opsin-like, Ddo_008381 (mRNA) Dugesia dorotocephala

Overview
Nameopsin-like
Unique NameDdo_008381
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length2922
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteOpsin-like
Homology
BLAST of opsin-like vs. uniprot
Match: gi|129211|sp|P09241|OPSD_ENTDO (RecName: Full=Rhodopsin [Enteroctopus dofleini])

HSP 1 Score: 318.546 bits (815), Expect = 1.46766e-96
Identity = 154/306 (50.33%), Postives = 229/306 (74.84%), Query Frame = 1
Query:  112 VHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1029
+HP+W +F+ +P+ +Y VG++I VGI G+LGN +V+Y+F+ KSL+TP NMFI++LA+ DL+FSA+NGFPL TIS+F +W +GK+ C++YG +GG+FGF+SINTMA+IS+DRY VI +P K ++ +RA +M++FVW++S++WS P F +G YVPEG TSC+FDYL+ F + MY F++P+ II FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++I+ +++SW+PYA+IAL+A G + + PY AELPVLFAK SA++NP +Y+++HPKFR
Sbjct: 20 IHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISMVIITQFMLSWSPYAIIALLAQFGPAEWVTPYAAELPVLFAKASAIHNPIVYSVSHPKFR 324

HSP 2 Score: 318.546 bits (815), Expect = 1.46766e-96
Identity = 154/306 (50.33%), Postives = 229/306 (74.84%), Query Frame = -1
Query: 1894 VHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 2811
+HP+W +F+ +P+ +Y VG++I VGI G+LGN +V+Y+F+ KSL+TP NMFI++LA+ DL+FSA+NGFPL TIS+F +W +GK+ C++YG +GG+FGF+SINTMA+IS+DRY VI +P K ++ +RA +M++FVW++S++WS P F +G YVPEG TSC+FDYL+ F + MY F++P+ II FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++I+ +++SW+PYA+IAL+A G + + PY AELPVLFAK SA++NP +Y+++HPKFR
Sbjct: 20 IHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISMVIITQFMLSWSPYAIIALLAQFGPAEWVTPYAAELPVLFAKASAIHNPIVYSVSHPKFR 324
BLAST of opsin-like vs. uniprot
Match: gi|3024254|sp|O15973|OPSD1_MIZYE (RecName: Full=Rhodopsin, GQ-coupled; AltName: Full=GQ-rhodopsin [Mizuhopecten yessoensis])

HSP 1 Score: 309.301 bits (791), Expect = 1.57698e-92
Identity = 172/401 (42.89%), Postives = 265/401 (66.08%), Query Frame = 1
Query:   52 NKTANVSKVP-WHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHTNEAYESE 1251
N T N S P W+ ++ VH +W +F V E +HY++GVYI+ VG+ G++GN V+YIF++ KSLR+P N+F+++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+ IS+DRY VI +P Q +++T ++ +M+V VW+ S++ S PPFFG+G Y+PEGFQTSCTFDYLT++ + + +Y+ F+IP+ II CY I++ VR H+ +ML + + M + A +++++ +KI++ + L++ISW+PYA+IAL+A G + P +ELP++ AK+S+M+NP +YA++HPKFR L ++ P L CCC PK K TSV S ++ +S S + + D T G + G T E+
Sbjct: 15 NGTLNRSMTPNTGWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMK-TEDARANNKRARSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITPLVSELPMMLAKSSSMHNPVVYALSHPKFRKALYQRVPWLFCCCKPKEKADFRTSVCSKRSVTRTESVNSDVSSVISNLSDS---TTTLGLTSEGATRANRETS 411

HSP 2 Score: 309.301 bits (791), Expect = 1.57698e-92
Identity = 172/401 (42.89%), Postives = 265/401 (66.08%), Query Frame = -1
Query: 1672 NKTANVSKVP-WHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHTNEAYESE 2871
N T N S P W+ ++ VH +W +F V E +HY++GVYI+ VG+ G++GN V+YIF++ KSLR+P N+F+++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+ IS+DRY VI +P Q +++T ++ +M+V VW+ S++ S PPFFG+G Y+PEGFQTSCTFDYLT++ + + +Y+ F+IP+ II CY I++ VR H+ +ML + + M + A +++++ +KI++ + L++ISW+PYA+IAL+A G + P +ELP++ AK+S+M+NP +YA++HPKFR L ++ P L CCC PK K TSV S ++ +S S + + D T G + G T E+
Sbjct: 15 NGTLNRSMTPNTGWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMK-TEDARANNKRARSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITPLVSELPMMLAKSSSMHNPVVYALSHPKFRKALYQRVPWLFCCCKPKEKADFRTSVCSKRSVTRTESVNSDVSSVISNLSDS---TTTLGLTSEGATRANRETS 411
BLAST of opsin-like vs. uniprot
Match: gi|129209|sp|P24603|OPSD_LOLFO (RecName: Full=Rhodopsin [Loligo forbesii])

