+CHL WL+ +L+ + + C+ P L ++ + EF C+ ++ P V CP CTCS + IV+C GK LT IP +LP E+ L+ N+I ++ G S YK L++I L+ N + ++ P AF GL+ L +L L N + + ++ F GL SL L L+ N+I CL F+ + L LL L +NKL + + PL ++ ++L NP CDC + WL L + T A C P + +++ F+C+ D + + C + CP KC C V+CS L+ +PE I T L L++N+ L+ + L K++ SNN+I +I+ F ++ + EI L+SN+L+ V ++ FK L L+ L L N I+C+G +SF ++++ L L +N++ +C+C L WL EW R + G+ P CQ P LK P+ ++ + F C+ D C+ + +CP++C C T + CS LK +P IP + TELYLD N TL N +L + LS N I+ ++ + + L TL+LS+N+L+CI F L +L++L L ND+S +P AF DL+ L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + +F C D I AKC+ C+ PC+N+G C+ Y C CP F G+ C+ I+AC PC++GG C K + G + C+C GF G C N+DDC + CEN +TCVD +N Y+C CP + G+ CE K +C D NPC++ C L+ +KC CT G+ G++C+ + DDC+ N CKN A C D VNGY CIC GY G +CE F+ + S C +C N C+ + + C+C PGY G C+ L S+ F K+S+++I P ++ + P+ NI+L+ T+ SG++LY+G DK ++ V L+RG ++ SY+ G +S++ +ND H + + + ++L++ ++G + + L + D+ +++GG P K +++ N + F GCI +L IN + DF K + + PGC P +C+ +G C ++ + C C+ G++G C +R T + + H CL I F Y
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIE-TSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGD-CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCDDGND-------------------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKC-ILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE--------------------------FSPPMVLPRTSPCDNFDCQNGAQCI---VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE------------------------------PCHKKVCA-------HGTCQPSSQAG--FTCECQEGWMGPLCDQR-------TNDPCLGNKCVHGTCLPINAFSY 1385

HSP 3 Score: 293.123 bits (749), Expect = 7.62769e-79
Identity = 223/694 (32.13%), Postives = 332/694 (47.84%), Query Frame = 2
Query:  101 PSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEEN-------TCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQ-GFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKAN--FSYSCCLDMKCNKIPKCPSKCKC 2149
PS V CP C C N V+C+ + +P L E T + L N I VI F L+ + LSNN+IS + AF L +L L L N I LP LF L LQ L L N++ CL F L L L L NKL I++ + L+ ++ + ++ N C+CHL WL +L +T C +P+RL+ I + + +F+C+ E+ C D CP++C C + V+C+ ++L IP+ +P T EL L NN T+L G K L+KI + N + DIE GAF G + + L N L ++ F GL SL L L +N I C+ +F G+ + LL L +N+++ + L L L L+ NP C+C + WL + L+ K + T C P I ++ + +F C+ +D D +C P CP +C+C +V CS GL LP+ I T L L N + + S ++ +L +DLSNN+I + +FS T+L + LS N+L+C+ TF L L +L L+ N IS + +F + L +L + N L+CDC ++WLS+W ++ Y G R C P + L K F C+G + + AK N S C D CN P +C C
Sbjct: 266 PSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP----IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADL-ACPEKCRC-EGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRI-VTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGND------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYK--HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIAR---CAGPGEMADKLLLTTPSKKFTCQG----PVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTC 937

HSP 4 Score: 293.123 bits (749), Expect = 7.62769e-79
Identity = 223/694 (32.13%), Postives = 332/694 (47.84%), Query Frame = -2
Query: 7482 PSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEEN-------TCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQ-GFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKAN--FSYSCCLDMKCNKIPKCPSKCKC 9530
PS V CP C C N V+C+ + +P L E T + L N I VI F L+ + LSNN+IS + AF L +L L L N I LP LF L LQ L L N++ CL F L L L L NKL I++ + L+ ++ + ++ N C+CHL WL +L +T C +P+RL+ I + + +F+C+ E+ C D CP++C C + V+C+ ++L IP+ +P T EL L NN T+L G K L+KI + N + DIE GAF G + + L N L ++ F GL SL L L +N I C+ +F G+ + LL L +N+++ + L L L L+ NP C+C + WL + L+ K + T C P I ++ + +F C+ +D D +C P CP +C+C +V CS GL LP+ I T L L N + + S ++ +L +DLSNN+I + +FS T+L + LS N+L+C+ TF L L +L L+ N IS + +F + L +L + N L+CDC ++WLS+W ++ Y G R C P + L K F C+G + + AK N S C D CN P +C C
Sbjct: 266 PSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP----IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADL-ACPEKCRC-EGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRI-VTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGND------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYK--HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIAR---CAGPGEMADKLLLTTPSKKFTCQG----PVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTC 937

HSP 5 Score: 208.379 bits (529), Expect = 1.18544e-52
Identity = 143/501 (28.54%), Postives = 225/501 (44.91%), Query Frame = 2
Query: 1451 NCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNL------------------DQIYSVHQA-----------------------------SNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETED--TYITAKCDACMKTP 2734
N V CP +CSCS V+C G+ L S+P I +T L L+ N+I + ++I ++ + + L +LDLS NQI+ I F + +K + L N++ C+ + F+ L +LE+L LN+N+I+ + SF L+ L++N L+CDC L WLS+W R + C P L+G + + ++ FVC G++S + S + CP+ C C + +DC L EIPT +P TE+ L++N +K + +F L+ + LS N I+E+ D L++L +LVL + NK+ C+ DAF+DL NL +L L N + TI F L + + L QNPF CDC++KWL + ++ + C SP R+ K I K +F CS TED + ++ C A + P
Sbjct: 21 NKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCS------------------VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCS-GTEDYRSKLSGDCFADLACP 499

HSP 6 Score: 208.379 bits (529), Expect = 1.18544e-52
Identity = 143/501 (28.54%), Postives = 225/501 (44.91%), Query Frame = -2
Query: 6897 NCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNL------------------DQIYSVHQA-----------------------------SNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETED--TYITAKCDACMKTP 8180
N V CP +CSCS V+C G+ L S+P I +T L L+ N+I + ++I ++ + + L +LDLS NQI+ I F + +K + L N++ C+ + F+ L +LE+L LN+N+I+ + SF L+ L++N L+CDC L WLS+W R + C P L+G + + ++ FVC G++S + S + CP+ C C + +DC L EIPT +P TE+ L++N +K + +F L+ + LS N I+E+ D L++L +LVL + NK+ C+ DAF+DL NL +L L N + TI F L + + L QNPF CDC++KWL + ++ + C SP R+ K I K +F CS TED + ++ C A + P
Sbjct: 21 NKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCS------------------VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCS-GTEDYRSKLSGDCFADLACP 499
BLAST of slit vs. RefSeq Human
Match: gi|574281850|ref|NP_001276064.1| (slit homolog 2 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 706.442 bits (1822), Expect = 0
Identity = 472/1480 (31.89%), Postives = 734/1480 (49.59%), Query Frame = 2
Query:  116 EICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQ------------------------CLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQ----PDRKV--CPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNEL------------------------HCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC--KNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQY 4378
+ CP C C +V+C R+VP + T RL+L GN I I K+DF L +L+VLQL N+IS+IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL ENQ+Q C+ + F L L+ L L N + +S A + LR R+ SN L+C+CHL WL+ +L+ + + C+ P L ++ + EF C++EE Q P V CP CTCS + IV+C GK LT IP +LP E+ L+ N+I ++ G S YK L++I L+ N + ++ P AF GL+ L +L L N + + ++ F GL SL L L+ N+I CL F+ + L LL L +NKL + + PL ++ ++L NP CDC + WL L + T A C P + +++ F+C+ D + + C + CP KC C V+CS L+ +PE I T L L++N+ L+ + L K++ SNN+I +I+ F ++ + EI L+SN+L+ V ++ FK L L+ L L N I+C+G +SF ++++ L L +N++ +C+C L WL EW R + G+ P CQ P LK P+ ++ + F C+ D C+ + +CP++C C T + CS LK +P IP + TELYLD N TL N +L + LS N I+ ++ + + L TL+LS+N+L+CI F L +L++L L ND+S +P AF DL+ L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + +F C D I AKC+ C+ PC+N+G C+ Y C CP F G+ C+ I+AC PC++GG C K + G + C+C GF G C N+DDC + CEN +TCVD +N Y+C CP + G+ CE K +C D NPC++ C L+ +KC CT G+ G++C+ + DDC+ N CKN A C D VNGY CIC GY G +CE F+ + S C +C N C+ + + C+C PGY G C+ L S+ F K+S+++I P ++ + P+ NI+L+ T+ SG++LY+G DK ++ V L+RG ++ SY+ G +S++ +ND H + + + ++L++ ++G + + L + D+ +++GG P K +++ N + F GCI +L IN + DF K + + PGC P +C+ +G C ++ + C C+ G++G C +R T + + H CL I F Y
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIE-TSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGD-CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCDDGND-------------------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKC-ILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE--------------------------FSPPMVLPRTSPCDNFDCQNGAQCI---VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE------------------------------PCHKKVCA-------HGTCQPSSQAG--FTCECQEGWMGPLCDQR-------TNDPCLGNKCVHGTCLPINAFSY 1389

