piwi-1, Ddo_012777 (mRNA) Dugesia dorotocephala

Overview
Namepiwi-1
Unique NameDdo_012777
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length5348
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NotePIWI-1
Homology
BLAST of piwi-1 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 1371.3 bits (3548), Expect = 0
Identity = 660/819 (80.59%), Postives = 730/819 (89.13%), Query Frame = 3
Query: 2772 MDPSNSQT---TRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRS-IAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL 5216
MD +N T RPRRGGLQRRFAIIEPALQPDTV DKIG+DGR V+LKSNYANF I +GPF+MYDVV ENKS+R+KL L YA ++ N PFCFDGRRLFT WH ED T L I D+E+SIR LT+FLKNSEEYYQM+NIVFNN+Q MGQEKIGRQ+F+ SN +S ++EGPSFFKM+NFKILGG+STTITRGTN +GTASTLLYLERINRVLNE++V SVYRRDQID LIGRDIITKYNNKTYRISDIKEM ++DE++LG K+ISY YFKQRYNI LK DKQPFVISR+KRS + P + +N+ EG P E DQSLSIPGELCYLCGFSDSER+NINLQK++G VLKREPRERLNDIRDFCKWT G +++++M SWGM I+EQPITIRGRE+ PVDIFS + KINTKIPDDWKFGE++FD+PKGTAHRFGVLVVDRNP+HFN FIEDVKREIGRLRINYT++++SSCR NEVEDAL +FI+++KVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRK VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENL KNFLTA+ TFQ+KFNTMP R IIYRDGVGDSQLAFTKK+ET+AVMKM+E IYENQ LPQI+YV+VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQKTTKGTASPTNYNVLMDTK TNKKTNEV+ M+PSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK+HRG PP IN+RIRERLFYL
Sbjct: 1 MDSTNVTTDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED--TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEG--------PTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808

HSP 2 Score: 1371.3 bits (3548), Expect = 0
Identity = 660/819 (80.59%), Postives = 730/819 (89.13%), Query Frame = -3
Query:  133 MDPSNSQT---TRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRS-IAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL 2577
MD +N T RPRRGGLQRRFAIIEPALQPDTV DKIG+DGR V+LKSNYANF I +GPF+MYDVV ENKS+R+KL L YA ++ N PFCFDGRRLFT WH ED T L I D+E+SIR LT+FLKNSEEYYQM+NIVFNN+Q MGQEKIGRQ+F+ SN +S ++EGPSFFKM+NFKILGG+STTITRGTN +GTASTLLYLERINRVLNE++V SVYRRDQID LIGRDIITKYNNKTYRISDIKEM ++DE++LG K+ISY YFKQRYNI LK DKQPFVISR+KRS + P + +N+ EG P E DQSLSIPGELCYLCGFSDSER+NINLQK++G VLKREPRERLNDIRDFCKWT G +++++M SWGM I+EQPITIRGRE+ PVDIFS + KINTKIPDDWKFGE++FD+PKGTAHRFGVLVVDRNP+HFN FIEDVKREIGRLRINYT++++SSCR NEVEDAL +FI+++KVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRK VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENL KNFLTA+ TFQ+KFNTMP R IIYRDGVGDSQLAFTKK+ET+AVMKM+E IYENQ LPQI+YV+VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQKTTKGTASPTNYNVLMDTK TNKKTNEV+ M+PSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK+HRG PP IN+RIRERLFYL
Sbjct: 1 MDSTNVTTDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED--TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEG--------PTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808
BLAST of piwi-1 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 911.368 bits (2354), Expect = 0
Identity = 444/828 (53.62%), Postives = 596/828 (71.98%), Query Frame = 3
Query: 2760 SSLSMDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSL--RSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNI--DSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISF-VNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQ--PLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL 5216
+ L + S ++ RGGL+ F I+EP LQP + +K G GR V L+SN+ F++ F MYD V L + KL F+ + K FCFDGRRLFT E WHG D + D+ ++++R +++ L +EEYYQM+N++ NN+Q ++GQE+IG+ YF+S NI D V GP+FF+ +FK+LGGF TT+ RGT G +TLLY+ERINRVLN++SV Y R ID LIGRDIITKYNNKTYRIS+IKEM +D++ E+GG+ +SY EYFK+RYNI L QPFV++R+K+ + + K++ E+ P E D +L+IPGELC+LCGFSD E++N++LQK++G VLKREPRERL+DI +C W N W + ID +P+ I GRE+PP D+ S KIN K+ DDWKFG V+FDI + H V++VDRN + F+ DV++E+ +RI+ + V++C N+VE L + + MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRKVV+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SF VNS KG+ EFHE L KNF A+ F+ +++ +PQR +++RDGVGD+QL FTK +E +A+ ++E IY+ P+PQI+YVIVKKR+ K F G NPNPGT+VD+++VKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT++ KK + MAP+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGKVH+G+NP INERIR RLFYL
Sbjct: 9 AKLEANGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESD--IQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833

HSP 2 Score: 911.368 bits (2354), Expect = 0
Identity = 444/828 (53.62%), Postives = 596/828 (71.98%), Query Frame = -3
Query:  133 SSLSMDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSL--RSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNI--DSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISF-VNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQ--PLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL 2589
+ L + S ++ RGGL+ F I+EP LQP + +K G GR V L+SN+ F++ F MYD V L + KL F+ + K FCFDGRRLFT E WHG D + D+ ++++R +++ L +EEYYQM+N++ NN+Q ++GQE+IG+ YF+S NI D V GP+FF+ +FK+LGGF TT+ RGT G +TLLY+ERINRVLN++SV Y R ID LIGRDIITKYNNKTYRIS+IKEM +D++ E+GG+ +SY EYFK+RYNI L QPFV++R+K+ + + K++ E+ P E D +L+IPGELC+LCGFSD E++N++LQK++G VLKREPRERL+DI +C W N W + ID +P+ I GRE+PP D+ S KIN K+ DDWKFG V+FDI + H V++VDRN + F+ DV++E+ +RI+ + V++C N+VE L + + MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRKVV+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SF VNS KG+ EFHE L KNF A+ F+ +++ +PQR +++RDGVGD+QL FTK +E +A+ ++E IY+ P+PQI+YVIVKKR+ K F G NPNPGT+VD+++VKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT++ KK + MAP+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGKVH+G+NP INERIR RLFYL
Sbjct: 9 AKLEANGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESD--IQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833
BLAST of piwi-1 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 910.598 bits (2352), Expect = 0
Identity = 444/812 (54.68%), Postives = 587/812 (72.29%), Query Frame = 3
Query: 2805 RRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSL--RSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNI--DSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQ--PLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL 5216
RRGGLQ+RF I+EP LQP+ DKIG G+ V L+SN+ F++N + MYD L + KL L K FC+DGRRLFT + W G D TID+ ++S+R +++FL ++EEYYQM+N++ NN+Q +MGQEKIG+ YF+ SN D+V GP+FF+ NFK+LGGF TT+ RGT +G +TLLY+ERINRVLN++SV Y R ID LIGRDI+TKYNNKTYRIS+IKEM I++ E+ G+ +SY +YFK+RYNI L T++QPFV++R+K+ IA + K E A P + D +L+I GELC+LCGFSD E++NI+LQK++G VLKR PRERL+DI FC W ++ WG+ ID P+ I GRE+P D+ S Q+IN KI DDWKFG+V+F++ KG H V++VDRN + + F+ DV+ EI +LR + I V C N+VE +L + ++ +ALVF+PDD+VYAKVK+FT+STGLLTQCVT RNG+NR+D+RR+VV+ K+VMQ+FSK GYDPW I++KM PTMIVG+DTFH+K K+S+ ASVFSI++ FSQY+SF NS KGK EFH+ L+ NF A+ F+ + +P R ++YRDGVGDSQL FTK++E +A+ ++E IY+ +PQI+YVIVKKRI K F G N NPGTIVD+++VKPNF+EF+LVSQ+ T+GTASPTNYNVL DT+ N K + A+ P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAH+LAEL+GKVH+G+ P INERIR RLFYL
Sbjct: 17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSD--IKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK-IARRDKRKEHNENEA------PEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818