HSP 1 Score: 297.36 bits (760), Expect = 1.05621e-88
Identity = 160/351 (45.58%), Postives = 239/351 (68.09%), Query Frame = 1
Query:  112 VHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQ---SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKESS 1155
+HP+W++F+ VP +Y +G++I+ GI G +GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFPL+TIS F W +G C++YG IGG+FG +SI TM +IS+DRY VI +P K ++ ++A IM++FVW++S IW+ P FG+G Y EG +C+FDY+T+ ++ NI + MYI F+ P+ +I FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++IV +L+SW+PYAV+AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR ++ FP ++ CC KE + A A P+ QS E++
Sbjct: 19 IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNI---LCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-NAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQSGGETA 365

HSP 2 Score: 297.36 bits (760), Expect = 1.05621e-88
Identity = 160/351 (45.58%), Postives = 239/351 (68.09%), Query Frame = -1
Query: 1768 VHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQ---SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKESS 2811
+HP+W++F+ VP +Y +G++I+ GI G +GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFPL+TIS F W +G C++YG IGG+FG +SI TM +IS+DRY VI +P K ++ ++A IM++FVW++S IW+ P FG+G Y EG +C+FDY+T+ ++ NI + MYI F+ P+ +I FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++IV +L+SW+PYAV+AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR ++ FP ++ CC KE + A A P+ QS E++
Sbjct: 19 IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNI---LCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-NAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQSGGETA 365
BLAST of opsin-like vs. uniprot
Match: gi|2499376|sp|Q17094|OPSD_ALLSU (RecName: Full=Rhodopsin, partial [Alloteuthis subulata])

HSP 1 Score: 291.197 bits (744), Expect = 1.45358e-86
Identity = 157/347 (45.24%), Postives = 230/347 (66.28%), Query Frame = 1
Query:  112 VHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKES 1152
+H +W++F+ VP +Y +G++I+ GI G GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFP++TIS F W +G+ C++YG IGG+FG SI TM +IS+DRY VI +P K ++ ++A IM+VFVW++S IW+ P FG+G Y EG +C+FDY+T+ + MYI F+ P+ +I FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++IV L+SW+PYA++AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + FP ++ CC KE + A A P+ QS ES
Sbjct: 12 IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGES 357

HSP 2 Score: 291.197 bits (744), Expect = 1.45358e-86
Identity = 157/347 (45.24%), Postives = 230/347 (66.28%), Query Frame = -1
Query: 1771 VHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKES 2811
+H +W++F+ VP +Y +G++I+ GI G GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFP++TIS F W +G+ C++YG IGG+FG SI TM +IS+DRY VI +P K ++ ++A IM+VFVW++S IW+ P FG+G Y EG +C+FDY+T+ + MYI F+ P+ +I FCY+ IV +V HE EM MA+++NA + GA A+++ AKIS++IV L+SW+PYA++AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + FP ++ CC KE + A A P+ QS ES
Sbjct: 12 IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGES 357
BLAST of opsin-like vs. uniprot
Match: gi|3024292|sp|O16005|OPSD_SEPOF (RecName: Full=Rhodopsin [Sepia officinalis])

HSP 1 Score: 283.108 bits (723), Expect = 2.45035e-83
Identity = 169/375 (45.07%), Postives = 247/375 (65.87%), Query Frame = 1
Query:   31 IGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKESS 1155
+G+ + +N+T W ++ E VHP+W++F VP+ +Y +G++I GI G GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFPL+TIS F +W +G C++YGFIGG+FG +SI TM++IS+DRY VI +P K ++ +RA +M++FVW++S +WS P FG+G YV EG +C+FDY+T+ + MYI F P+ II FCY+ IV AV HE EM MA+++NA + GA A+++ AKIS++IV +L+SW+PYAV+AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + + FP +I CC KE + A P+ QS ES+
Sbjct: 1 MGRDIPDNET-------WWYNPTME--VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQSGGESA 365

HSP 2 Score: 283.108 bits (723), Expect = 2.45035e-83
Identity = 169/375 (45.07%), Postives = 247/375 (65.87%), Query Frame = -1
Query: 1768 IGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKESS 2892
+G+ + +N+T W ++ E VHP+W++F VP+ +Y +G++I GI G GN +V+Y+F KSL+TP NMFI++LA D TFS VNGFPL+TIS F +W +G C++YGFIGG+FG +SI TM++IS+DRY VI +P K ++ +RA +M++FVW++S +WS P FG+G YV EG +C+FDY+T+ + MYI F P+ II FCY+ IV AV HE EM MA+++NA + GA A+++ AKIS++IV +L+SW+PYAV+AL+A G + + PY A+LPV+FAK SA++NP IY+++HPKFR + + FP +I CC KE + A P+ QS ES+
Sbjct: 1 MGRDIPDNET-------WWYNPTME--VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQSGGESA 365
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15026624 (SmedSxldir_c84693_g1_i1|m.24953|m.19106)