HSP 2 Score: 706.442 bits (1822), Expect = 0
Identity = 472/1480 (31.89%), Postives = 734/1480 (49.59%), Query Frame = -2
Query: 5253 EICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQ------------------------CLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQ----PDRKV--CPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNEL------------------------HCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC--KNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQY 9515
+ CP C C +V+C R+VP + T RL+L GN I I K+DF L +L+VLQL N+IS+IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL ENQ+Q C+ + F L L+ L L N + +S A + LR R+ SN L+C+CHL WL+ +L+ + + C+ P L ++ + EF C++EE Q P V CP CTCS + IV+C GK LT IP +LP E+ L+ N+I ++ G S YK L++I L+ N + ++ P AF GL+ L +L L N + + ++ F GL SL L L+ N+I CL F+ + L LL L +NKL + + PL ++ ++L NP CDC + WL L + T A C P + +++ F+C+ D + + C + CP KC C V+CS L+ +PE I T L L++N+ L+ + L K++ SNN+I +I+ F ++ + EI L+SN+L+ V ++ FK L L+ L L N I+C+G +SF ++++ L L +N++ +C+C L WL EW R + G+ P CQ P LK P+ ++ + F C+ D C+ + +CP++C C T + CS LK +P IP + TELYLD N TL N +L + LS N I+ ++ + + L TL+LS+N+L+CI F L +L++L L ND+S +P AF DL+ L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + +F C D I AKC+ C+ PC+N+G C+ Y C CP F G+ C+ I+AC PC++GG C K + G + C+C GF G C N+DDC + CEN +TCVD +N Y+C CP + G+ CE K +C D NPC++ C L+ +KC CT G+ G++C+ + DDC+ N CKN A C D VNGY CIC GY G +CE F+ + S C +C N C+ + + C+C PGY G C+ L S+ F K+S+++I P ++ + P+ NI+L+ T+ SG++LY+G DK ++ V L+RG ++ SY+ G +S++ +ND H + + + ++L++ ++G + + L + D+ +++GG P K +++ N + F GCI +L IN + DF K + + PGC P +C+ +G C ++ + C C+ G++G C +R T + + H CL I F Y
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIE-TSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGD-CFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCDDGND-------------------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKC-ILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE--------------------------FSPPMVLPRTSPCDNFDCQNGAQCI---VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE------------------------------PCHKKVCA-------HGTCQPSSQAG--FTCECQEGWMGPLCDQR-------TNDPCLGNKCVHGTCLPINAFSY 1389

HSP 3 Score: 293.123 bits (749), Expect = 8.03924e-79
Identity = 223/694 (32.13%), Postives = 332/694 (47.84%), Query Frame = 2
Query:  101 PSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEEN-------TCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQ-GFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKAN--FSYSCCLDMKCNKIPKCPSKCKC 2149
PS V CP C C N V+C+ + +P L E T + L N I VI F L+ + LSNN+IS + AF L +L L L N I LP LF L LQ L L N++ CL F L L L L NKL I++ + L+ ++ + ++ N C+CHL WL +L +T C +P+RL+ I + + +F+C+ E+ C D CP++C C + V+C+ ++L IP+ +P T EL L NN T+L G K L+KI + N + DIE GAF G + + L N L ++ F GL SL L L +N I C+ +F G+ + LL L +N+++ + L L L L+ NP C+C + WL + L+ K + T C P I ++ + +F C+ +D D +C P CP +C+C +V CS GL LP+ I T L L N + + S ++ +L +DLSNN+I + +FS T+L + LS N+L+C+ TF L L +L L+ N IS + +F + L +L + N L+CDC ++WLS+W ++ Y G R C P + L K F C+G + + AK N S C D CN P +C C
Sbjct: 270 PSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP----IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADL-ACPEKCRC-EGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRI-VTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGND------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYK--HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIAR---CAGPGEMADKLLLTTPSKKFTCQG----PVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTC 941

HSP 4 Score: 293.123 bits (749), Expect = 8.03924e-79
Identity = 223/694 (32.13%), Postives = 332/694 (47.84%), Query Frame = -2
Query: 7482 PSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEEN-------TCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQ-GFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKAN--FSYSCCLDMKCNKIPKCPSKCKC 9530
PS V CP C C N V+C+ + +P L E T + L N I VI F L+ + LSNN+IS + AF L +L L L N I LP LF L LQ L L N++ CL F L L L L NKL I++ + L+ ++ + ++ N C+CHL WL +L +T C +P+RL+ I + + +F+C+ E+ C D CP++C C + V+C+ ++L IP+ +P T EL L NN T+L G K L+KI + N + DIE GAF G + + L N L ++ F GL SL L L +N I C+ +F G+ + LL L +N+++ + L L L L+ NP C+C + WL + L+ K + T C P I ++ + +F C+ +D D +C P CP +C+C +V CS GL LP+ I T L L N + + S ++ +L +DLSNN+I + +FS T+L + LS N+L+C+ TF L L +L L+ N IS + +F + L +L + N L+CDC ++WLS+W ++ Y G R C P + L K F C+G + + AK N S C D CN P +C C
Sbjct: 270 PSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP----IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADL-ACPEKCRC-EGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRI-VTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGND------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYK--HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIAR---CAGPGEMADKLLLTTPSKKFTCQG----PVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTC 941

HSP 5 Score: 206.068 bits (523), Expect = 5.0294e-52
Identity = 145/501 (28.94%), Postives = 226/501 (45.11%), Query Frame = 2
Query: 1451 NCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNL------------------DQIYSVHQA-----------------------------SNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETED--TYITAKCDACMKTP 2734
N V CP +CSCS V+C G+ L S+P I +T L L+ N+I + ++I ++ + + L +LDLS NQI+ I F + +K + L N++ C+ + F+ L +LE+L LN+N+I+ + SF L+ L++N L+CDC L WLS+W R + C P L+G + + ++ FVC S +EE +F C + CP+ C C + +DC L EIPT +P TE+ L++N +K + +F L+ + LS N I+E+ D L++L +LVL + NK+ C+ DAF+DL NL +L L N + TI F L + + L QNPF CDC++KWL + ++ + C SP R+ K I K +F CS TED + ++ C A + P
Sbjct: 21 NKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQCMGPSHLRGHNVAEVQKREFVC----SDEEE----GHQSFMAPSC------SVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCS-GTEDYRSKLSGDCFADLACP 503

HSP 6 Score: 206.068 bits (523), Expect = 5.0294e-52
Identity = 145/501 (28.94%), Postives = 226/501 (45.11%), Query Frame = -2
Query: 6897 NCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNL------------------DQIYSVHQA-----------------------------SNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETED--TYITAKCDACMKTP 8180
N V CP +CSCS V+C G+ L S+P I +T L L+ N+I + ++I ++ + + L +LDLS NQI+ I F + +K + L N++ C+ + F+ L +LE+L LN+N+I+ + SF L+ L++N L+CDC L WLS+W R + C P L+G + + ++ FVC S +EE +F C + CP+ C C + +DC L EIPT +P TE+ L++N +K + +F L+ + LS N I+E+ D L++L +LVL + NK+ C+ DAF+DL NL +L L N + TI F L + + L QNPF CDC++KWL + ++ + C SP R+ K I K +F CS TED + ++ C A + P
Sbjct: 21 NKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQCMGPSHLRGHNVAEVQKREFVC----SDEEE----GHQSFMAPSC------SVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCS-GTEDYRSKLSGDCFADLACP 503
BLAST of slit vs. RefSeq Human
Match: gi|4759146|ref|NP_004778.1| (slit homolog 2 protein isoform 1 precursor [Homo sapiens])