HSP 2 Score: 910.598 bits (2352), Expect = 0
Identity = 444/812 (54.68%), Postives = 587/812 (72.29%), Query Frame = -3
Query:  133 RRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSL--RSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNI--DSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQ--PLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL 2544
RRGGLQ+RF I+EP LQP+ DKIG G+ V L+SN+ F++N + MYD L + KL L K FC+DGRRLFT + W G D TID+ ++S+R +++FL ++EEYYQM+N++ NN+Q +MGQEKIG+ YF+ SN D+V GP+FF+ NFK+LGGF TT+ RGT +G +TLLY+ERINRVLN++SV Y R ID LIGRDI+TKYNNKTYRIS+IKEM I++ E+ G+ +SY +YFK+RYNI L T++QPFV++R+K+ IA + K E A P + D +L+I GELC+LCGFSD E++NI+LQK++G VLKR PRERL+DI FC W ++ WG+ ID P+ I GRE+P D+ S Q+IN KI DDWKFG+V+F++ KG H V++VDRN + + F+ DV+ EI +LR + I V C N+VE +L + ++ +ALVF+PDD+VYAKVK+FT+STGLLTQCVT RNG+NR+D+RR+VV+ K+VMQ+FSK GYDPW I++KM PTMIVG+DTFH+K K+S+ ASVFSI++ FSQY+SF NS KGK EFH+ L+ NF A+ F+ + +P R ++YRDGVGDSQL FTK++E +A+ ++E IY+ +PQI+YVIVKKRI K F G N NPGTIVD+++VKPNF+EF+LVSQ+ T+GTASPTNYNVL DT+ N K + A+ P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAH+LAEL+GKVH+G+ P INERIR RLFYL
Sbjct: 17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSD--IKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK-IARRDKRKEHNENEA------PEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818
BLAST of piwi-1 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 275.018 bits (702), Expect = 3.53866e-75
Identity = 222/824 (26.94%), Postives = 365/824 (44.30%), Query Frame = 3
Query: 2808 RGGLQRRF---AIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDD-TTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSV----------CSVYRRDQ--IDALIGRDIITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKIN-TKIPDDWKFGEVRFDIPKGTAHRFG---VLVVDRNPAHFNAFIEDVKREIGRL--RINYTIEAVSSCRGNEVEDALAEFIKINKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFK--DG--GNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGAN 5171
RGG +R F + L K G G A+ L++N+ + Y V E++ LRS L F + + FDG LF E + T + +E+++ +S Q NI+F + ++ ++IGR Y+ N D P I GF TTI + +S +L + ++VL +V C R + L+G I+TKYNNKTYRI DI + ++ + G IS++ YFK +Y + + Q ++S +KR A + +P E CYL G +D RA+ N+ K + + P +R I + + +T+WG++ + + +++ GR +P I + DW E+R +P + + RN + ++ + + G + R+ + R + AL + + + M +V +P DK K + +QCV R S VA K +QM K+G + W + + + MIVG+D +H + GKRS+ A V S++ S++ S E + L + A+ + N++P R I+YRDGVGD L YE +M+ ++T+ ++ P++ V+VKKRIS +FF DG NP PGT++D +V +P +Y+F++VSQ G +PT+YNV+ D + + P +Q++TY L H+Y+NW G +RVP P YAH+LA LVG+ +H+ N
Sbjct: 77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLGKAHT----FDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---NPDD------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGPA-----------------MLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVA-RETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALM--TVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848

HSP 2 Score: 275.018 bits (702), Expect = 3.53866e-75
Identity = 222/824 (26.94%), Postives = 365/824 (44.30%), Query Frame = -3
Query:  178 RGGLQRRF---AIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDD-TTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSV----------CSVYRRDQ--IDALIGRDIITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKIN-TKIPDDWKFGEVRFDIPKGTAHRFG---VLVVDRNPAHFNAFIEDVKREIGRL--RINYTIEAVSSCRGNEVEDALAEFIKINKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFK--DG--GNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGAN 2541
RGG +R F + L K G G A+ L++N+ + Y V E++ LRS L F + + FDG LF E + T + +E+++ +S Q NI+F + ++ ++IGR Y+ N D P I GF TTI + +S +L + ++VL +V C R + L+G I+TKYNNKTYRI DI + ++ + G IS++ YFK +Y + + Q ++S +KR A + +P E CYL G +D RA+ N+ K + + P +R I + + +T+WG++ + + +++ GR +P I + DW E+R +P + + RN + ++ + + G + R+ + R + AL + + + M +V +P DK K + +QCV R S VA K +QM K+G + W + + + MIVG+D +H + GKRS+ A V S++ S++ S E + L + A+ + N++P R I+YRDGVGD L YE +M+ ++T+ ++ P++ V+VKKRIS +FF DG NP PGT++D +V +P +Y+F++VSQ G +PT+YNV+ D + + P +Q++TY L H+Y+NW G +RVP P YAH+LA LVG+ +H+ N
Sbjct: 77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLGKAHT----FDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---NPDD------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGPA-----------------MLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVA-RETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALM--TVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848
BLAST of piwi-1 vs. uniprot
Match: gi|33112431|sp|Q9VKM1|PIWI_DROME (RecName: Full=Protein piwi)

HSP 1 Score: 265.388 bits (677), Expect = 4.22273e-72
Identity = 220/815 (26.99%), Postives = 378/815 (46.38%), Query Frame = 3
Query: 2853 QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCEN--KSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTID-DMELSIRYLTSFLKNSE-EYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRD----------IITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWK--FGEVR-FDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGR--LRINYTIE-AVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPL--PQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFY 5213
+P +V K G DG V L++N+ + Y V E ++ R ++ L+N+A + + FDG +LFT + + +D + ++SI+++ F+ +E + Q++N++ + E +GR F + ++E FKME + G+ T+I R D LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ G+ IS+ EY+ +YNI ++ QP +IS+ N++KA + + + IP ELC + G + R+N L ++M + P++R + +R F N ++ + + W M +D+ ++GR + +I + K+ DW+ F + R P R+ V+ RN ++ + R LRI E + R A+ + ++ + + L +P+D Y+ +K + + TQ VT + NR +A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L ++E + +++ L+T Y L PQ+ Y++V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LV G N +I + E+ FY
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFV-GFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRA--KIEIRE----FKME---LWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK----------NRDKA--------LKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSS----------MGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLV-----GTNLHSIPQNALEKKFY 841

HSP 2 Score: 265.388 bits (677), Expect = 4.22273e-72
Identity = 220/815 (26.99%), Postives = 378/815 (46.38%), Query Frame = -3
Query:  136 QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCEN--KSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTID-DMELSIRYLTSFLKNSE-EYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRD----------IITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWK--FGEVR-FDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGR--LRINYTIE-AVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPL--PQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFY 2496
+P +V K G DG V L++N+ + Y V E ++ R ++ L+N+A + + FDG +LFT + + +D + ++SI+++ F+ +E + Q++N++ + E +GR F + ++E FKME + G+ T+I R D LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ G+ IS+ EY+ +YNI ++ QP +IS+ N++KA + + + IP ELC + G + R+N L ++M + P++R + +R F N ++ + + W M +D+ ++GR + +I + K+ DW+ F + R P R+ V+ RN ++ + R LRI E + R A+ + ++ + + L +P+D Y+ +K + + TQ VT + NR +A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L ++E + +++ L+T Y L PQ+ Y++V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LV G N +I + E+ FY
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFV-GFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRA--KIEIRE----FKME---LWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK----------NRDKA--------LKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSS----------MGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLV-----GTNLHSIPQNALEKKFY 841
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 1369.76 bits (3544), Expect = 0
Identity = 661/826 (80.02%), Postives = 732/826 (88.62%), Query Frame = 3
Query: 2754 FKSSLSMDPSNSQT---TRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIA-PNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL* 5219
F MD +N + RPRRGGLQRRFAIIEPALQPDTV DKIG+DGR V+LKSNYANF I +GPF+MYDVV ENKS+R+KL L YA ++ N PFCFDGRRLFT WH ED T L I D+E+SIR LT+FLKNSEEYYQM+NIVFNN+Q MGQEKIGRQ+F+ SN +S ++EGPSFFKM+NFKILGG+STTITRGTN +GTASTLLYLERINRVLNE++V SVYRRDQID LIGRDIITKYNNKTYRISDIKEM ++DE++LG K+ISY YFKQRYNI LK DKQPFVISR+KRS+ P + +N+ EG P E DQSLSIPGELCYLCGFSDSER+NINLQK++G VLKREPRERLNDIRDFCKWT G +++++M SWGM I+EQPITIRGRE+ PVDIFS + KINTKIPDDWKFGE++FD+PKGTAHRFGVLVVDRNP+HFN FIEDVKREIGRLRINYT++++SSCR NEVEDAL +FI+++KVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRK VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENL KNFLTA+ TFQ+KFNTMP R IIYRDGVGDSQLAFTKK+ET+AVMKM+E IYENQ LPQI+YV+VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQKTTKGTASPTNYNVLMDTK TNKKTNEV+ M+PSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK+HRG PP IN+RIRERLFYL*
Sbjct: 38 FTQIYEMDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED--TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEG--------PTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852