HSP 1 Score: 724.161 bits (1868), Expect = 0
Identity = 381/419 (90.93%), Postives = 398/419 (94.99%), Query Frame = 1
Query:    7 MSVQSFLSIGQKLIENKTAN---VSKVPWHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHTNEAYESEK 1254
MSVQSF ++G KL+EN T N ++K WHWD +FESIVHPYWR F++VPEVYHYLVGVYIS VGI+GVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG+GNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNF+IPV IIIFCYYQIVKAVR+HELEMLKMAQKMNASHP SMKTGAKKADVQAAKISVIIVFLY++SWTPYA+IALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTS ASATKPSKYQSE+ESSMSQLD EDDKQ VET K Q SGHTNEAYESE+
Sbjct: 13 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQ 431

HSP 2 Score: 724.161 bits (1868), Expect = 0
Identity = 381/419 (90.93%), Postives = 398/419 (94.99%), Query Frame = -1
Query: 1669 MSVQSFLSIGQKLIENKTAN---VSKVPWHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHTNEAYESEK 2916
MSVQSF ++G KL+EN T N ++K WHWD +FESIVHPYWR F++VPEVYHYLVGVYIS VGI+GVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG+GNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNF+IPV IIIFCYYQIVKAVR+HELEMLKMAQKMNASHP SMKTGAKKADVQAAKISVIIVFLY++SWTPYA+IALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTS ASATKPSKYQSE+ESSMSQLD EDDKQ VET K Q SGHTNEAYESE+
Sbjct: 13 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQ 431
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15032968 (SmedSxlregen_c81464_g11_i1|m.21191|m.10162)

HSP 1 Score: 149.058 bits (375), Expect = 1.76872e-38
Identity = 107/346 (30.92%), Postives = 176/346 (50.87%), Query Frame = 1
Query:  145 PEVYHY-LVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATK--PSKYQSEKESSMS 1161
PE + Y + GVYI F+G+ G + N V+ +F +K L TP N+F+ L D + GFP L +SSF W + C +Y F + G SI + +I+++R+ + P QT+K++T+KR+I ++ W +I S PP G+ YV EG Q SC+FD QSK I+ + IG F++ + II CY +I VR EM + K S + K + + + + +++SW PYA++ ++AL + + +P FAK+ + NP IY +N+P+F+ +L K L K + + T ++++ T+ PS Q+ S
Sbjct: 15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIM----LLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTK---SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQGTS 352

HSP 2 Score: 149.058 bits (375), Expect = 1.76872e-38
Identity = 107/346 (30.92%), Postives = 176/346 (50.87%), Query Frame = -1
Query: 1762 PEVYHY-LVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATK--PSKYQSEKESSMS 2778
PE + Y + GVYI F+G+ G + N V+ +F +K L TP N+F+ L D + GFP L +SSF W + C +Y F + G SI + +I+++R+ + P QT+K++T+KR+I ++ W +I S PP G+ YV EG Q SC+FD QSK I+ + IG F++ + II CY +I VR EM + K S + K + + + + +++SW PYA++ ++AL + + +P FAK+ + NP IY +N+P+F+ +L K L K + + T ++++ T+ PS Q+ S
Sbjct: 15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIM----LLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTK---SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQGTS 352
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15028515 (SmedSxldir_c96785_g1_i5|m.39594|m.45818)

HSP 1 Score: 145.591 bits (366), Expect = 5.96592e-37
Identity = 94/300 (31.33%), Postives = 159/300 (53.00%), Query Frame = 1
Query:  145 PEVY-HYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKI---SVIIVFLYLISWTPYAVIALMALTGRRDHLNPY-TAELPVLFAKTSAMYNPFIYAINHP 1020
PE Y +Y + YI +GI G N+LV+ +F +KS+ TP N+FI LA+ DL + GFP LTIS F W + + C Y F + G SI + +++++R VI++P + +K ++ KR+ ++++ W +++ S PP G+ YV EG SC++D +SK I+F IG+ F++ + IIIFCY + L++ + A M S A++ + K+ I +++SW PYA++ ++++ + N P FAK+ +YNP IY ++P
Sbjct: 19 PETYVYYALASYILVIGIIGTAENMLVMLVFIRSKSMWTPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGI----FLVVLLIIIFCYLALF-------LKVQRQATSMRVMIKDSRDLLAERERQRENKLIWMGCNITLAFVLSWGPYALVTILSIFKVLNEKNSLIIVTFPSFFAKSFTIYNPIIYIFSYP 306