HSP 1 Score: 702.205 bits (1811), Expect = 0
Identity = 471/1483 (31.76%), Postives = 734/1483 (49.49%), Query Frame = 2
Query:  116 EICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQ------------------------CLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPDRKV--CPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNS-ESDIKYDTHD------ENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNEL------------------------HCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC--KNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQY 4378
+ CP C C +V+C R+VP + T RL+L GN I I K+DF L +L+VLQL N+IS+IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL ENQ+Q C+ + F L L+ L L N + +S A + LR R+ SN L+C+CHL WL+ +L+ + + C+ P L ++ + EF C+ ++ P V CP CTCS + IV+C GK LT IP +LP E+ L+ N+I ++ G S YK L++I L+ N + ++ P AF GL+ L +L L N + + ++ F GL SL L L+ N+I CL F+ + L LL L +NKL + + PL ++ ++L NP CDC + WL L + T A C P + +++ F+C++ E T D +C + CP KC C V+CS L+ +PE I T L L++N+ L+ + L K++ SNN+I +I+ F ++ + EI L+SN+L+ V ++ FK L L+ L L N I+C+G +SF ++++ L L +N++ +C+C L WL EW R + G+ P CQ P LK P+ ++ + F C+ D C+ + +CP++C C T + CS LK +P IP + TELYLD N TL N +L + LS N I+ ++ + + L TL+LS+N+L+CI F L +L++L L ND+S +P AF DL+ L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + +F C D I AKC+ C+ PC+N+G C+ Y C CP F G+ C+ I+AC PC++GG C K + G + C+C GF G C N+DDC + CEN +TCVD +N Y+C CP + G+ CE K +C D NPC++ C L+ +KC CT G+ G++C+ + DDC+ N CKN A C D VNGY CIC GY G +CE F+ + S C +C N C+ + + C+C PGY G C+ L S+ F K+S+++I P ++ + P+ NI+L+ T+ SG++LY+G DK ++ V L+RG ++ SY+ G +S++ +ND H + + + ++L++ ++G + + L + D+ +++GG P K +++ N + F GCI +L IN + DF K + + PGC P +C+ +G C ++ + C C+ G++G C +R T + + H CL I F Y
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIE-TSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCDDGND-------------------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKC-ILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE--------------------------FSPPMVLPRTSPCDNFDCQNGAQCI---VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE------------------------------PCHKKVCA-------HGTCQPSSQAG--FTCECQEGWMGPLCDQR-------TNDPCLGNKCVHGTCLPINAFSY 1393

HSP 2 Score: 702.205 bits (1811), Expect = 0
Identity = 471/1483 (31.76%), Postives = 734/1483 (49.49%), Query Frame = -2
Query: 5253 EICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQ------------------------CLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPDRKV--CPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNS-ESDIKYDTHD------ENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNEL------------------------HCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGIC--KNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYC-HDKNPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQY 9515
+ CP C C +V+C R+VP + T RL+L GN I I K+DF L +L+VLQL N+IS+IE GAF +L L +LRLNRN +Q P+ LF +KL +LDL ENQ+Q C+ + F L L+ L L N + +S A + LR R+ SN L+C+CHL WL+ +L+ + + C+ P L ++ + EF C+ ++ P V CP CTCS + IV+C GK LT IP +LP E+ L+ N+I ++ G S YK L++I L+ N + ++ P AF GL+ L +L L N + + ++ F GL SL L L+ N+I CL F+ + L LL L +NKL + + PL ++ ++L NP CDC + WL L + T A C P + +++ F+C++ E T D +C + CP KC C V+CS L+ +PE I T L L++N+ L+ + L K++ SNN+I +I+ F ++ + EI L+SN+L+ V ++ FK L L+ L L N I+C+G +SF ++++ L L +N++ +C+C L WL EW R + G+ P CQ P LK P+ ++ + F C+ D C+ + +CP++C C T + CS LK +P IP + TELYLD N TL N +L + LS N I+ ++ + + L TL+LS+N+L+CI F L +L++L L ND+S +P AF DL+ L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + +F C D I AKC+ C+ PC+N+G C+ Y C CP F G+ C+ I+AC PC++GG C K + G + C+C GF G C N+DDC + CEN +TCVD +N Y+C CP + G+ CE K +C D NPC++ C L+ +KC CT G+ G++C+ + DDC+ N CKN A C D VNGY CIC GY G +CE F+ + S C +C N C+ + + C+C PGY G C+ L S+ F K+S+++I P ++ + P+ NI+L+ T+ SG++LY+G DK ++ V L+RG ++ SY+ G +S++ +ND H + + + ++L++ ++G + + L + D+ +++GG P K +++ N + F GCI +L IN + DF K + + PGC P +C+ +G C ++ + C C+ G++G C +R T + + H CL I F Y
Sbjct: 26 QACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIE-TSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGN---PRCQKPYFLKEIPIQDVAIQDFTCDDGND-------------------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQF-TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKC-ILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE--------------------------FSPPMVLPRTSPCDNFDCQNGAQCI---VRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHPASAI-YSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK-VPMQTGILPGCE------------------------------PCHKKVCA-------HGTCQPSSQAG--FTCECQEGWMGPLCDQR-------TNDPCLGNKCVHGTCLPINAFSY 1393

HSP 3 Score: 291.582 bits (745), Expect = 2.39337e-78
Identity = 222/701 (31.67%), Postives = 332/701 (47.36%), Query Frame = 2
Query:  101 PSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPDRK--------------VCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQ-GFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKAN--FSYSCCLDMKCNKIPKCPSKCKC 2149
PS V CP C C N V+C+ + +P L E T + L N I VI F L+ + LSNN+IS + AF L +L L L N I LP LF L LQ L L N++ CL F L L L L NKL I++ + L+ ++ + ++ N C+CHL WL +L +T C +P+RL+ I + + +F+C+ +E P + CP++C C + V+C+ ++L IP+ +P T EL L NN T+L G K L+KI + N + DIE GAF G + + L N L ++ F GL SL L L +N I C+ +F G+ + LL L +N+++ + L L L L+ NP C+C + WL + L+ K + T C P I ++ + +F C+ +D D +C P CP +C+C +V CS GL LP+ I T L L N + + S ++ +L +DLSNN+I + +FS T+L + LS N+L+C+ TF L L +L L+ N IS + +F + L +L + N L+CDC ++WLS+W ++ Y G R C P + L K F C+G + + AK N S C D CN P +C C
Sbjct: 266 PSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP----IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRC-EGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRI-VTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGND------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYK--HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIAR---CAGPGEMADKLLLTTPSKKFTCQG----PVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTC 945

HSP 4 Score: 291.582 bits (745), Expect = 2.39337e-78
Identity = 222/701 (31.67%), Postives = 332/701 (47.36%), Query Frame = -2
Query: 7482 PSEEVEICPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEA-ITKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPDRK--------------VCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQ-GFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKAN--FSYSCCLDMKCNKIPKCPSKCKC 9530
PS V CP C C N V+C+ + +P L E T + L N I VI F L+ + LSNN+IS + AF L +L L L N I LP LF L LQ L L N++ CL F L L L L NKL I++ + L+ ++ + ++ N C+CHL WL +L +T C +P+RL+ I + + +F+C+ +E P + CP++C C + V+C+ ++L IP+ +P T EL L NN T+L G K L+KI + N + DIE GAF G + + L N L ++ F GL SL L L +N I C+ +F G+ + LL L +N+++ + L L L L+ NP C+C + WL + L+ K + T C P I ++ + +F C+ +D D +C P CP +C+C +V CS GL LP+ I T L L N + + S ++ +L +DLSNN+I + +FS T+L + LS N+L+C+ TF L L +L L+ N IS + +F + L +L + N L+CDC ++WLS+W ++ Y G R C P + L K F C+G + + AK N S C D CN P +C C
Sbjct: 266 PSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP----IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRC-EGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRI-VTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGND------DNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYK--HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIAR---CAGPGEMADKLLLTTPSKKFTCQG----PVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTC 945

HSP 5 Score: 207.223 bits (526), Expect = 2.58658e-52
Identity = 137/484 (28.31%), Postives = 217/484 (44.83%), Query Frame = 2
Query: 1451 NCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNL------------------DQIYSVHQA-----------------------------SNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETE 2689
N V CP +CSCS V+C G+ L S+P I +T L L+ N+I + ++I ++ + + L +LDLS NQI+ I F + +K + L N++ C+ + F+ L +LE+L LN+N+I+ + SF L+ L++N L+CDC L WLS+W R + C P L+G + + ++ FVC G++S + S + CP+ C C + +DC L EIPT +P TE+ L++N +K + +F L+ + LS N I+E+ D L++L +LVL + NK+ C+ DAF+DL NL +L L N + TI F L + + L QNPF CDC++KWL + ++ + C SP R+ K I K +F CS + +
Sbjct: 21 NKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCS------------------VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQ 483

HSP 6 Score: 207.223 bits (526), Expect = 2.58658e-52
Identity = 137/484 (28.31%), Postives = 217/484 (44.83%), Query Frame = -2
Query: 6942 NCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNL------------------DQIYSVHQA-----------------------------SNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVL------------------------SFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETE 8180
N V CP +CSCS V+C G+ L S+P I +T L L+ N+I + ++I ++ + + L +LDLS NQI+ I F + +K + L N++ C+ + F+ L +LE+L LN+N+I+ + SF L+ L++N L+CDC L WLS+W R + C P L+G + + ++ FVC G++S + S + CP+ C C + +DC L EIPT +P TE+ L++N +K + +F L+ + LS N I+E+ D L++L +LVL + NK+ C+ DAF+DL NL +L L N + TI F L + + L QNPF CDC++KWL + ++ + C SP R+ K I K +F CS + +
Sbjct: 21 NKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCS------------------VLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQ 483
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136484|ref|NP_476729.1| (slit, isoform B [Drosophila melanogaster])

HSP 1 Score: 758.829 bits (1958), Expect = 0
Identity = 495/1514 (32.69%), Postives = 761/1514 (50.26%), Query Frame = 2
Query:   83 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 4588
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +L ++ N+I + +F L+ L L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1469