HSP 2 Score: 1369.76 bits (3544), Expect = 0
Identity = 661/826 (80.02%), Postives = 732/826 (88.62%), Query Frame = -3
Query:  130 FKSSLSMDPSNSQT---TRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIA-PNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL* 2595
F MD +N + RPRRGGLQRRFAIIEPALQPDTV DKIG+DGR V+LKSNYANF I +GPF+MYDVV ENKS+R+KL L YA ++ N PFCFDGRRLFT WH ED T L I D+E+SIR LT+FLKNSEEYYQM+NIVFNN+Q MGQEKIGRQ+F+ SN +S ++EGPSFFKM+NFKILGG+STTITRGTN +GTASTLLYLERINRVLNE++V SVYRRDQID LIGRDIITKYNNKTYRISDIKEM ++DE++LG K+ISY YFKQRYNI LK DKQPFVISR+KRS+ P + +N+ EG P E DQSLSIPGELCYLCGFSDSER+NINLQK++G VLKREPRERLNDIRDFCKWT G +++++M SWGM I+EQPITIRGRE+ PVDIFS + KINTKIPDDWKFGE++FD+PKGTAHRFGVLVVDRNP+HFN FIEDVKREIGRLRINYT++++SSCR NEVEDAL +FI+++KVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRK VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENL KNFLTA+ TFQ+KFNTMP R IIYRDGVGDSQLAFTKK+ET+AVMKM+E IYENQ LPQI+YV+VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQKTTKGTASPTNYNVLMDTK TNKKTNEV+ M+PSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK+HRG PP IN+RIRERLFYL*
Sbjct: 38 FTQIYEMDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED--TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEG--------PTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 915.22 bits (2364), Expect = 0
Identity = 447/832 (53.73%), Postives = 594/832 (71.39%), Query Frame = 3
Query: 2760 SSLSMDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSL--RSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNI--DSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISR----MKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQ--PLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL* 5219
+ L + S ++ RGGL+R F I+EP LQP + +K G GR V L+SN+ F++ F MYD V L + KL F+ + K FCFDGRRLFT E WHG D + D+ ++++R +++ L +EEYYQM+N++ NN+Q ++GQE+IG+ YF+S NI D V GP+FF+ +FK+LGGF TT+ RGT G +TLLY+ERINRVLN++SV Y R ID LIGRDIITKYNNKTYRIS+IKEM +D++ E+GG+ +SY EYFK+RYNI L QPFV++R M+R + E E P E D +L+IPGELC+LCGFSD E++N++LQK++G VLKREPRERL+DI +C W N W + ID +P+ I GRE+PP D+ S KIN K+ DDWKFG V+FDI + H V++VDRN + F+ DV++E+ +RI+ + V++C N+VE L + + MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRKVV+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE L KNF A+ F+ +++ +PQR +++RDGVGD+QL FTK +E +A+ ++E IY+ P+PQI+YVIVKKR+ K F G NPNPGT+VD+++VKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT++ KK + MAP+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGKVH+G+NP INERIR RLFYL*
Sbjct: 9 AKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESD--IQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837

HSP 2 Score: 915.22 bits (2364), Expect = 0
Identity = 447/832 (53.73%), Postives = 594/832 (71.39%), Query Frame = -3
Query:  130 SSLSMDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCENKSL--RSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNI--DSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYRISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISR----MKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQ--PLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL* 2589
+ L + S ++ RGGL+R F I+EP LQP + +K G GR V L+SN+ F++ F MYD V L + KL F+ + K FCFDGRRLFT E WHG D + D+ ++++R +++ L +EEYYQM+N++ NN+Q ++GQE+IG+ YF+S NI D V GP+FF+ +FK+LGGF TT+ RGT G +TLLY+ERINRVLN++SV Y R ID LIGRDIITKYNNKTYRIS+IKEM +D++ E+GG+ +SY EYFK+RYNI L QPFV++R M+R + E E P E D +L+IPGELC+LCGFSD E++N++LQK++G VLKREPRERL+DI +C W N W + ID +P+ I GRE+PP D+ S KIN K+ DDWKFG V+FDI + H V++VDRN + F+ DV++E+ +RI+ + V++C N+VE L + + MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRKVV+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE L KNF A+ F+ +++ +PQR +++RDGVGD+QL FTK +E +A+ ++E IY+ P+PQI+YVIVKKR+ K F G NPNPGT+VD+++VKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT++ KK + MAP+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGKVH+G+NP INERIR RLFYL*
Sbjct: 9 AKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESD--IQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 237.269 bits (604), Expect = 9.29724e-64
Identity = 192/720 (26.67%), Postives = 331/720 (45.97%), Query Frame = 3
Query: 3171 NSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVY-------------RRDQIDALIGRDIITKYNNKTYRISDIKEMA-IDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLS--IPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDI-FSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNP-AHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIK-----INKVHMALVFIPDDKVYAKVKNFTM------STGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFF----KDGG---NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL* 5219
N E + N++F ++ + KIGR YF E +I G+ T+I N DG LL + ++V+ SV + + I+ L+G+ ++T +NN+ YRI+DI E + GG++ISYR+YFK Y + ++ +QP ++S K+ + G +E D L IP ELC L G +D + L + + + P++R + +F + + ++ + WG+ I++ + I +M P I F + ++ ++K + G +L+ ++ N ++ + + R+ + + + + E+ L E + + V L + +D+ Y +K F S +L Q + + N VA +Q+ +KLG + W + + + M+VGLD +H G+ RSV A V S +A +++ S + + E L L+ + + + N +P+ +YRDGV D QL + +K E E K+ E+ + P ++Y +V+KRI+ + + K+ G NPNPGTIVD V + N Y+F+LVSQ +GT +PT+Y VL D + P +Q + Y H+Y+NW GT+RVP P YAH+LA +VG+ + A P + + +RLFYL*
Sbjct: 306 NFSECPMVYNVLFKRIENSLRMVKIGRDYFYP---------EKKIVLDRRRMEIWPGYVTSIQ---NFDG--GLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVS------------KSNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-------VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK-PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQ-NLKAEPSNL---LCDRLFYL* 975