HSP 2 Score: 145.591 bits (366), Expect = 5.96592e-37
Identity = 94/300 (31.33%), Postives = 159/300 (53.00%), Query Frame = -1
Query: 1903 PEVY-HYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKI---SVIIVFLYLISWTPYAVIALMALTGRRDHLNPY-TAELPVLFAKTSAMYNPFIYAINHP 2778
PE Y +Y + YI +GI G N+LV+ +F +KS+ TP N+FI LA+ DL + GFP LTIS F W + + C Y F + G SI + +++++R VI++P + +K ++ KR+ ++++ W +++ S PP G+ YV EG SC++D +SK I+F IG+ F++ + IIIFCY + L++ + A M S A++ + K+ I +++SW PYA++ ++++ + N P FAK+ +YNP IY ++P
Sbjct: 19 PETYVYYALASYILVIGIIGTAENMLVMLVFIRSKSMWTPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGI----FLVVLLIIIFCYLALF-------LKVQRQATSMRVMIKDSRDLLAERERQRENKLIWMGCNITLAFVLSWGPYALVTILSIFKVLNEKNSLIIVTFPSFFAKSFTIYNPIIYIFSYP 306
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15030838 (SmedSxlregen_c54053_g1_i1|m.6668|m.37854)

HSP 1 Score: 117.087 bits (292), Expect = 8.51319e-28
Identity = 78/295 (26.44%), Postives = 158/295 (53.56%), Query Frame = 1
Query:  148 EVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIM-LVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1029
+V++Y + ISF I GVL N +++ F ++L++P N+ IM++ I + A+ G P+ +SSF W + + C YGF G S+ M +I++DR+FVIA+P TM + K I + + +YSLI++ PP G+ Y + +TSC+ ++ ++ + I + + ++IP+ + ++CY+ I +R +++ + +++ +K + + +++ + + I+WTPYAVI + G + P ++AK++ + PF++ +++ +FR
Sbjct: 10 KVFYYSKAIVISFFLIFGVLLNGTIMFTFFHNRALKSPTNLLIMAIIINNFLL-AIFGIPMDIVSSFYQYWIFSDVGCRFYGFAMFFTGLNSVAIMTVIAIDRFFVIAKP--TMAAHITKNVIYLSICGCLVYSLIFTIPPLIGWNEYKLDKSKTSCSVNFESRDPIFYSYTIVILVFCYIIPIIVNLYCYFYIYMTIR-------HISRNTKVTTDNAVEQN-RKIERKLLTVAIAVFVSFFIAWTPYAVICTWTVFGDPSVIPLIVYTTPSVWAKSTVVVYPFVFVLSNQQFR 293

HSP 2 Score: 117.087 bits (292), Expect = 8.51319e-28
Identity = 78/295 (26.44%), Postives = 158/295 (53.56%), Query Frame = -1
Query: 1894 EVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIM-LVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 2775
+V++Y + ISF I GVL N +++ F ++L++P N+ IM++ I + A+ G P+ +SSF W + + C YGF G S+ M +I++DR+FVIA+P TM + K I + + +YSLI++ PP G+ Y + +TSC+ ++ ++ + I + + ++IP+ + ++CY+ I +R +++ + +++ +K + + +++ + + I+WTPYAVI + G + P ++AK++ + PF++ +++ +FR
Sbjct: 10 KVFYYSKAIVISFFLIFGVLLNGTIMFTFFHNRALKSPTNLLIMAIIINNFLL-AIFGIPMDIVSSFYQYWIFSDVGCRFYGFAMFFTGLNSVAIMTVIAIDRFFVIAKP--TMAAHITKNVIYLSICGCLVYSLIFTIPPLIGWNEYKLDKSKTSCSVNFESRDPIFYSYTIVILVFCYIIPIIVNLYCYFYIYMTIR-------HISRNTKVTTDNAVEQN-RKIERKLLTVAIAVFVSFFIAWTPYAVICTWTVFGDPSVIPLIVYTTPSVWAKSTVVVYPFVFVLSNQQFR 293
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15010993 (SmedAsxldir_c46418_g1_i1|m.8227|m.22320)