HSP 2 Score: 758.829 bits (1958), Expect = 0
Identity = 495/1514 (32.69%), Postives = 761/1514 (50.26%), Query Frame = -2
Query: 5043 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 9548
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +L ++ N+I + +F L+ L L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1469
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136482|ref|NP_476728.1| (slit, isoform A [Drosophila melanogaster])

HSP 1 Score: 750.74 bits (1937), Expect = 0
Identity = 495/1525 (32.46%), Postives = 761/1525 (49.90%), Query Frame = 2
Query:   83 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 4588
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +L ++ N+I + +F L+ L L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1480

HSP 2 Score: 750.74 bits (1937), Expect = 0
Identity = 495/1525 (32.46%), Postives = 761/1525 (49.90%), Query Frame = -2
Query: 5043 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 9548
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +L ++ N+I + +F L+ L L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1480
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077130|ref|NP_001097333.1| (slit, isoform D [Drosophila melanogaster])

HSP 1 Score: 750.74 bits (1937), Expect = 0
Identity = 495/1525 (32.46%), Postives = 761/1525 (49.90%), Query Frame = 2
Query:   83 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 4588
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +L ++ N+I + +F L+ L L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1480

HSP 2 Score: 750.74 bits (1937), Expect = 0
Identity = 495/1525 (32.46%), Postives = 761/1525 (49.90%), Query Frame = -2
Query: 5043 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLDLRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 9548
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +L ++ N+I + +F L+ L L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1480
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136480|ref|NP_476727.1| (slit, isoform C [Drosophila melanogaster])

HSP 1 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1549 (32.15%), Postives = 766/1549 (49.45%), Query Frame = 2
Query:   83 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLD------------------------LRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 4588
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +LRLN N ++ +P++ + + L +LD L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1504

HSP 2 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1549 (32.15%), Postives = 766/1549 (49.45%), Query Frame = -2
Query: 5043 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLD------------------------LRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 9548
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +LRLN N ++ +P++ + + L +LD L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1504
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077132|ref|NP_001097334.1| (slit, isoform E [Drosophila melanogaster])

HSP 1 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1549 (32.15%), Postives = 766/1549 (49.45%), Query Frame = 2
Query:   83 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXXQHLPDHLFSKLSKLQKLD------------------------LRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXXTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 4588
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +LRLN N ++ +P++ + + L +LD L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1504