HSP 2 Score: 237.269 bits (604), Expect = 9.29724e-64
Identity = 192/720 (26.67%), Postives = 331/720 (45.97%), Query Frame = -3
Query:  130 NSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVY-------------RRDQIDALIGRDIITKYNNKTYRISDIKEMA-IDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLS--IPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDI-FSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNP-AHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIK-----INKVHMALVFIPDDKVYAKVKNFTM------STGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFF----KDGG---NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFYL* 2178
N E + N++F ++ + KIGR YF E +I G+ T+I N DG LL + ++V+ SV + + I+ L+G+ ++T +NN+ YRI+DI E + GG++ISYR+YFK Y + ++ +QP ++S K+ + G +E D L IP ELC L G +D + L + + + P++R + +F + + ++ + WG+ I++ + I +M P I F + ++ ++K + G +L+ ++ N ++ + + R+ + + + + E+ L E + + V L + +D+ Y +K F S +L Q + + N VA +Q+ +KLG + W + + + M+VGLD +H G+ RSV A V S +A +++ S + + E L L+ + + + N +P+ +YRDGV D QL + +K E E K+ E+ + P ++Y +V+KRI+ + + K+ G NPNPGTIVD V + N Y+F+LVSQ +GT +PT+Y VL D + P +Q + Y H+Y+NW GT+RVP P YAH+LA +VG+ + A P + + +RLFYL*
Sbjct: 306 NFSECPMVYNVLFKRIENSLRMVKIGRDYFYP---------EKKIVLDRRRMEIWPGYVTSIQ---NFDG--GLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVS------------KSNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-------VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK-PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQ-NLKAEPSNL---LCDRLFYL* 975
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 110.923 bits (276), Expect = 3.60158e-24
Identity = 91/335 (27.16%), Postives = 153/335 (45.67%), Query Frame = 3
Query: 4260 KVHMALVFIPDDKVYAKVKNF-TMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPT------------MIVGLDTFHSKTGK----RSVQASVFSISAKFSQYISFVNSSKGKNEFH--------ENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFF----KDG----GNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRG 5165
K+ + + + +D+ Y +VK F + G++TQC+ R+ D+ + + K+ G+N +++P M+ G+D H + + +SV A V S+ + Y + + K E E++ N L +++ P+R I YRDGV + Q K+E A+ + + E P I Y++V+KR ++FF KDG GN GT+VD+ + ++FYL S + +GT+ P +Y+VL D N ++E LQ TY L H+Y ++ P PT+YAH LA G+ G
Sbjct: 664 KLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM------KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTF--YKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978

HSP 2 Score: 110.923 bits (276), Expect = 3.60158e-24
Identity = 91/335 (27.16%), Postives = 153/335 (45.67%), Query Frame = -3
Query:  184 KVHMALVFIPDDKVYAKVKNF-TMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPT------------MIVGLDTFHSKTGK----RSVQASVFSISAKFSQYISFVNSSKGKNEFH--------ENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFF----KDG----GNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRG 1089
K+ + + + +D+ Y +VK F + G++TQC+ R+ D+ + + K+ G+N +++P M+ G+D H + + +SV A V S+ + Y + + K E E++ N L +++ P+R I YRDGV + Q K+E A+ + + E P I Y++V+KR ++FF KDG GN GT+VD+ + ++FYL S + +GT+ P +Y+VL D N ++E LQ TY L H+Y ++ P PT+YAH LA G+ G
Sbjct: 664 KLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM------KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTF--YKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 108.227 bits (269), Expect = 2.1796e-23
Identity = 91/318 (28.62%), Postives = 145/318 (45.60%), Query Frame = 3
Query: 4263 VHMALVFIPDDK-VYAKVKNF-TMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPT----------MIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKM---LETIYENQPLPQILYVIVKKRISVKFF----KD----GGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 5138
+ + +V +P VYA+VK + GL TQCV +N + + +++ + K+ GIN + P+ + +G D H G K S+ A V S+ A S+Y + V+ + E ++LA + F P R I YRDGV + Q +E +A+ + LE Y+ P I +V+V+KR + F KD GN GT VD+ + P ++FYL S +GT+ P++Y+VL D N +A +Q +TY L H Y ++ +P P +YAH +A
Sbjct: 584 LQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKNVNKP--------SPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ----PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD-------DNRFSA---DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879

HSP 2 Score: 108.227 bits (269), Expect = 2.1796e-23
Identity = 91/318 (28.62%), Postives = 145/318 (45.60%), Query Frame = -3
Query:  211 VHMALVFIPDDK-VYAKVKNF-TMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPT----------MIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKM---LETIYENQPLPQILYVIVKKRISVKFF----KD----GGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1086
+ + +V +P VYA+VK + GL TQCV +N + + +++ + K+ GIN + P+ + +G D H G K S+ A V S+ A S+Y + V+ + E ++LA + F P R I YRDGV + Q +E +A+ + LE Y+ P I +V+V+KR + F KD GN GT VD+ + P ++FYL S +GT+ P++Y+VL D N +A +Q +TY L H Y ++ +P P +YAH +A
Sbjct: 584 LQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKNVNKP--------SPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ----PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD-------DNRFSA---DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879
BLAST of piwi-1 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = 3
Query: 2874 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 5216
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861

HSP 2 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = -3
Query:  133 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 2475
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = 3
Query: 2874 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 5216
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861

HSP 2 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = -3
Query:  133 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 2475
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = 3
Query: 2874 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 5216
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861

HSP 2 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = -3
Query:  133 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 2475
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = 3
Query: 2874 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 5216
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861

HSP 2 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = -3
Query:  133 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 2475
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = 3
Query: 2874 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 5216
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861

HSP 2 Score: 261.922 bits (668), Expect = 3.26917e-71
Identity = 214/817 (26.19%), Postives = 357/817 (43.70%), Query Frame = -3
Query:  133 KIGRDGRAVNLKSNYANFTINTDGPFFMYDV----VCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDT-TATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV------------YRRDQIDALIGRDIITKYNNKTYRISDIK--EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI--NTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 2475
K G G V L +N+ T + Y + + E + LRS L F + + FDG LF + + + T +D+ ++I S Q NI+F + +M ++IGR Y+ ++ P I GF+T+I + NS +L + ++VL +V ++ LIG ++TKYNNKTYR+ DI + + G +S+ EY++++YN + KQP ++S+ KR P G +P ++ IP ELCYL G +D R + N+ K + + P +R ++ + + + WG++ D ++ GR + I + N + D K I + ++ RN N+ I+++ + + + + EV+D ++++ + + + + DK A K +QCV R + +A K +QM K+G + W +++ + MIVG+D +H T G+RS+ V SI+ +++ S E + L A+ + S MP R I+YRDGVGD QL YE + L++I P++ ++VKKR++ +FF G NP PGT++D +V +P +Y+F++VSQ G+ SPT+YNV+ D + + P +Q++TY L H+Y+NW G IRVP P YAH+LA LVG+ +HR N N RL+YL
Sbjct: 104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPG-------------GTLP----GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVM--AIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 265.388 bits (677), Expect = 4.87452e-73
Identity = 220/815 (26.99%), Postives = 378/815 (46.38%), Query Frame = 3
Query: 2853 QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCEN--KSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTID-DMELSIRYLTSFLKNSE-EYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRD----------IITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWK--FGEVR-FDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGR--LRINYTIE-AVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPL--PQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFY 5213
+P +V K G DG V L++N+ + Y V E ++ R ++ L+N+A + + FDG +LFT + + +D + ++SI+++ F+ +E + Q++N++ + E +GR F + ++E FKME + G+ T+I R D LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ G+ IS+ EY+ +YNI ++ QP +IS+ N++KA + + + IP ELC + G + R+N L ++M + P++R + +R F N ++ + + W M +D+ ++GR + +I + K+ DW+ F + R P R+ V+ RN ++ + R LRI E + R A+ + ++ + + L +P+D Y+ +K + + TQ VT + NR +A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L ++E + +++ L+T Y L PQ+ Y++V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LV G N +I + E+ FY
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFV-GFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRA--KIEIRE----FKME---LWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK----------NRDKA--------LKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSS----------MGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLV-----GTNLHSIPQNALEKKFY 841

HSP 2 Score: 265.388 bits (677), Expect = 4.87452e-73
Identity = 220/815 (26.99%), Postives = 378/815 (46.38%), Query Frame = -3
Query:  136 QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCEN--KSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTID-DMELSIRYLTSFLKNSE-EYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRD----------IITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWK--FGEVR-FDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGR--LRINYTIE-AVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPL--PQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFY 2496
+P +V K G DG V L++N+ + Y V E ++ R ++ L+N+A + + FDG +LFT + + +D + ++SI+++ F+ +E + Q++N++ + E +GR F + ++E FKME + G+ T+I R D LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ G+ IS+ EY+ +YNI ++ QP +IS+ N++KA + + + IP ELC + G + R+N L ++M + P++R + +R F N ++ + + W M +D+ ++GR + +I + K+ DW+ F + R P R+ V+ RN ++ + R LRI E + R A+ + ++ + + L +P+D Y+ +K + + TQ VT + NR +A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L ++E + +++ L+T Y L PQ+ Y++V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LV G N +I + E+ FY
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFV-GFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRA--KIEIRE----FKME---LWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK----------NRDKA--------LKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSS----------MGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLV-----GTNLHSIPQNALEKKFY 841
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 265.388 bits (677), Expect = 4.87452e-73
Identity = 220/815 (26.99%), Postives = 378/815 (46.38%), Query Frame = 3
Query: 2853 QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCEN--KSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTID-DMELSIRYLTSFLKNSE-EYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRD----------IITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWK--FGEVR-FDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGR--LRINYTIE-AVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPL--PQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFY 5213
+P +V K G DG V L++N+ + Y V E ++ R ++ L+N+A + + FDG +LFT + + +D + ++SI+++ F+ +E + Q++N++ + E +GR F + ++E FKME + G+ T+I R D LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ G+ IS+ EY+ +YNI ++ QP +IS+ N++KA + + + IP ELC + G + R+N L ++M + P++R + +R F N ++ + + W M +D+ ++GR + +I + K+ DW+ F + R P R+ V+ RN ++ + R LRI E + R A+ + ++ + + L +P+D Y+ +K + + TQ VT + NR +A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L ++E + +++ L+T Y L PQ+ Y++V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LV G N +I + E+ FY
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFV-GFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRA--KIEIRE----FKME---LWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK----------NRDKA--------LKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSS----------MGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLV-----GTNLHSIPQNALEKKFY 841