HSP 1 Score: 105.531 bits (262), Expect = 6.67283e-24
Identity = 95/321 (29.60%), Postives = 160/321 (49.84%), Query Frame = 1
Query:  139 LVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNG-FPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFG----NYVPEGFQTSCTFDYLT--QSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVR-----LHELEMLKMAQKMNASHPASMKTGAKKADVQAAK------ISVIIVFLYLISWTPYAVIALMA---LTGRRDHLNPYTAELP---VLFAKTSAMYNPFIYAINHPKFR 1029
L+P V Y+ + I G LG+ LV+Y+ +K+LRTP NMFI++LAI DL A + F ++ + SF+ W +G+ C++ G G +S ++ I+LDRY VI P T SL + AI +++ +W+ SLI ++P G N + T CT + K + ++I + +VIP++I+ Y +I + ++ LH+ + L+ + + SH + T +K D+Q + +S+ IVF ISW P +I ++ L + P + + +L TSA NP +Y + FR
Sbjct: 58 LIPLVLSYIAMIVI------GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKAN-HTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNLHKKD-LESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVF--AISWLPLNLINMIMDLYLMYNESTVGPMSLRIQSICLLMVLTSACTNPILYGWLNDNFR 366

HSP 2 Score: 105.531 bits (262), Expect = 6.67283e-24
Identity = 95/321 (29.60%), Postives = 160/321 (49.84%), Query Frame = -1
Query: 1894 LVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNG-FPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFG----NYVPEGFQTSCTFDYLT--QSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVR-----LHELEMLKMAQKMNASHPASMKTGAKKADVQAAK------ISVIIVFLYLISWTPYAVIALMA---LTGRRDHLNPYTAELP---VLFAKTSAMYNPFIYAINHPKFR 2784
L+P V Y+ + I G LG+ LV+Y+ +K+LRTP NMFI++LAI DL A + F ++ + SF+ W +G+ C++ G G +S ++ I+LDRY VI P T SL + AI +++ +W+ SLI ++P G N + T CT + K + ++I + +VIP++I+ Y +I + ++ LH+ + L+ + + SH + T +K D+Q + +S+ IVF ISW P +I ++ L + P + + +L TSA NP +Y + FR
Sbjct: 58 LIPLVLSYIAMIVI------GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKAN-HTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNLHKKD-LESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVF--AISWLPLNLINMIMDLYLMYNESTVGPMSLRIQSICLLMVLTSACTNPILYGWLNDNFR 366
BLAST of opsin-like vs. RefSeq Human
Match: gi|15150803|ref|NP_150598.1| (melanopsin isoform 1 [Homo sapiens])

HSP 1 Score: 204.912 bits (520), Expect = 5.65449e-56
Identity = 121/302 (40.07%), Postives = 182/302 (60.26%), Query Frame = 1
Query:  142 VPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAK---KADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1038
VP+ HY +G I VG+ G+LGNL V+Y F ++SLRTP NMFI++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDRY VI +P T + +RA +L+ VWLY+L WS PPFFG+ YVPEG TSC++DY++ + + + + F +P+ III+CY I +A+R E + Q A + +++ + AKI ++++ L+++SW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 361

HSP 2 Score: 204.912 bits (520), Expect = 5.65449e-56
Identity = 121/302 (40.07%), Postives = 182/302 (60.26%), Query Frame = -1
Query: 1885 VPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAK---KADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 2781
VP+ HY +G I VG+ G+LGNL V+Y F ++SLRTP NMFI++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDRY VI +P T + +RA +L+ VWLY+L WS PPFFG+ YVPEG TSC++DY++ + + + + F +P+ III+CY I +A+R E + Q A + +++ + AKI ++++ L+++SW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 361
BLAST of opsin-like vs. RefSeq Human
Match: gi|71999143|ref|NP_001025186.1| (melanopsin isoform 2 [Homo sapiens])

HSP 1 Score: 197.593 bits (501), Expect = 2.2805e-53
Identity = 122/313 (38.98%), Postives = 182/313 (58.15%), Query Frame = 1
Query:  142 VPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAK---KADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1038
VP+ HY +G I VG+ G+LGNL V+Y F A +SLRTP NMFI++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDRY VI +P T + +RA +L+ VWLY+L WS PPFFG+ YVPEG TSC++DY++ + + + + F +P+ III+CY I +A+R E + Q A + +++ + AKI ++++ L+++SW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372

HSP 2 Score: 197.593 bits (501), Expect = 2.2805e-53
Identity = 122/313 (38.98%), Postives = 182/313 (58.15%), Query Frame = -1
Query: 1885 VPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAK---KADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 2781
VP+ HY +G I VG+ G+LGNL V+Y F A +SLRTP NMFI++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDRY VI +P T + +RA +L+ VWLY+L WS PPFFG+ YVPEG TSC++DY++ + + + + F +P+ III+CY I +A+R E + Q A + +++ + AKI ++++ L+++SW PY+ +AL+A G L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372
BLAST of opsin-like vs. RefSeq Human
Match: gi|38678524|ref|NP_859528.1| (opsin-5 [Homo sapiens])

HSP 1 Score: 156.762 bits (395), Expect = 2.63798e-40
Identity = 104/290 (35.86%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  163 LVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1026
+ G Y++ +GI GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P A+I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYAV+++ + GR D + + +P L AK++AMYNP IY + KF
Sbjct: 35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313