HSP 2 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1549 (32.15%), Postives = 766/1549 (49.45%), Query Frame = -2
Query: 5043 TIWINDPSEEVEI-----CPKGCQCENFSVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLSNNRISSIESGAFDXXXXXXXXXXXXXXIQHLPDHLFSKLSKLQKLD------------------------LRENQLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAI-TKLKHLRELRISSNKLHCNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCANEENTCQPD---RKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQNNSITILRQGFXXXXXXXXXXXLTQNGMVDIEPGAFIGLQQLTALYLNMNNLRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLSALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCVGPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSEIVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDLSNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLNDNHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSLRLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCLDMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLKTLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCIHQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYITAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQPCRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGH-KCENGATCVDQVNKYSCKCPNGFRGKFCESKFLYCHDK-NPCENSGHCEPLSNNDYKCSCTKGWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAWKPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNEDMNKQKSYCKCKPGYSGPFCQYLNSLYF-GKDSHIEIHPPSRGFLMPKGNISLKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMDVVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFIGGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVKPGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNNGVCHEVNEKNRKYKCVCKNGFVGRKCKK-----------RVSKCHGKTTRTFIKDPDTHDNCLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTHKIQFKCDNGRFYRRSVTLPRSCKCQGNCH 9548
++ I+ P V + CP+ C C +V+C HR +VP ++ RL L GN + VI ++DF +L L++LQL++N+I +IE +F +L++L +LRLN N ++ +P++ + + L +LD L NQ+ CL+EH F L L+ L L N L + I L LR LR+S N C+CHL WL+ FL+ + + P TR C +P +L ++ L EF+C+ + CP C C+ DGIV+C K LT++P LP +T EL L+ N IT L S ++ L++I L+ N + I A GL+QLT L L N ++ + F GL SL L L+ NEI C+ F + L LL L +N + +L + ++ ++L NP CDC + WL L + T A C P H ++SL+ F+C S +++ E C CP C C V+C+G GL +P I TT L+L+ N++ + + +LVKL+L NQ+ I+P+ F ++ ++E+ L NK+K ++N+ F L +L+ L L DN ISC+ SF+ +L L L +N +C+C L W +EW R G+ R C +P ++ + +L F C S E + C + CP C C T + CS QLKEIP IP T+ELYL+ N+++ ++ ++L +L L LS N IT ++ L L TL++S+NKLQC+ + A L+NL+VL L N +S +P +F DL +L +IALG NP +CDC +KW + + +++ GI+ CA PE+MK K I + + F+C + I AKC+AC + PCQN +C + +Y C C +HGK CE I+AC+G PCRN C + G + C C G+ G +C NIDDC G KC+N ATC+D V Y C+C GF G+FC++K +C + NPC N C + Y C C G+ G NC NIDDC+ ++C+N C D +N Y+C C Y G YCE + +S + S C HEC +GVC + C+C PGY+G +C+YL S+ F +S +E+ P P+ N+++ F + +G+++Y G D ++L V LF G I++SY++G+ + +S ++V D K H + + + +N T+ ++ + ++ ++ +N Y+ L T +F+GG P A +N N + F GC++ + IN K +DF + + PGC L+ QE E D IK P C + C N + Y+C CK+G GR C + S C + R + T ++C S + +Y C G C N CC K++ C N R Y +++ + R C C C+
Sbjct: 55 SVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL-APYTR---CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIE-TSGARCESPKRMHRRRIESLREEKFKC-SWDELRMKLSGE-CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAPSKVRDVQIKDLPHSEFKC-----SSENSEGCLGDGY---------------CPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------GHNMISMMYPQT------SPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVS-TMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINE--GSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGCA-LLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARD------GYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYY----TENDCRSRQPLKYAKCVGGCGNQ---------------------CCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY 1504
The following BLAST results are available for this feature:
BLAST of slit vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|33302576|sp|P24014|SLIT_DROME0.000000e+032.15RecName: Full=Protein slit; Short=dSlit; Contains:... [more]
gi|45477220|sp|O88280|SLIT3_RAT1.963560e-7631.76RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|341942041|sp|Q9WVB4|SLIT3_MOUSE3.023080e-7631.31RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|311033528|sp|O75094|SLIT3_HUMAN6.725060e-7530.89RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|45477219|sp|O88279|SLIT1_RAT0.000000e+030.67RecName: Full=Slit homolog 1 protein; Short=Slit-1... [more]
back to top
BLAST of slit vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150367780.000000e+070.98dd_smedV4_12111_0_1|m.4973|m.1592[more]
SMU150063171.973030e-3343.16SmedAsxldir_c107934_g5_i1|m.86273|m.14433[more]
SMU150061401.777370e-2930.95SmedAsxldir_c107649_g2_i1|m.84323|m.17798[more]
SMU150371147.392110e-2927.37dd_smedV4_13823_0_1|m.8312|m.39635[more]
SMU150361381.473720e-2330.95SmedSxlregen_c89796_g1_i1|m.42552|m.12127[more]
back to top
BLAST of slit vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|11321571|ref|NP_003053.1|2.348920e-7530.89slit homolog 3 protein isoform 2 precursor [Homo s... [more]
gi|429836873|ref|NP_001258875.1|2.688790e-7530.81slit homolog 3 protein isoform 1 precursor [Homo s... [more]
gi|574281382|ref|NP_001276065.1|7.627690e-7931.78slit homolog 2 protein isoform 3 precursor [Homo s... [more]
gi|574281850|ref|NP_001276064.1|8.039240e-7931.89slit homolog 2 protein isoform 2 precursor [Homo s... [more]
gi|4759146|ref|NP_004778.1|2.393370e-7831.76slit homolog 2 protein isoform 1 precursor [Homo s... [more]
back to top
BLAST of slit vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136484|ref|NP_476729.1|0.000000e+032.69slit, isoform B [Drosophila melanogaster][more]
gi|17136482|ref|NP_476728.1|0.000000e+032.46slit, isoform A [Drosophila melanogaster][more]
gi|161077130|ref|NP_001097333.1|0.000000e+032.46slit, isoform D [Drosophila melanogaster][more]
gi|17136480|ref|NP_476727.1|0.000000e+032.15slit, isoform C [Drosophila melanogaster][more]
gi|161077132|ref|NP_001097334.1|0.000000e+032.15slit, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_016416 ID=Ddo_016416|Name=slit|organism=Dugesia dorotocephala|type=mRNA|length=9630bp
GGATAAAATGCAATTTATTTTTAAGGATATAACTTATAAATCCTATTTGA
TTTTATTATTATCATTATATTGTTTTTCCTCGACCATTTGGATCAATGAT
CCATCAGAGGAAGTCGAAATTTGTCCTAAAGGATGTCAATGTGAAAACTT
TTCCGTCGAATGTAAACATCGTTTGTTTCGCAATGTTCCAAATATATTAG
CGGAAAAAACAACTCGATTAAATCTTCTCGGAAACCGAATTGATGTGATT
AGAAAATCGGATTTTTTCAAGTTGAATTATCTGAAAGTTTTACAACTGTC
AAACAACAGAATTTCGTCAATTGAGTCGGGAGCGTTTGATAACCTAATCA
ACCTAATCAAATTAAGATTGAACAGAAACCTCATTCAACATCTTCCCGAT
CATTTGTTTTCCAAACTCTCCAAGCTGCAGAAATTAGATCTGCGGGAAAA
TCAACTTCAATGTCTCAATGAACACGTTTTTAGTAAACTTGGAATGCTCA
AAACTTTACTATTGGAAGGTAACAAACTTTACTGGATATCTGAAGCAATA
ACCAAATTAAAACATCTTCGAGAATTACGAATAAGTTCAAACAAACTGCA
CTGTAACTGCCATCTTCACTGGTTGAACGTGTTCCTGAAACTAAAGTCCG
ACATCTTCAAGCCTGACACTCGTTCGGTTGTTTGTGTGACCCCTCAGCGA
TTGAGTCAAATACCGATTTCAACCCTCAGTACCTTTGAATTTCAATGTGC
AAATGAAGAAAACACCTGTCAACCAGACAGAAAAGTGTGTCCAAAACAAT
GCACATGTTCTCAAGACGGGATCGTTAATTGCACTGGTAAACAGCTTACG
AACATCCCCCAGGATCTTCCGACAAATACCATTGAACTAGATTTACAAAA
TAATAGCATCACGATTCTCAGACAAGGATTTCTATCAAAATATAAATTAT
TGAAAAAAATAATTTTAACGCAAAATGGAATGGTCGACATTGAACCAGGA
GCATTTATCGGTTTACAGCAACTAACGGCTTTATATTTAAACATGAACAA
TTTAAGAACGATAAGACGAAATGCTTTCAACGGACTGTCTTCATTAATGT
TTTTATATTTACACAATAACGAAATTGAATGCCTGCCAACCGGTACATTC
GAAGGGGTCAAGAGACTTTACTTGTTGCATTTGTCAGAAAATAAACTTTC
TGCTCTGAAGGAAGAAGTCCTGAGACCTCTCGTAAAACTAAGATATCTAT
ATCTGGTCCACAATCCTTTGTATTGTGACTGCAAAATACTGTGGTTAGTT
CAAGTTTTGAAACTCAAGGAAGTCAATGCGACCCCAGTGGCATCATGTGT
TGGTCCCAGTAGCGCCCATGGAATAGCCGTAAAGAGTCTCCAGAATTACA
ATTTTCAGTGTAATTCTGAATCTGATATTAAATACGATACTCATGATGAA
AACTGTGTTCCGAAGGTCATTTGTCCACATAAATGCTCTTGCTCTTCAGA
AATCGTCAACTGTTCGGGAGTCGGTCTGAGTTCGCTTCCTGAAAAGATCT
TCCCTTCAACGACCACTCTAATTTTATCTCACAATGACATCAAAAACTTA
GATCAAATTTATTCAGTTCATCAGGCATCGAATTTAGTTAAATTAGACTT
GTCTAACAATCAAATTGAAAATATTAAACCGGACACGTTTAGCAAAAGCA
CCAAATTGAAAGAAATAAACCTCAGTTCAAACAAATTAAAATGCGTCAAT
AATGAAACGTTCAAACATTTAATAGAACTAGAAATATTACAACTCAACGA
CAATCATATTAGCTGCATCGGAACAAATTCTTTTAAATTTAATACAAATC