HSP 2 Score: 265.388 bits (677), Expect = 4.87452e-73
Identity = 220/815 (26.99%), Postives = 378/815 (46.38%), Query Frame = -3
Query:  136 QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDVVCEN--KSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTID-DMELSIRYLTSFLKNSE-EYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRD----------IITKYNNKTYRISDIK-EMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWK--FGEVR-FDIPKGTAHRFGVLVVDRNPAHFNAFIEDVKREIGR--LRINYTIE-AVSSCRGNEVEDALAEFIKINKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPL--PQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGANPPTINERIRERLFY 2496
+P +V K G DG V L++N+ + Y V E ++ R ++ L+N+A + + FDG +LFT + + +D + ++SI+++ F+ +E + Q++N++ + E +GR F + ++E FKME + G+ T+I R D LL E ++V+ ++ + RR + +D ++T YNN+TYRI+D+ G+ IS+ EY+ +YNI ++ QP +IS+ N++KA + + + IP ELC + G + R+N L ++M + P++R + +R F N ++ + + W M +D+ ++GR + +I + K+ DW+ F + R P R+ V+ RN ++ + R LRI E + R A+ + ++ + + L +P+D Y+ +K + + TQ VT + NR +A K +Q+ KLGY PW I L ++ M +G D S + KR+ A + S+ + S Y S V + L A+ +Q + +P R + YRDGV L ++E + +++ L+T Y L PQ+ Y++V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT SPT+YNVL + ++P +Q++TY + HLY+NW GT RVP YA +LA LV G N +I + E+ FY
Sbjct: 82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFV-GFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRA--KIEIRE----FKME---LWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK----------NRDKA--------LKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDP-KLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSS----------MGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLV-----GTNLHSIPQNALEKKFY 841
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 265.388 bits (677), Expect = 6.62023e-73
Identity = 226/832 (27.16%), Postives = 380/832 (45.67%), Query Frame = 3
Query: 2757 KSSLSMDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMY--DVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDD------TTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFK--ILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQID-------ALIGRDIITKYNNKTYRISDIKEMAID-DEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI-NTKIPDDWKFGEVRFDIPKGTAH--RFGVLVVDRNPAHFNAFIEDVKREIGRLRINYT---IEAVSSCRGNEVEDALAEFIKIN-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXXKV--VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYEN---QPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 5153
KSSLS + PR RR +P + K G G + +++NY + + Y D + ++ R + +FL + + FDG +F + +D T + +++E+ I+ + S E +Q++N++ + + + R Y+ + + +ENF+ + G+ T+I + N S + + ++ R ++ S RD D A++G I+T YNNKTYRI D+ + + + ISY +Y+K+RYNI ++ KQP V+SR N+R N DQ++ I EL G +D+ RA+ ++M + P R+ +R F K + Q+ E + SW + +D + I R +PP I +QKI DW E R H R+ V+ RN F++ R +++N E + R A+ + ++ M ++ P+++ Y+ +K T + + +Q VT + + R + + +A K V+QM +KL PW + + + M VG D HS K +S A V ++ K S +Y S VN E E ++ N A+ ++Q + ++P+R + +RDGVGD QL E + L+ IY++ Q ++ ++IV KRI+ ++F NP PGT+VD+ + P Y+F+LVSQ GT SPT+YNV+ D N LQ ++Y +TH+Y+N+ GTIRVP HYAH+LA LV +
Sbjct: 64 KSSLSAVQMHKSEGDPRGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG---YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---PTDKNIRGGN----------------DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849

HSP 2 Score: 265.388 bits (677), Expect = 6.62023e-73
Identity = 226/832 (27.16%), Postives = 380/832 (45.67%), Query Frame = -3
Query:  196 KSSLSMDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMY--DVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDD------TTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFK--ILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQID-------ALIGRDIITKYNNKTYRISDIKEMAID-DEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI-NTKIPDDWKFGEVRFDIPKGTAH--RFGVLVVDRNPAHFNAFIEDVKREIGRLRINYT---IEAVSSCRGNEVEDALAEFIKIN-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXRKV--VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYEN---QPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 2592
KSSLS + PR RR +P + K G G + +++NY + + Y D + ++ R + +FL + + FDG +F + +D T + +++E+ I+ + S E +Q++N++ + + + R Y+ + + +ENF+ + G+ T+I + N S + + ++ R ++ S RD D A++G I+T YNNKTYRI D+ + + + ISY +Y+K+RYNI ++ KQP V+SR N+R N DQ++ I EL G +D+ RA+ ++M + P R+ +R F K + Q+ E + SW + +D + I R +PP I +QKI DW E R H R+ V+ RN F++ R +++N E + R A+ + ++ M ++ P+++ Y+ +K T + + +Q VT + + R + + +A K V+QM +KL PW + + + M VG D HS K +S A V ++ K S +Y S VN E E ++ N A+ ++Q + ++P+R + +RDGVGD QL E + L+ IY++ Q ++ ++IV KRI+ ++F NP PGT+VD+ + P Y+F+LVSQ GT SPT+YNV+ D N LQ ++Y +TH+Y+N+ GTIRVP HYAH+LA LV +
Sbjct: 64 KSSLSAVQMHKSEGDPRGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG---YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---PTDKNIRGGN----------------DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 262.692 bits (670), Expect = 2.06548e-72
Identity = 221/816 (27.08%), Postives = 377/816 (46.20%), Query Frame = 3
Query: 2808 RGGLQRRFAIIEPAL-QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMY--DVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDD------TTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFK--ILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQID-------ALIGRDIITKYNNKTYRISDIKEMAID-DEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI-NTKIPDDWKFGEVRFDIPKGTAH--RFGVLVVDRNPAHFNAFIEDVKREIGRLRINYT---IEAVSSCRGNEVEDALAEFIKIN-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXXKV--VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYEN---QPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 5153
RG ++ R I + +P + K G G + +++NY + + Y D + ++ R + +FL + + FDG +F + +D T + +++E+ I+ + S E +Q++N++ + + + R Y+ + + +ENF+ + G+ T+I + N S + + ++ R ++ S RD D A++G I+T YNNKTYRI D+ + + + ISY +Y+K+RYNI ++ KQP V+SR N+R N DQ++ I EL G +D+ RA+ ++M + P R+ +R F K + Q+ E + SW + +D + I R +PP I +QKI DW E R H R+ V+ RN F++ R +++N E + R A+ + ++ M ++ P+++ Y+ +K T + + +Q VT + + R + + +A K V+QM +KL PW + + + M VG D HS K +S A V ++ K S +Y S VN E E ++ N A+ ++Q + ++P+R + +RDGVGD QL E + L+ IY++ Q ++ ++IV KRI+ ++F NP PGT+VD+ + P Y+F+LVSQ GT SPT+YNV+ D N LQ ++Y +TH+Y+N+ GTIRVP HYAH+LA LV +
Sbjct: 9 RGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG---YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---PTDKNIRGGN----------------DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778