HSP 2 Score: 156.762 bits (395), Expect = 2.63798e-40
Identity = 104/290 (35.86%), Postives = 155/290 (53.45%), Query Frame = -1
Query: 1897 LVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 2760
+ G Y++ +GI GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P A+I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYAV+++ + GR D + + +P L AK++AMYNP IY + KF
Sbjct: 35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313
BLAST of opsin-like vs. RefSeq Human
Match: gi|767939386|ref|XP_011512652.1| (PREDICTED: opsin-5 isoform X3 [Homo sapiens])

HSP 1 Score: 150.599 bits (379), Expect = 3.07047e-38
Identity = 115/369 (31.17%), Postives = 175/369 (47.43%), Query Frame = 1
Query:  178 ISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR-IQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHT--NEAYESEK*FVEN 1269
+S+ I GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P A+I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYAV+++ + GR D + + +P L AK++AMYNP IY + KF Q TT S+ ++ +K QL ++ + +++ H+ E E E V N
Sbjct: 2 LSYGRILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEDKGRLWHQLSCGENSEMTASSETLGTKAHSPLQETREGENEAVGN 359

HSP 2 Score: 150.599 bits (379), Expect = 3.07047e-38
Identity = 115/369 (31.17%), Postives = 175/369 (47.43%), Query Frame = -1
Query: 1654 ISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR-IQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHT--NEAYESEK*FVEN 2745
+S+ I GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P A+I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYAV+++ + GR D + + +P L AK++AMYNP IY + KF Q TT S+ ++ +K QL ++ + +++ H+ E E E V N
Sbjct: 2 LSYGRILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEDKGRLWHQLSCGENSEMTASSETLGTKAHSPLQETREGENEAVGN 359
BLAST of opsin-like vs. RefSeq Human
Match: gi|767939382|ref|XP_011512650.1| (PREDICTED: opsin-5 isoform X2 [Homo sapiens])

HSP 1 Score: 150.984 bits (380), Expect = 3.39535e-38
Identity = 115/371 (31.00%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  178 ISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR-IQLEXXXXXXXXXXXXXXXERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHT--NEAYESEK*FVENRN 1275
+S+ I GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P A+I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYAV+++ + GR D + + +P L AK++AMYNP IY + KF Q TT S+ ++ +K QL ++ + +++ H+ E E E V N
Sbjct: 2 LSYGRILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEDKGRLWHQLSCGENSEMTASSETLGTKAHSPLQETREGENEAVGGNN 361

HSP 2 Score: 150.984 bits (380), Expect = 3.39535e-38
Identity = 115/371 (31.00%), Postives = 175/371 (47.17%), Query Frame = -1
Query: 1648 ISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR-IQLEXXXXXXXXXXXXXXKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVETNKGQAASGHT--NEAYESEK*FVENRN 2745
+S+ I GN VLY+ + K P + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDRY I L K A I L +W Y+ W+T P G G+YVPE F TSCT D+ L Q S G +F + + ++P A+I+F Y +I+ V+ E+ ++++SH MK K++++I +LI+W PYAV+++ + GR D + + +P L AK++AMYNP IY + KF Q TT S+ ++ +K QL ++ + +++ H+ E E E V N
Sbjct: 2 LSYGRILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEDKGRLWHQLSCGENSEMTASSETLGTKAHSPLQETREGENEAVGGNN 361
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17137098|ref|NP_477096.1| (rhodopsin 5, isoform A [Drosophila melanogaster])

HSP 1 Score: 202.986 bits (515), Expect = 8.8092e-57
Identity = 116/320 (36.25%), Postives = 197/320 (61.56%), Query Frame = 1
Query:   94 SDFESIVHPYWREFELVPEVYHYLVGVYISFV--GIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-FGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1041
++++ +VH +WR F P YH G YI+F+ ++ + GN LV++IF+++KSLRTP N+ I++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DRY I+ P L+ + +++++F WL++ +S P F +G Y PEGF T+C+FDYLT + N +F +++ ++VIP+ +I+ YY++ VR+HE + + A+KMN S A+ +++ AK ++II L++++WTPY+V+AL+ G + + P+ + LP L K+ + +P++YA +HPK+R++LE
Sbjct: 31 AEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344

HSP 2 Score: 202.986 bits (515), Expect = 8.8092e-57
Identity = 116/320 (36.25%), Postives = 197/320 (61.56%), Query Frame = -1
Query: 1882 SDFESIVHPYWREFELVPEVYHYLVGVYISFV--GIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-FGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 2829
++++ +VH +WR F P YH G YI+F+ ++ + GN LV++IF+++KSLRTP N+ I++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DRY I+ P L+ + +++++F WL++ +S P F +G Y PEGF T+C+FDYLT + N +F +++ ++VIP+ +I+ YY++ VR+HE + + A+KMN S A+ +++ AK ++II L++++WTPY+V+AL+ G + + P+ + LP L K+ + +P++YA +HPK+R++LE
Sbjct: 31 AEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|665407712|ref|NP_001285859.1| (rhodopsin 5, isoform B [Drosophila melanogaster])