TGAAATATCTAATGTTAAACAATAACGAACTTCATTGTGACTGTCGTCTG
AAATGGTTATCCGAATGGTCGCGGAACAACTACGGTATTCTTGGAAGTCT
AAGACTTCCAACTTGCCAATCACCGCCAATTTTGAAAGGAACTCCGCTTC
CTAATTTGGATGAAAAGTATTTTGTATGTGAAGGTAACAAATCTTCGAAG
GAAGAGACATCTTCATGTGCTAAAGCTAATTTTAGCTATTCTTGCTGTTT
AGACATGAAATGCAATAAAATTCCAAAGTGTCCGTCTAAATGCAAATGTG
AATCCACGAGAATCGATTGTAGTGAACTTCAGCTGAAGGAAATCCCAACA
GAAATTCCTCCAAATACGACGGAACTATATCTCGACAGAAATGATCTCAA
AACCCTTAATGAATCATCATTTAAAAATCTAATAAATCTAAAAACTTTGG
TCCTCAGTTATAATGGTATCACAGAAATCAATAAAGATGTGTTGACCCCT
TTGAAAAATTTGGAAACATTAGTTTTGAGTTTCAATAAATTGCAATGCAT
ACATCAAGATGCTTTCAAGGACCTTTCAAATTTAAAAGTCTTAATACTTC
AAAGTAATGATGTTTCTACGATCCCGTTTCAAGCATTTCGAGACTTAACA
AATCTTAATAACATTGCTCTTGGTCAAAACCCATTCCATTGTGATTGTAA
TATAAAATGGCTGAATCAGTTCTTTTTGGACAGATTTTTGGACAATGGGA
TTTCCCTCTGTGCCAGTCCTGAAAGGATGAAATTAAAATCAATTTATCAT
TCAAAACCCACTGAGTTTATCTGTTCAGAAGAAACCGAAGACACTTATAT
CACTGCCAAATGTGACGCTTGTATGAAAACTCCGTGTCAAAATAACGGTA
AATGTTCACTGATTACACATCATGATTACATTTGCGATTGTCCTAATCCT
TTTCATGGGAAAAGTTGTGAAAAAAGAATAAATGCTTGTTTTGGTCAACC
GTGTAGAAATGGAGGTATTTGTAAAAATACTGATAATTTCGGAAATTATG
AATGTGTTTGTCCCAGTGGTTTCCGTGGTCCAAAATGCACTGAGAATATA
GACGATTGTGGAGGTCACAAATGTGAAAATGGTGCAACCTGTGTAGACCA
AGTGAATAAATACAGCTGTAAATGTCCAAATGGTTTCAGAGGAAAGTTTT
GTGAGAGCAAATTCCTCTATTGCCACGATAAAAATCCCTGCGAGAATTCT
GGACATTGTGAACCGCTTTCCAATAATGACTATAAATGTTCTTGTACAAA
AGGATGGGAAGGAAAAAACTGTGAACAAAATATCGATGATTGTAAGTACA
ATGTTTGCAAAAATGAAGCAAAATGTGAGGACTTGGTAAATGGTTACAAA
TGTATATGCAGACCGGGTTATGTTGGAACTTACTGTGAAGAACCAGCATG
GAAACCGTATAAACTAAAAACGAATCTTTCCAGGAGAGATATTGATAGAA
GTGAAGTCTCAAAGCATTTCACATCCATAAATGAAGTAATATCTGAATCT
GTTTGCGCATATCATGAATGTTTGAATAATGGAGTTTGTGTAAATGAAGA
TATGAATAAACAAAAGTCGTATTGTAAATGCAAGCCAGGATATTCGGGTC
CTTTCTGTCAGTATTTAAATAGTTTATATTTTGGTAAAGACTCACATATT
GAAATTCATCCACCTTCAAGAGGATTTTTAATGCCAAAAGGAAACATTTC
CCTAAAATTTATAACTAATTCTTCATCCGGATTGATTCTCTATCAAGGGT
TCGATAAGAGCTACTTGGTTGTAAATCTATTTCGAGGACATATAAAAATA
AGTTATAACATTGGCGATAAAGATATCGGACCCGATGGTTTTTCAATGGA
CGTGGTCAATGATAATAAATTACATTATCTGAATATCGAAATAGTTGGTG
AAAATTTAACAATGTACCTCAATGGGAAAGTACACTTCACTCTGAAGTCC
AAGTACCTAATGACCAATCAATATATGGCACTCGACACCGGGATATTTAT
TGGTGGAGCACCGAAAAAAATCCTTAATACTGCAATACAAAACCATCATT
TCGATAACGACTCAGATTTTACTGGATGCATCGAATCGTTGCTTATCAAC
CGGAAAAAAATCGACTTTTCCAAATACATGTCAAAGTCCGTGAACGTTAA
ACCCGGATGTGGAGATTTAATATCGAAAACCGCTCAAGAATTACCATCGT
CAGAAGTTCCAACACAAGACATAGAAGTACCGATTAAGTCAACCAAAAGT
TTGCCAGTCAAAAGCACAATATGTAGCAAGCCGGGCGTTTGTTCCAATAA
TGGCGTTTGTCACGAAGTAAATGAGAAAAATCGAAAATATAAATGCGTTT
GCAAAAATGGATTTGTTGGCAGAAAATGTAAAAAAAGAGTTTCCAAATGT
CATGGCAAAACAACTCGAACTTTTATCAAAGATCCAGATACTCATGACAA
TTGTTTATCAATAAAAAAGTTCCAATACCGAGTTTGTAAAGGAACTTGCT
CTAATAATCGAATGCAAGCAGATAGCAACAGGAACTTTTATCAAAGATCT
ACAGACAACAGTTTATCTCCTTGTTGTCAACCCTCAAAATATACCACGCA
CAAAATACAGTTCAAATGCGATAATGGACGCTTCTATCGCCGTAGCGTTA
CTCTTCCTCGAAGCTGTAAATGTCAAGGAAATTGTCATAGAATTTAAATA
AAAATCAAAGAAACTCTCCCACACAAATCTCATGAATTTCATATCTAACT
CCAATCTGAAAAAAACTTCATATTTTGCCCATATTTTTTTCTGTATAATT
CACTAAAATATTGAATGTAGTGACTTTGACATGCATTTCAGTTGTATTTA
TTGTTGCACCGGTCGGTGTTGTAGTTAGCTCATTTGTATTTCTATCAAAT
TAATAATAAACTGTATACAGTTTATTATTAATTTGATAGAAATACAAATG
AGCTAACTACAACACCGACCGGTGCAACAATAAATACAACTGAAATGCAT
GTCAAAGTCACTACATTCAATATTTTAGTGAATTATACAGAAAAAAATAT
GGGCAAAATATGAAGTTTTTTTCAGATTGGAGTTAGATATGAAATTCATG
AGATTTGTGTGGGAGAGTTTCTTTGATTTTTATTTAAATTCTATGACAAT
TTCCTTGACATTTACAGCTTCGAGGAAGAGTAACGCTACGGCGATAGAAG
CGTCCATTATCGCATTTGAACTGTATTTTGTGCGTGGTATATTTTGAGGG
TTGACAACAAGGAGATAAACTGTTGTCTGTAGATCTTTGATAAAAGTTCC
TGTTGCTATCTGCTTGCATTCGATTATTAGAGCAAGTTCCTTTACAAACT
CGGTATTGGAACTTTTTTATTGATAAACAATTGTCATGAGTATCTGGATC
TTTGATAAAAGTTCGAGTTGTTTTGCCATGACATTTGGAAACTCTTTTTT
TACATTTTCTGCCAACAAATCCATTTTTGCAAACGCATTTATATTTTCGA
TTTTTCTCATTTACTTCGTGACAAACGCCATTATTGGAACAAACGCCCGG
CTTGCTACATATTGTGCTTTTGACTGGCAAACTTTTGGTTGACTTAATCG
GTACTTCTATGTCTTGTGTTGGAACTTCTGACGATGGTAATTCTTGAGCG
GTTTTCGATATTAAATCTCCACATCCGGGTTTAACGTTCACGGACTTTGA
CATGTATTTGGAAAAGTCGATTTTTTTCCGGTTGATAAGCAACGATTCGA
TGCATCCAGTAAAATCTGAGTCGTTATCGAAATGATGGTTTTGTATTGCA
GTATTAAGGATTTTTTTCGGTGCTCCACCAATAAATATCCCGGTGTCGAG
TGCCATATATTGATTGGTCATTAGGTACTTGGACTTCAGAGTGAAGTGTA
CTTTCCCATTGAGGTACATTGTTAAATTTTCACCAACTATTTCGATATTC
AGATAATGTAATTTATTATCATTGACCACGTCCATTGAAAAACCATCGGG
TCCGATATCTTTATCGCCAATGTTATAACTTATTTTTATATGTCCTCGAA
ATAGATTTACAACCAAGTAGCTCTTATCGAACCCTTGATAGAGAATCAAT
CCGGATGAAGAATTAGTTATAAATTTTAGGGAAATGTTTCCTTTTGGCAT
TAAAAATCCTCTTGAAGGTGGATGAATTTCAATATGTGAGTCTTTACCAA
AATATAAACTATTTAAATACTGACAGAAAGGACCCGAATATCCTGGCTTG
CATTTACAATACGACTTTTGTTTATTCATATCTTCATTTACACAAACTCC
ATTATTCAAACATTCATGATATGCGCAAACAGATTCAGATATTACTTCAT
TTATGGATGTGAAATGCTTTGAGACTTCACTTCTATCAATATCTCTCCTG
GAAAGATTCGTTTTTAGTTTATACGGTTTCCATGCTGGTTCTTCACAGTA
AGTTCCAACATAACCCGGTCTGCATATACATTTGTAACCATTTACCAAGT
CCTCACATTTTGCTTCATTTTTGCAAACATTGTACTTACAATCATCGATA
TTTTGTTCACAGTTTTTTCCTTCCCATCCTTTTGTACAAGAACATTTATA
GTCATTATTGGAAAGCGGTTCACAATGTCCAGAATTCTCGCAGGGATTTT
TATCGTGGCAATAGAGGAATTTGCTCTCACAAAACTTTCCTCTGAAACCA
TTTGGACATTTACAGCTGTATTTATTCACTTGGTCTACACAGGTTGCACC
ATTTTCACATTTGTGACCTCCACAATCGTCTATATTCTCAGTGCATTTTG
GACCACGGAAACCACTGGGACAAACACATTCATAATTTCCGAAATTATCA
GTATTTTTACAAATACCTCCATTTCTACACGGTTGACCAAAACAAGCATT
TATTCTTTTTTCACAACTTTTCCCATGAAAAGGATTAGGACAATCGCAAA
TGTAATCATGATGTGTAATCAGTGAACATTTACCGTTATTTTGACACGGA
GTTTTCATACAAGCGTCACATTTGGCAGTGATATAAGTGTCTTCGGTTTC
TTCTGAACAGATAAACTCAGTGGGTTTTGAATGATAAATTGATTTTAATT
TCATCCTTTCAGGACTGGCACAGAGGGAAATCCCATTGTCCAAAAATCTG
TCCAAAAAGAACTGATTCAGCCATTTTATATTACAATCACAATGGAATGG
GTTTTGACCAAGAGCAATGTTATTAAGATTTGTTAAGTCTCGAAATGCTT
GAAACGGGATCGTAGAAACATCATTACTTTGAAGTATTAAGACTTTTAAA
TTTGAAAGGTCCTTGAAAGCATCTTGATGTATGCATTGCAATTTATTGAA
ACTCAAAACTAATGTTTCCAAATTTTTCAAAGGGGTCAACACATCTTTAT
TGATTTCTGTGATACCATTATAACTGAGGACCAAAGTTTTTAGATTTATT
AGATTTTTAAATGATGATTCATTAAGGGTTTTGAGATCATTTCTGTCGAG
ATATAGTTCCGTCGTATTTGGAGGAATTTCTGTTGGGATTTCCTTCAGCT
GAAGTTCACTACAATCGATTCTCGTGGATTCACATTTGCATTTAGACGGA
CACTTTGGAATTTTATTGCATTTCATGTCTAAACAGCAAGAATAGCTAAA
ATTAGCTTTAGCACATGAAGATGTCTCTTCCTTCGAAGATTTGTTACCTT
CACATACAAAATACTTTTCATCCAAATTAGGAAGCGGAGTTCCTTTCAAA
ATTGGCGGTGATTGGCAAGTTGGAAGTCTTAGACTTCCAAGAATACCGTA
GTTGTTCCGCGACCATTCGGATAACCATTTCAGACGACAGTCACAATGAA
GTTCGTTATTGTTTAACATTAGATATTTCAGATTTGTATTAAATTTAAAA
GAATTTGTTCCGATGCAGCTAATATGATTGTCGTTGAGTTGTAATATTTC
TAGTTCTATTAAATGTTTGAACGTTTCATTATTGACGCATTTTAATTTGT
TTGAACTGAGGTTTATTTCTTTCAATTTGGTGCTTTTGCTAAACGTGTCC
GGTTTAATATTTTCAATTTGATTGTTAGACAAGTCTAATTTAACTAAATT
CGATGCCTGATGAACTGAATAAATTTGATCTAAGTTTTTGATGTCATTGT
GAGATAAAATTAGAGTGGTCGTTGAAGGGAAGATCTTTTCAGGAAGCGAA
CTCAGACCGACTCCCGAACAGTTGACGATTTCTGAAGAGCAAGAGCATTT
ATGTGGACAAATGACCTTCGGAACACAGTTTTCATCATGAGTATCGTATT
TAATATCAGATTCAGAATTACACTGAAAATTGTAATTCTGGAGACTCTTT
ACGGCTATTCCATGGGCGCTACTGGGACCAACACATGATGCCACTGGGGT
CGCATTGACTTCCTTGAGTTTCAAAACTTGAACTAACCACAGTATTTTGC
AGTCACAATACAAAGGATTGTGGACCAGATATAGATATCTTAGTTTTACG
AGAGGTCTCAGGACTTCTTCCTTCAGAGCAGAAAGTTTATTTTCTGACAA
ATGCAACAAGTAAAGTCTCTTGACCCCTTCGAATGTACCGGTTGGCAGGC
ATTCAATTTCGTTATTGTGTAAATATAAAAACATTAATGAAGACAGTCCG
TTGAAAGCATTTCGTCTTATCGTTCTTAAATTGTTCATGTTTAAATATAA
AGCCGTTAGTTGCTGTAAACCGATAAATGCTCCTGGTTCAATGTCGACCA
TTCCATTTTGCGTTAAAATTATTTTTTTCAATAATTTATATTTTGATAGA
AATCCTTGTCTGAGAATCGTGATGCTATTATTTTGTAAATCTAGTTCAAT
GGTATTTGTCGGAAGATCCTGGGGGATGTTCGTAAGCTGTTTACCAGTGC
AATTAACGATCCCGTCTTGAGAACATGTGCATTGTTTTGGACACACTTTT
CTGTCTGGTTGACAGGTGTTTTCTTCATTTGCACATTGAAATTCAAAGGT
ACTGAGGGTTGAAATCGGTATTTGACTCAATCGCTGAGGGGTCACACAAA
CAACCGAACGAGTGTCAGGCTTGAAGATGTCGGACTTTAGTTTCAGGAAC
ACGTTCAACCAGTGAAGATGGCAGTTACAGTGCAGTTTGTTTGAACTTAT
TCGTAATTCTCGAAGATGTTTTAATTTGGTTATTGCTTCAGATATCCAGT
AAAGTTTGTTACCTTCCAATAGTAAAGTTTTGAGCATTCCAAGTTTACTA
AAAACGTGTTCATTGAGACATTGAAGTTGATTTTCCCGCAGATCTAATTT
CTGCAGCTTGGAGAGTTTGGAAAACAAATGATCGGGAAGATGTTGAATGA
GGTTTCTGTTCAATCTTAATTTGATTAGGTTGATTAGGTTATCAAACGCT
CCCGACTCAATTGACGAAATTCTGTTGTTTGACAGTTGTAAAACTTTCAG
ATAATTCAACTTGAAAAAATCCGATTTTCTAATCACATCAATTCGGTTTC
CGAGAAGATTTAATCGAGTTGTTTTTTCCGCTAATATATTTGGAACATTG
CGAAACAAACGATGTTTACATTCGACGGAAAAGTTTTCACATTGACATCC
TTTAGGACAAATTTCGACTTCCTCTGATGGATCATTGATCCAAATGGTCG
AGGAAAAACAATATAATGATAATAATAAAATCAAATAGGATTTATAAGTT
ATATCCTTAAAAATAAATTGCATTTTATCC