HSP 2 Score: 262.692 bits (670), Expect = 2.06548e-72
Identity = 221/816 (27.08%), Postives = 377/816 (46.20%), Query Frame = -3
Query:  196 RGGLQRRFAIIEPAL-QPDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMY--DVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLFTCEAWHGGEDD------TTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFK--ILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSVYRRDQID-------ALIGRDIITKYNNKTYRISDIKEMAID-DEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKI-NTKIPDDWKFGEVRFDIPKGTAH--RFGVLVVDRNPAHFNAFIEDVKREIGRLRINYT---IEAVSSCRGNEVEDALAEFIKIN-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNXXXXXRKV--VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYEN---QPLPQILYVIVKKRISVKFFKDGGNPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 2541
RG ++ R I + +P + K G G + +++NY + + Y D + ++ R + +FL + + FDG +F + +D T + +++E+ I+ + S E +Q++N++ + + + R Y+ + + +ENF+ + G+ T+I + N S + + ++ R ++ S RD D A++G I+T YNNKTYRI D+ + + + ISY +Y+K+RYNI ++ KQP V+SR N+R N DQ++ I EL G +D+ RA+ ++M + P R+ +R F K + Q+ E + SW + +D + I R +PP I +QKI DW E R H R+ V+ RN F++ R +++N E + R A+ + ++ M ++ P+++ Y+ +K T + + +Q VT + + R + + +A K V+QM +KL PW + + + M VG D HS K +S A V ++ K S +Y S VN E E ++ N A+ ++Q + ++P+R + +RDGVGD QL E + L+ IY++ Q ++ ++IV KRI+ ++F NP PGT+VD+ + P Y+F+LVSQ GT SPT+YNV+ D N LQ ++Y +TH+Y+N+ GTIRVP HYAH+LA LV +
Sbjct: 9 RGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG---YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---PTDKNIRGGN----------------DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 257.299 bits (656), Expect = 3.24753e-70
Identity = 220/816 (26.96%), Postives = 369/816 (45.22%), Query Frame = 3
Query: 2856 PDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDV--VCENKSLRSKLTFLTNYA-KTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV-----------YRRDQIDALIGRDIITKYNNKTYRISDI---KEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHF-NAFIEDVKREIGRLRINYTIEAVSSCRGNEVE---DALAEFIKIN-KVHMALVFIPDDKVYAKVKNFTMS-TGLLTQCVTQRNGSNXXXXXXKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 5216
PD + G G +VN+ NY T + F Y+V S+ ++ +L ++ K KT FDG L+ T +D+EL IR L + Q+ NI+F+ V ++ K R+ F S P + ++ G+ T + + +L + +R+L + +V + Y+ L+G ++T+YNN+TY+I+DI + EI+ G SY EY+KQ +NI +K QP + S K+ G E RE Q IP ELCYL G D R++ L + + + P +R + F + SN +E + SWG+++ I GR+M I+ ++ ++ V ++ K +++ RN + ++++K+ L +N + + S + ++ AL I +N ++ + + D YA +K S + +Q + + N + V K V+QM KLG W + + MI G+D++H + + SV A V SI++ +SQ+ S + E L+ +F A+ ++ + +P IIYRDG+GD QL YE + E + N+ +I Y++V+KRI+ + F G NP PGT+VD+ + K N Y+F+LVSQ +GT +PT+Y VL D P ++Q+++Y L LY+NW GT+R+P YAH+LA L+G+ + R + E + E+LFYL
Sbjct: 117 PDLIY---GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT---FDGNTLYLPILLPNKM--TVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCT--SYVEYYKQYHNINIKDVNQPLIYS------------IKKSRGIPAE-----RENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD----------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867