HSP 1 Score: 202.986 bits (515), Expect = 8.8092e-57
Identity = 116/320 (36.25%), Postives = 197/320 (61.56%), Query Frame = 1
Query:   94 SDFESIVHPYWREFELVPEVYHYLVGVYISFV--GIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-FGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1041
++++ +VH +WR F P YH G YI+F+ ++ + GN LV++IF+++KSLRTP N+ I++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DRY I+ P L+ + +++++F WL++ +S P F +G Y PEGF T+C+FDYLT + N +F +++ ++VIP+ +I+ YY++ VR+HE + + A+KMN S A+ +++ AK ++II L++++WTPY+V+AL+ G + + P+ + LP L K+ + +P++YA +HPK+R++LE
Sbjct: 31 AEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344

HSP 2 Score: 202.986 bits (515), Expect = 8.8092e-57
Identity = 116/320 (36.25%), Postives = 197/320 (61.56%), Query Frame = -1
Query: 1882 SDFESIVHPYWREFELVPEVYHYLVGVYISFV--GIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-FGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 2829
++++ +VH +WR F P YH G YI+F+ ++ + GN LV++IF+++KSLRTP N+ I++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DRY I+ P L+ + +++++F WL++ +S P F +G Y PEGF T+C+FDYLT + N +F +++ ++VIP+ +I+ YY++ VR+HE + + A+KMN S A+ +++ AK ++II L++++WTPY+V+AL+ G + + P+ + LP L K+ + +P++YA +HPK+R++LE
Sbjct: 31 AEYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738051|ref|NP_524407.1| (neither inactivation nor afterpotential E [Drosophila melanogaster])

HSP 1 Score: 197.978 bits (502), Expect = 4.50927e-55
Identity = 122/342 (35.67%), Postives = 192/342 (56.14%), Query Frame = 1
Query:   97 DFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSVASATK 1122
D ++ PYW +F + ++ ++ Y+ +G+ GN +V+YIFA+ KSLRTP N+ +++LAI D N P++ I+ + W G + C+IY +G FG SI +M +ISLDRY VI + + +TI A+ + ++W S IW P FG+ YVPEG TSC DYL + + I I + IP+ +I + Y+ I+ AV HE M + A+KMN S + K A+ + AK++++ + L+ ++WTPY VI M L + + L P FAK++A YNP +Y I+HPK+R+ L++K PC + K D S A+A++
Sbjct: 30 DMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLF-KFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASE 368

HSP 2 Score: 197.978 bits (502), Expect = 4.50927e-55
Identity = 122/342 (35.67%), Postives = 192/342 (56.14%), Query Frame = -1
Query: 1801 DFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXKERDTTSVASATK 2826
D ++ PYW +F + ++ ++ Y+ +G+ GN +V+YIFA+ KSLRTP N+ +++LAI D N P++ I+ + W G + C+IY +G FG SI +M +ISLDRY VI + + +TI A+ + ++W S IW P FG+ YVPEG TSC DYL + + I I + IP+ +I + Y+ I+ AV HE M + A+KMN S + K A+ + AK++++ + L+ ++WTPY VI M L + + L P FAK++A YNP +Y I+HPK+R+ L++K PC + K D S A+A++
Sbjct: 30 DMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLF-KFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASE 368
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17136434|ref|NP_476701.1| (rhodopsin 4 [Drosophila melanogaster])

HSP 1 Score: 197.593 bits (501), Expect = 6.71678e-55
Identity = 114/327 (34.86%), Postives = 186/327 (56.88%), Query Frame = 1
Query:   67 VSKVPWHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGF-GNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1041
+ +P HW + E P HY++GV+ F+ A +GN +V++IF+++KSLRTP NMF+++LA+ DL P+ +SF+ +A G C+I+ IG G + T A I DRY VI +P +++T +A+IM + +WLY W P F +VPEG+ TSC+FDYL+ + +F ++ +FV P +I++ Y QIV V HE + + A+KMN S +++ + A+++ AK ++ I FL+ +SWTPY V++L+ G + L P +P K A +PF+YAI+HP++R++L+
Sbjct: 36 IQYIPEHWLTQLEP------------PASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKA--PIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMN--RNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQ 346