Design Primers for slit

back to top

protein sequence

>Ddo_016416-protein ID=Ddo_016416-protein|Name=slit|organism=Dugesia dorotocephala|type=polypeptide|length=1532bp
DKMQFIFKDITYKSYLILLLSLYCFSSTIWINDPSEEVEICPKGCQCENF
SVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLS
NNRISSIESGAFDNLINLIKLRLNRNLIQHLPDHLFSKLSKLQKLDLREN
QLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLH
CNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA
NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQN
NSITILRQGFLSKYKLLKKIILTQNGMVDIEPGAFIGLQQLTALYLNMNN
LRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLS
ALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCV
GPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSE
IVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDL
SNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLND
NHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSL
RLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL
DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLK
TLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCI
HQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCN
IKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYI
TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQP
CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQ
VNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTK
GWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAW
KPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNED
MNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNIS
LKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMD
VVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFI
GGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVK
PGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNN
GVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDN
CLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTH
KIQFKCDNGRFYRRSVTLPRSCKCQGNCHRI*
back to top

coding sequence

>Ddo_016416.2.4597 ID=Ddo_016416.2.4597|Name=Ddo_016416.2.4597|organism=Dugesia dorotocephala|type=CDS|length=4596bp
GATAAAATGCAATTTATTTTTAAGGATATAACTTATAAATCCTATTTGAT
TTTATTATTATCATTATATTGTTTTTCCTCGACCATTTGGATCAATGATC
CATCAGAGGAAGTCGAAATTTGTCCTAAAGGATGTCAATGTGAAAACTTT
TCCGTCGAATGTAAACATCGTTTGTTTCGCAATGTTCCAAATATATTAGC
GGAAAAAACAACTCGATTAAATCTTCTCGGAAACCGAATTGATGTGATTA
GAAAATCGGATTTTTTCAAGTTGAATTATCTGAAAGTTTTACAACTGTCA
AACAACAGAATTTCGTCAATTGAGTCGGGAGCGTTTGATAACCTAATCAA
CCTAATCAAATTAAGATTGAACAGAAACCTCATTCAACATCTTCCCGATC
ATTTGTTTTCCAAACTCTCCAAGCTGCAGAAATTAGATCTGCGGGAAAAT
CAACTTCAATGTCTCAATGAACACGTTTTTAGTAAACTTGGAATGCTCAA
AACTTTACTATTGGAAGGTAACAAACTTTACTGGATATCTGAAGCAATAA
CCAAATTAAAACATCTTCGAGAATTACGAATAAGTTCAAACAAACTGCAC
TGTAACTGCCATCTTCACTGGTTGAACGTGTTCCTGAAACTAAAGTCCGA
CATCTTCAAGCCTGACACTCGTTCGGTTGTTTGTGTGACCCCTCAGCGAT
TGAGTCAAATACCGATTTCAACCCTCAGTACCTTTGAATTTCAATGTGCA
AATGAAGAAAACACCTGTCAACCAGACAGAAAAGTGTGTCCAAAACAATG
CACATGTTCTCAAGACGGGATCGTTAATTGCACTGGTAAACAGCTTACGA
ACATCCCCCAGGATCTTCCGACAAATACCATTGAACTAGATTTACAAAAT
AATAGCATCACGATTCTCAGACAAGGATTTCTATCAAAATATAAATTATT
GAAAAAAATAATTTTAACGCAAAATGGAATGGTCGACATTGAACCAGGAG
CATTTATCGGTTTACAGCAACTAACGGCTTTATATTTAAACATGAACAAT
TTAAGAACGATAAGACGAAATGCTTTCAACGGACTGTCTTCATTAATGTT
TTTATATTTACACAATAACGAAATTGAATGCCTGCCAACCGGTACATTCG
AAGGGGTCAAGAGACTTTACTTGTTGCATTTGTCAGAAAATAAACTTTCT
GCTCTGAAGGAAGAAGTCCTGAGACCTCTCGTAAAACTAAGATATCTATA
TCTGGTCCACAATCCTTTGTATTGTGACTGCAAAATACTGTGGTTAGTTC
AAGTTTTGAAACTCAAGGAAGTCAATGCGACCCCAGTGGCATCATGTGTT
GGTCCCAGTAGCGCCCATGGAATAGCCGTAAAGAGTCTCCAGAATTACAA
TTTTCAGTGTAATTCTGAATCTGATATTAAATACGATACTCATGATGAAA
ACTGTGTTCCGAAGGTCATTTGTCCACATAAATGCTCTTGCTCTTCAGAA
ATCGTCAACTGTTCGGGAGTCGGTCTGAGTTCGCTTCCTGAAAAGATCTT
CCCTTCAACGACCACTCTAATTTTATCTCACAATGACATCAAAAACTTAG
ATCAAATTTATTCAGTTCATCAGGCATCGAATTTAGTTAAATTAGACTTG
TCTAACAATCAAATTGAAAATATTAAACCGGACACGTTTAGCAAAAGCAC
CAAATTGAAAGAAATAAACCTCAGTTCAAACAAATTAAAATGCGTCAATA
ATGAAACGTTCAAACATTTAATAGAACTAGAAATATTACAACTCAACGAC
AATCATATTAGCTGCATCGGAACAAATTCTTTTAAATTTAATACAAATCT
GAAATATCTAATGTTAAACAATAACGAACTTCATTGTGACTGTCGTCTGA
AATGGTTATCCGAATGGTCGCGGAACAACTACGGTATTCTTGGAAGTCTA
AGACTTCCAACTTGCCAATCACCGCCAATTTTGAAAGGAACTCCGCTTCC
TAATTTGGATGAAAAGTATTTTGTATGTGAAGGTAACAAATCTTCGAAGG
AAGAGACATCTTCATGTGCTAAAGCTAATTTTAGCTATTCTTGCTGTTTA
GACATGAAATGCAATAAAATTCCAAAGTGTCCGTCTAAATGCAAATGTGA
ATCCACGAGAATCGATTGTAGTGAACTTCAGCTGAAGGAAATCCCAACAG
AAATTCCTCCAAATACGACGGAACTATATCTCGACAGAAATGATCTCAAA
ACCCTTAATGAATCATCATTTAAAAATCTAATAAATCTAAAAACTTTGGT
CCTCAGTTATAATGGTATCACAGAAATCAATAAAGATGTGTTGACCCCTT
TGAAAAATTTGGAAACATTAGTTTTGAGTTTCAATAAATTGCAATGCATA
CATCAAGATGCTTTCAAGGACCTTTCAAATTTAAAAGTCTTAATACTTCA
AAGTAATGATGTTTCTACGATCCCGTTTCAAGCATTTCGAGACTTAACAA
ATCTTAATAACATTGCTCTTGGTCAAAACCCATTCCATTGTGATTGTAAT
ATAAAATGGCTGAATCAGTTCTTTTTGGACAGATTTTTGGACAATGGGAT
TTCCCTCTGTGCCAGTCCTGAAAGGATGAAATTAAAATCAATTTATCATT
CAAAACCCACTGAGTTTATCTGTTCAGAAGAAACCGAAGACACTTATATC
ACTGCCAAATGTGACGCTTGTATGAAAACTCCGTGTCAAAATAACGGTAA
ATGTTCACTGATTACACATCATGATTACATTTGCGATTGTCCTAATCCTT
TTCATGGGAAAAGTTGTGAAAAAAGAATAAATGCTTGTTTTGGTCAACCG
TGTAGAAATGGAGGTATTTGTAAAAATACTGATAATTTCGGAAATTATGA
ATGTGTTTGTCCCAGTGGTTTCCGTGGTCCAAAATGCACTGAGAATATAG
ACGATTGTGGAGGTCACAAATGTGAAAATGGTGCAACCTGTGTAGACCAA
GTGAATAAATACAGCTGTAAATGTCCAAATGGTTTCAGAGGAAAGTTTTG
TGAGAGCAAATTCCTCTATTGCCACGATAAAAATCCCTGCGAGAATTCTG
GACATTGTGAACCGCTTTCCAATAATGACTATAAATGTTCTTGTACAAAA
GGATGGGAAGGAAAAAACTGTGAACAAAATATCGATGATTGTAAGTACAA
TGTTTGCAAAAATGAAGCAAAATGTGAGGACTTGGTAAATGGTTACAAAT
GTATATGCAGACCGGGTTATGTTGGAACTTACTGTGAAGAACCAGCATGG
AAACCGTATAAACTAAAAACGAATCTTTCCAGGAGAGATATTGATAGAAG
TGAAGTCTCAAAGCATTTCACATCCATAAATGAAGTAATATCTGAATCTG
TTTGCGCATATCATGAATGTTTGAATAATGGAGTTTGTGTAAATGAAGAT
ATGAATAAACAAAAGTCGTATTGTAAATGCAAGCCAGGATATTCGGGTCC
TTTCTGTCAGTATTTAAATAGTTTATATTTTGGTAAAGACTCACATATTG
AAATTCATCCACCTTCAAGAGGATTTTTAATGCCAAAAGGAAACATTTCC
CTAAAATTTATAACTAATTCTTCATCCGGATTGATTCTCTATCAAGGGTT
CGATAAGAGCTACTTGGTTGTAAATCTATTTCGAGGACATATAAAAATAA
GTTATAACATTGGCGATAAAGATATCGGACCCGATGGTTTTTCAATGGAC
GTGGTCAATGATAATAAATTACATTATCTGAATATCGAAATAGTTGGTGA
AAATTTAACAATGTACCTCAATGGGAAAGTACACTTCACTCTGAAGTCCA
AGTACCTAATGACCAATCAATATATGGCACTCGACACCGGGATATTTATT
GGTGGAGCACCGAAAAAAATCCTTAATACTGCAATACAAAACCATCATTT
CGATAACGACTCAGATTTTACTGGATGCATCGAATCGTTGCTTATCAACC
GGAAAAAAATCGACTTTTCCAAATACATGTCAAAGTCCGTGAACGTTAAA
CCCGGATGTGGAGATTTAATATCGAAAACCGCTCAAGAATTACCATCGTC
AGAAGTTCCAACACAAGACATAGAAGTACCGATTAAGTCAACCAAAAGTT
TGCCAGTCAAAAGCACAATATGTAGCAAGCCGGGCGTTTGTTCCAATAAT
GGCGTTTGTCACGAAGTAAATGAGAAAAATCGAAAATATAAATGCGTTTG
CAAAAATGGATTTGTTGGCAGAAAATGTAAAAAAAGAGTTTCCAAATGTC
ATGGCAAAACAACTCGAACTTTTATCAAAGATCCAGATACTCATGACAAT
TGTTTATCAATAAAAAAGTTCCAATACCGAGTTTGTAAAGGAACTTGCTC
TAATAATCGAATGCAAGCAGATAGCAACAGGAACTTTTATCAAAGATCTA
CAGACAACAGTTTATCTCCTTGTTGTCAACCCTCAAAATATACCACGCAC
AAAATACAGTTCAAATGCGATAATGGACGCTTCTATCGCCGTAGCGTTAC
TCTTCCTCGAAGCTGTAAATGTCAAGGAAATTGTCATAGAATTTAA
back to top
Gene Groups
slit is similar in sequence to the genes of this group: GG9051
Gene NameGene ID
SMU15036778SMU15036778
slitDdo_016416
slitGsp_007744
slitPgr_016847
slitPmo_017648