HSP 2 Score: 257.299 bits (656), Expect = 3.24753e-70
Identity = 220/816 (26.96%), Postives = 369/816 (45.22%), Query Frame = -3
Query:  133 PDTVVDKIGRDGRAVNLKSNYANFTINTDGPFFMYDV--VCENKSLRSKLTFLTNYA-KTRKNKTPFCFDGRRLFTCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQCLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTNSDGTASTLLYLERINRVLNESSVCSV-----------YRRDQIDALIGRDIITKYNNKTYRISDI---KEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSIAPNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINLQKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITIRGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRNPAHF-NAFIEDVKREIGRLRINYTIEAVSSCRGNEVE---DALAEFIKIN-KVHMALVFIPDDKVYAKVKNFTMS-TGLLTQCVTQRNGSNXXXXXRKVVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDSQLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGG----NPNPGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEVAAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-VHRGANPPTINERIRERLFYL 2493
PD + G G +VN+ NY T + F Y+V S+ ++ +L ++ K KT FDG L+ T +D+EL IR L + Q+ NI+F+ V ++ K R+ F S P + ++ G+ T + + +L + +R+L + +V + Y+ L+G ++T+YNN+TY+I+DI + EI+ G SY EY+KQ +NI +K QP + S K+ G E RE Q IP ELCYL G D R++ L + + + P +R + F + SN +E + SWG+++ I GR+M I+ ++ ++ V ++ K +++ RN + ++++K+ L +N + + S + ++ AL I +N ++ + + D YA +K S + +Q + + N + V K V+QM KLG W + + MI G+D++H + + SV A V SI++ +SQ+ S + E L+ +F A+ ++ + +P IIYRDG+GD QL YE + E + N+ +I Y++V+KRI+ + F G NP PGT+VD+ + K N Y+F+LVSQ +GT +PT+Y VL D P ++Q+++Y L LY+NW GT+R+P YAH+LA L+G+ + R + E + E+LFYL
Sbjct: 117 PDLIY---GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT---FDGNTLYLPILLPNKM--TVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCT--SYVEYYKQYHNINIKDVNQPLIYS------------IKKSRGIPAE-----RENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD----------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
The following BLAST results are available for this feature:
BLAST of piwi-1 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000000e+080.59RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000000e+053.62RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000000e+054.68RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE3.538660e-7526.94RecName: Full=Piwi-like protein 1[more]
gi|33112431|sp|Q9VKM1|PIWI_DROME4.222730e-7226.99RecName: Full=Protein piwi[more]
back to top
BLAST of piwi-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150261770.000000e+080.02SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159470.000000e+053.73SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150001119.297240e-6426.67Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150329883.601580e-2427.16SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
SMU150389362.179600e-2328.62dd_smedV4_3861_0_1|m.24705|m.16148[more]
back to top
BLAST of piwi-1 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|3.269170e-7126.19piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|3.269170e-7126.19PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|3.269170e-7126.19PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|3.269170e-7126.19PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|3.269170e-7126.19PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|4.874520e-7326.99piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|4.874520e-7326.99piwi, isoform B [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|6.620230e-7327.16aubergine, isoform A [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|2.065480e-7227.08aubergine, isoform C [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|3.247530e-7026.96argonaute 3, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_012777 ID=Ddo_012777|Name=piwi-1|organism=Dugesia dorotocephala|type=mRNA|length=5348bp
TCTTTTTTTTTGATAAGTCTAAATTGTATTATAACATCAAATTGTAAAAA
TAACGAGTACAAAATGCAGCAGTAGTAGTAATAGAATTAGGAAATGCAAA
TAGAACACACAGAGAGACGACAAAGACGGCTACAAGTAGAACAGGCGCTC
GCGGATGCGCTCGTTGATGGTGGGCGGGTTGGCGCCCCGGTGCACCTTGC
CCACGAGCTCGGCCAGGCGGTGCGCGTAATGCGTGGGCACCGGCACGCGG
ATCGTGCCCATCCAGTTGAAGTAGAGGTGCGTGAGCGAGTACGTGATCTG
CTGCAGCACGCTGGGCGCCATCGCCGCCACCTCGTTCGTCTTCTTGTTCG
TCATCTTGGTGTCCATGAGCACGTTGTAGTTGGTCGGTGACGCCGTTCCC
TTGGTAGTTTTCTGGGACACGAGATAGAATTCGTAGAAGTTCGGCTTGAC
GACCTTCTCGTCGACGATCGTGCCCGGATTGGGGTTGCCGCCGTCCTTGA
AGAACTTGACGCTGATGCGCTTCTTAACGATCACGTAGAGGATCTGCGGC
AGCGGCTGGTTCTCGTAGATCGTCTCGAGCATCTTCATGACGGCCTCCGT
CTCGTACTTCTTGGTGAAGGCGAGCTGCGAGTCGCCCACGCCGTCGCGGT
AAATGATGAAGCGCTGAGGCATCGTGTTGAACTTGCTCTGGAACGTGTTG
ATTGCCGTCAGGAAGTTCTTGGCCAGGTTCTCGTGGAACTCGTTCTTGCC
CTTCGAGCTGTTGACGAAGCTGATGTACTGGGAGAACTTGGCGCTAATCG
AGAACACGGACGCCTGCACGGACCGCTTGCCCGTTTTCGAGTGGAACGTG
TCGAGTCCCACGATCATGGTGGGCGCCATCTTGAGGTTGATGCCCCACGG
GTCGTAGCCGAGCTTAGAGAACATCTGCATGACGGACTTGTCGGCCACCA
CCTTTCTGCGGCGGTCGTCGCGGTTGCTGCCGTTGCGCTGGGTGACGCAT
TGGGTCAGCAGGCCAGTTGACATGGTGAAGTTCTTGACCTTGGCGTAGAC
TTTGTCGTCGGGGATGAACACGAGAGCCATGTGAACCTTGTTGATCTTGA
TGAACTCGGCCAGAGCGTCCTCGACCTCGTTGCCACGACATGACGATACG
GCCTCGATCGTGTAGTTGATCCGGAGGCGGCCGATCTCGCGCTTCACGTC
CTCAATGAACGCGTTAAAATGCGCAGGGTTTCGGTCGACCACGAGCACTC
CGAAACGATGCGCCGTGCCTTTAGGGATGTCGAATCTCACTTCTCCAAAC
TTCCAGTCGTCAGGAATCTTGGTGTTGATCTTCTGGTCCATCGAGAAGAT
ATCGACCGGCGGCATTTCTCGACCGCGGATCGTGATCGGCTGCTCGTCAA
TGTTCATTCCCCAACTCGTCATGAATTCGCGAGTCTGTGCGCCATTGCTC
GTCCACTTACAGAAATCCCGGATGTCGTTGAGTCTCTCGCGCGGTTCTCT
CTTCAAAACGCCTCCCATGCTCTTCTGGAGATTGATATTAGCGCGCTCGC
TGTCGCTGAACCCGCACAAATAACACAATTCTCCGGGAATCGATAGACTC
TGGTCGGGCTCTCTCGGTGGAACGTCTCCCTCTTCCGCCGCGCCTTCCGC
TTTATTCTTGTTCCTCAAATTCGGCGCGATCGATCGTTTCATCCGGGAAA
TCACAAATGGTTGCTTGTCAGTCTTCAAAGCAATATTATACCGCTGTTTG
AAGTACTCGCGATAGGAAATCCGCTTCCCGCCCAACTCGATTTCATCGTC
AATCGCCATTTCTTTGATATCGGAAATCCTATACGTTTTATTGTTATATT
TCGTGATGATATCTCGCCCGATCAGCGCGTCGATTTGATCCCGTCGATAC
ACGCTACACACACTACTCTCATTCAAAACACGATTGATCCGCTCCAAATA
CAACAGCGTCGACGCAGTCCCATCCGAATTGGTTCCTCGGGTGATTGTCG
TAGAAAATCCACCTAAAATCTTGAAATTTTCCATTTTAAAGAAACTCGGA
CCCTCTTTTAACGACACAGAATCGATATTCGATGAAATAAAATACTGGCG
ACCGATTTTCTCTTGTCCCATCAAACACTGTACGTTATTGAATACGATAT
TCACCATTTGGTAGTACTCCTCGCTGTTCTTCAGGAAGCTCGTCAAGTAC
CGAATAGATAATTCCATGTCGTCTATCGTCAAAGTTGCGGTGGTGTCGTC
TTCCCCCCCGTGCCACGCTTCACACGTGAACAATCGCCTCCCATCAAAAC
AAAATGGCGTCTTATTTTTACGGGTTTTCGCGTAATTCGTCAAGAAAGTC
AATTTCGATCGTAAGCTTTTATTCTCACACACCACGTCGTACATGAAAAA
CGGGCCATCCGTATTAATGGTGAAATTCGCGTAATTCGATTTTAAATTAA
CGGCGCGTCCGTCGCGGCCGATTTTATCGACCACGGTGTCAGGTTGAAGT
GCCGGTTCGATGATGGCGAATCGTCGTTGGAGACCACCTCGTCTCGGTCG
GGTTGTTTGGCTGTTACTGGGATCCATCGACAAAGAGCTTTTAAAATAGA
ATAACAAATTAGCTAACGGTTGATTTAAACAAATTAAATTTTTGTTTTTT
TGGTAATTCGTTACCGTTTTTATTAATAAAAACGGTAACGAATTACCAAA
AAAACAAAAATTTAATTTGTTTAAATCAACCGTTAGCTAATTTGTTATTC
TATTTTAAAAGCTCTTTGTCGATGGATCCCAGTAACAGCCAAACAACCCG
ACCGAGACGAGGTGGTCTCCAACGACGATTCGCCATCATCGAACCGGCAC
TTCAACCTGACACCGTGGTCGATAAAATCGGCCGCGACGGACGCGCCGTT
AATTTAAAATCGAATTACGCGAATTTCACCATTAATACGGATGGCCCGTT
TTTCATGTACGACGTGGTGTGTGAGAATAAAAGCTTACGATCGAAATTGA
CTTTCTTGACGAATTACGCGAAAACCCGTAAAAATAAGACGCCATTTTGT
TTTGATGGGAGGCGATTGTTCACGTGTGAAGCGTGGCACGGGGGGGAAGA
CGACACCACCGCAACTTTGACGATAGACGACATGGAATTATCTATTCGGT
ACTTGACGAGCTTCCTGAAGAACAGCGAGGAGTACTACCAAATGGTGAAT
ATCGTATTCAATAACGTACAGTGTTTGATGGGACAAGAGAAAATCGGTCG
CCAGTATTTTATTTCATCGAATATCGATTCTGTGTCGTTAAAAGAGGGTC
CGAGTTTCTTTAAAATGGAAAATTTCAAGATTTTAGGTGGATTTTCTACG
ACAATCACCCGAGGAACCAATTCGGATGGGACTGCGTCGACGCTGTTGTA
TTTGGAGCGGATCAATCGTGTTTTGAATGAGAGTAGTGTGTGTAGCGTGT
ATCGACGGGATCAAATCGACGCGCTGATCGGGCGAGATATCATCACGAAA
TATAACAATAAAACGTATAGGATTTCCGATATCAAAGAAATGGCGATTGA
CGATGAAATCGAGTTGGGCGGGAAGCGGATTTCCTATCGCGAGTACTTCA
AACAGCGGTATAATATTGCTTTGAAGACTGACAAGCAACCATTTGTGATT
TCCCGGATGAAACGATCGATCGCGCCGAATTTGAGGAACAAGAATAAAGC
GGAAGGCGCGGCGGAAGAGGGAGACGTTCCACCGAGAGAGCCCGACCAGA
GTCTATCGATTCCCGGAGAATTGTGTTATTTGTGCGGGTTCAGCGACAGC
GAGCGCGCTAATATCAATCTCCAGAAGAGCATGGGAGGCGTTTTGAAGAG
AGAACCGCGCGAGAGACTCAACGACATCCGGGATTTCTGTAAGTGGACGA
GCAATGGCGCACAGACTCGCGAATTCATGACGAGTTGGGGAATGAACATT
GACGAGCAGCCGATCACGATCCGCGGTCGAGAAATGCCGCCGGTCGATAT
CTTCTCGATGGACCAGAAGATCAACACCAAGATTCCTGACGACTGGAAGT
TTGGAGAAGTGAGATTCGACATCCCTAAAGGCACGGCGCATCGTTTCGGA
GTGCTCGTGGTCGACCGAAACCCTGCGCATTTTAACGCGTTCATTGAGGA
CGTGAAGCGCGAGATCGGCCGCCTCCGGATCAACTACACGATCGAGGCCG
TATCGTCATGTCGTGGCAACGAGGTCGAGGACGCTCTGGCCGAGTTCATC
AAGATCAACAAGGTTCACATGGCTCTCGTGTTCATCCCCGACGACAAAGT
CTACGCCAAGGTCAAGAACTTCACCATGTCAACTGGCCTGCTGACCCAAT
GCGTCACCCAGCGCAACGGCAGCAACCGCGACGACCGCCGCAGAAAGGTG
GTGGCCGACAAGTCCGTCATGCAGATGTTCTCTAAGCTCGGCTACGACCC
GTGGGGCATCAACCTCAAGATGGCGCCCACCATGATCGTGGGACTCGACA
CGTTCCACTCGAAAACGGGCAAGCGGTCCGTGCAGGCGTCCGTGTTCTCG
ATTAGCGCCAAGTTCTCCCAGTACATCAGCTTCGTCAACAGCTCGAAGGG
CAAGAACGAGTTCCACGAGAACCTGGCCAAGAACTTCCTGACGGCAATCA
ACACGTTCCAGAGCAAGTTCAACACGATGCCTCAGCGCTTCATCATTTAC
CGCGACGGCGTGGGCGACTCGCAGCTCGCCTTCACCAAGAAGTACGAGAC
GGAGGCCGTCATGAAGATGCTCGAGACGATCTACGAGAACCAGCCGCTGC
CGCAGATCCTCTACGTGATCGTTAAGAAGCGCATCAGCGTCAAGTTCTTC
AAGGACGGCGGCAACCCCAATCCGGGCACGATCGTCGACGAGAAGGTCGT
CAAGCCGAACTTCTACGAATTCTATCTCGTGTCCCAGAAAACTACCAAGG
GAACGGCGTCACCGACCAACTACAACGTGCTCATGGACACCAAGATGACG
AACAAGAAGACGAACGAGGTGGCGGCGATGGCGCCCAGCGTGCTGCAGCA
GATCACGTACTCGCTCACGCACCTCTACTTCAACTGGATGGGCACGATCC
GCGTGCCGGTGCCCACGCATTACGCGCACCGCCTGGCCGAGCTCGTGGGC
AAGGTGCACCGGGGCGCCAACCCGCCCACCATCAACGAGCGCATCCGCGA
GCGCCTGTTCTACTTGTAGCCGTCTTTGTCGTCTCTCTGTGTGTTCTATT
TGCATTTCCTAATTCTATTACTACTACTGCTGCATTTTGTACTCGTTATT
TTTACAATTTGATGTTATAATACAATTTAGACTTATCAAAAAAAAAGA

Design Primers for piwi-1

back to top

protein sequence

>Ddo_012777-protein ID=Ddo_012777-protein|Name=piwi-1|organism=Dugesia dorotocephala|type=polypeptide|length=816bp
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
back to top

coding sequence

>Ddo_012777.2772.5219 ID=Ddo_012777.2772.5219|Name=Ddo_012777.2772.5219|organism=Dugesia dorotocephala|type=CDS|length=2448bp
ATGGATCCCAGTAACAGCCAAACAACCCGACCGAGACGAGGTGGTCTCCA
ACGACGATTCGCCATCATCGAACCGGCACTTCAACCTGACACCGTGGTCG
ATAAAATCGGCCGCGACGGACGCGCCGTTAATTTAAAATCGAATTACGCG
AATTTCACCATTAATACGGATGGCCCGTTTTTCATGTACGACGTGGTGTG
TGAGAATAAAAGCTTACGATCGAAATTGACTTTCTTGACGAATTACGCGA
AAACCCGTAAAAATAAGACGCCATTTTGTTTTGATGGGAGGCGATTGTTC
ACGTGTGAAGCGTGGCACGGGGGGGAAGACGACACCACCGCAACTTTGAC
GATAGACGACATGGAATTATCTATTCGGTACTTGACGAGCTTCCTGAAGA
ACAGCGAGGAGTACTACCAAATGGTGAATATCGTATTCAATAACGTACAG
TGTTTGATGGGACAAGAGAAAATCGGTCGCCAGTATTTTATTTCATCGAA
TATCGATTCTGTGTCGTTAAAAGAGGGTCCGAGTTTCTTTAAAATGGAAA
ATTTCAAGATTTTAGGTGGATTTTCTACGACAATCACCCGAGGAACCAAT
TCGGATGGGACTGCGTCGACGCTGTTGTATTTGGAGCGGATCAATCGTGT
TTTGAATGAGAGTAGTGTGTGTAGCGTGTATCGACGGGATCAAATCGACG
CGCTGATCGGGCGAGATATCATCACGAAATATAACAATAAAACGTATAGG
ATTTCCGATATCAAAGAAATGGCGATTGACGATGAAATCGAGTTGGGCGG
GAAGCGGATTTCCTATCGCGAGTACTTCAAACAGCGGTATAATATTGCTT
TGAAGACTGACAAGCAACCATTTGTGATTTCCCGGATGAAACGATCGATC
GCGCCGAATTTGAGGAACAAGAATAAAGCGGAAGGCGCGGCGGAAGAGGG
AGACGTTCCACCGAGAGAGCCCGACCAGAGTCTATCGATTCCCGGAGAAT
TGTGTTATTTGTGCGGGTTCAGCGACAGCGAGCGCGCTAATATCAATCTC
CAGAAGAGCATGGGAGGCGTTTTGAAGAGAGAACCGCGCGAGAGACTCAA
CGACATCCGGGATTTCTGTAAGTGGACGAGCAATGGCGCACAGACTCGCG
AATTCATGACGAGTTGGGGAATGAACATTGACGAGCAGCCGATCACGATC
CGCGGTCGAGAAATGCCGCCGGTCGATATCTTCTCGATGGACCAGAAGAT
CAACACCAAGATTCCTGACGACTGGAAGTTTGGAGAAGTGAGATTCGACA
TCCCTAAAGGCACGGCGCATCGTTTCGGAGTGCTCGTGGTCGACCGAAAC
CCTGCGCATTTTAACGCGTTCATTGAGGACGTGAAGCGCGAGATCGGCCG
CCTCCGGATCAACTACACGATCGAGGCCGTATCGTCATGTCGTGGCAACG
AGGTCGAGGACGCTCTGGCCGAGTTCATCAAGATCAACAAGGTTCACATG
GCTCTCGTGTTCATCCCCGACGACAAAGTCTACGCCAAGGTCAAGAACTT
CACCATGTCAACTGGCCTGCTGACCCAATGCGTCACCCAGCGCAACGGCA
GCAACCGCGACGACCGCCGCAGAAAGGTGGTGGCCGACAAGTCCGTCATG
CAGATGTTCTCTAAGCTCGGCTACGACCCGTGGGGCATCAACCTCAAGAT
GGCGCCCACCATGATCGTGGGACTCGACACGTTCCACTCGAAAACGGGCA
AGCGGTCCGTGCAGGCGTCCGTGTTCTCGATTAGCGCCAAGTTCTCCCAG
TACATCAGCTTCGTCAACAGCTCGAAGGGCAAGAACGAGTTCCACGAGAA
CCTGGCCAAGAACTTCCTGACGGCAATCAACACGTTCCAGAGCAAGTTCA
ACACGATGCCTCAGCGCTTCATCATTTACCGCGACGGCGTGGGCGACTCG
CAGCTCGCCTTCACCAAGAAGTACGAGACGGAGGCCGTCATGAAGATGCT
CGAGACGATCTACGAGAACCAGCCGCTGCCGCAGATCCTCTACGTGATCG
TTAAGAAGCGCATCAGCGTCAAGTTCTTCAAGGACGGCGGCAACCCCAAT
CCGGGCACGATCGTCGACGAGAAGGTCGTCAAGCCGAACTTCTACGAATT
CTATCTCGTGTCCCAGAAAACTACCAAGGGAACGGCGTCACCGACCAACT
ACAACGTGCTCATGGACACCAAGATGACGAACAAGAAGACGAACGAGGTG
GCGGCGATGGCGCCCAGCGTGCTGCAGCAGATCACGTACTCGCTCACGCA
CCTCTACTTCAACTGGATGGGCACGATCCGCGTGCCGGTGCCCACGCATT
ACGCGCACCGCCTGGCCGAGCTCGTGGGCAAGGTGCACCGGGGCGCCAAC
CCGCCCACCATCAACGAGCGCATCCGCGAGCGCCTGTTCTACTTGTAG
back to top
Gene Groups
piwi-1 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.