Gene Group Protein Sequences

>SMU15036778

MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQL
QCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCN
CHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASE
DKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELD
LKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLN
ENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSEN
KLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETNTPVAA
CLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCS
SDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKL
DLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQL
SENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLG
NHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTC
CSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDR
NHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNK
LQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFH
CDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETE
DAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINAC
FGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGAT
CNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKC
VCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCE
IPAWKPTVLKTLISRRDINQSEMTYENLENEVISESVCAYHECLNNGICI
NGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPR
GNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEG
YSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDT
GIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKS
INVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGIC
KNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDS
QGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKY
STHEIQFKCENGRVYRRAANLPKNCKCVANCLND*
>Ddo_016416 slit
DKMQFIFKDITYKSYLILLLSLYCFSSTIWINDPSEEVEICPKGCQCENF
SVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLS
NNRISSIESGAFDNLINLIKLRLNRNLIQHLPDHLFSKLSKLQKLDLREN
QLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLH
CNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA
NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQN
NSITILRQGFLSKYKLLKKIILTQNGMVDIEPGAFIGLQQLTALYLNMNN
LRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLS
ALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCV
GPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSE
IVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDL
SNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLND
NHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSL
RLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL
DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLK
TLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCI
HQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCN
IKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYI
TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQP
CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQ
VNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTK
GWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAW
KPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNED
MNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNIS
LKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMD
VVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFI
GGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVK
PGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNN
GVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDN
CLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTH
KIQFKCDNGRFYRRSVTLPRSCKCQGNCHRI*
>Gsp_007744 slit
MLIIFKDITYKFYLLLLLTLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDGLFSKLSKLQKLDLRDNQL
QCINENTFNKLTMLKYLLLEGNKIFWISESISKLKNLKELRIKKNKLTCN
CHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASE
DKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELD
LSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLN
ANKLKTIRKNAFSGLSSLMFLFLHGNEIECLPADAFEGVKKLHILHLSEN
KLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIAS
CHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCT
SDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKL
DMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQL
SDNEINCIVVDSFKNNLNLKYLMLNRNPFHCNCNMKWMSEWSRNHHSTLG
NHRLPTCQSPSLLKGTPITHLDEKYFLCDGNASIDQSSESCSEISSAEAC
CSIGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDR
NDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNK
LQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFH
CDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETE
DAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINAC
FGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGEC
VDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCV
CSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQ
PAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNG
DQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGN
ISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYS
MGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGI
FIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSIN
VKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKN
QGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLD
SCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYST
HKIQFKCRKGRKYFRDVNLPKNCKCISNCQSD*
>Pgr_016847 slit
MQTLNINIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSM
ECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNN
RITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQL
QCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCN
CHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASD
SKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELD
LHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLN
GNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSEN
KLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVA
SCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTC
TPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTNPSPLLSLPNLIK
IDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLK
LSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITL
GAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGSSDSEN
SCCSISKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYL
DRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSF
NKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNP
FHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEE
TDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRIN
ACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENG
ASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDY
RCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKL
CDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC
VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPR
GNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG
YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS
GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRA
VNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNG
GVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCL
SLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRI
EFKCDSGRQYFRVVHFVRRCKCLPNCTSK*
>Pmo_017648 slit
MCLYFLLYHDTMYSNMIDILRKIIIIMQKINLFFALLLLFFSICQSYSNT
WYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNR
INVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQ
YLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWI
AEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCA
TPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGI
VKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNS
NEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNND
IECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLN
CNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQDE
EAESESHDEDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVI
LSYNKLKEISNSSPLLALPNLIKIDLSYNEIDHIEADIFMKNSRLKEINL
NSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNR
NPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYF
LCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKV
DCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYN
GITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDV
ATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCA
SPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLI
THHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCP
VGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKF
TYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRN
NAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAG
KSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLD
SLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLS
VNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYL
DGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYF
IGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDL
QTVSSTPVSVSDVCSEPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCN
RKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSF
FHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNCT
SK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.