HSP 2 Score: 197.593 bits (501), Expect = 6.71678e-55
Identity = 114/327 (34.86%), Postives = 186/327 (56.88%), Query Frame = -1
Query: 1882 VSKVPWHWDSDFESIVHPYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGF-GNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 2856
+ +P HW + E P HY++GV+ F+ A +GN +V++IF+++KSLRTP NMF+++LA+ DL P+ +SF+ +A G C+I+ IG G + T A I DRY VI +P +++T +A+IM + +WLY W P F +VPEG+ TSC+FDYL+ + +F ++ +FV P +I++ Y QIV V HE + + A+KMN S +++ + A+++ AK ++ I FL+ +SWTPY V++L+ G + L P +P K A +PF+YAI+HP++R++L+
Sbjct: 36 IQYIPEHWLTQLEP------------PASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKA--PIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMN--RNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQ 346
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738059|ref|NP_524411.1| (rhodopsin 3 [Drosophila melanogaster])

HSP 1 Score: 194.126 bits (492), Expect = 1.43767e-53
Identity = 114/322 (35.40%), Postives = 187/322 (58.07%), Query Frame = 1
Query:   88 WDSDFESIVH--PYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFF-GFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1041
W+ E + H +W + PE +YL+G F + +LGN LV+++F++AKSLRTP N+ +++LA D F + P+ +SF+ +A G L C+I+G IG G + T A I+ DR+ VI +P + +T +AI M++F+++Y+ W + +G +VPEG+ TSCTFDYLT + +F ++ +FV P +I + Y QIV V HE + A+KMN S +++ + A+++ AK ++ I FL+ SWTPY V++L+ G + L P +P K A +PF+YAI+HP++R++L+
Sbjct: 33 WNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCD--FMMMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPME--GKMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQ 350

HSP 2 Score: 194.126 bits (492), Expect = 1.43767e-53
Identity = 114/322 (35.40%), Postives = 187/322 (58.07%), Query Frame = -1
Query: 1882 WDSDFESIVH--PYWREFELVPEVYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFF-GFGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHELEMLKMAQKMNA-SHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 2835
W+ E + H +W + PE +YL+G F + +LGN LV+++F++AKSLRTP N+ +++LA D F + P+ +SF+ +A G L C+I+G IG G + T A I+ DR+ VI +P + +T +AI M++F+++Y+ W + +G +VPEG+ TSCTFDYLT + +F ++ +FV P +I + Y QIV V HE + A+KMN S +++ + A+++ AK ++ I FL+ SWTPY V++L+ G + L P +P K A +PF+YAI+HP++R++L+
Sbjct: 33 WNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCD--FMMMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPME--GKMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQ 350
The following BLAST results are available for this feature:
BLAST of opsin-like vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|129211|sp|P09241|OPSD_ENTDO1.467660e-9650.33RecName: Full=Rhodopsin [Enteroctopus dofleini][more]
gi|3024254|sp|O15973|OPSD1_MIZYE1.576980e-9242.89RecName: Full=Rhodopsin, GQ-coupled; AltName: Full... [more]
gi|129209|sp|P24603|OPSD_LOLFO1.056210e-8845.58RecName: Full=Rhodopsin [Loligo forbesii][more]
gi|2499376|sp|Q17094|OPSD_ALLSU1.453580e-8645.24RecName: Full=Rhodopsin, partial [Alloteuthis subu... [more]
gi|3024292|sp|O16005|OPSD_SEPOF2.450350e-8345.07RecName: Full=Rhodopsin [Sepia officinalis][more]
back to top
BLAST of opsin-like vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150266240.000000e+090.93SmedSxldir_c84693_g1_i1|m.24953|m.19106[more]
SMU150329681.768720e-3830.92SmedSxlregen_c81464_g11_i1|m.21191|m.10162[more]
SMU150285155.965920e-3731.33SmedSxldir_c96785_g1_i5|m.39594|m.45818[more]
SMU150308388.513190e-2826.44SmedSxlregen_c54053_g1_i1|m.6668|m.37854[more]
SMU150109936.672830e-2429.60SmedAsxldir_c46418_g1_i1|m.8227|m.22320[more]
back to top
BLAST of opsin-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|15150803|ref|NP_150598.1|5.654490e-5640.07melanopsin isoform 1 [Homo sapiens][more]
gi|71999143|ref|NP_001025186.1|2.280500e-5338.98melanopsin isoform 2 [Homo sapiens][more]
gi|38678524|ref|NP_859528.1|2.637980e-4035.86opsin-5 [Homo sapiens][more]
gi|767939386|ref|XP_011512652.1|3.070470e-3831.17PREDICTED: opsin-5 isoform X3 [Homo sapiens][more]
gi|767939382|ref|XP_011512650.1|3.395350e-3831.00PREDICTED: opsin-5 isoform X2 [Homo sapiens][more]
back to top
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17137098|ref|NP_477096.1|8.809200e-5736.25rhodopsin 5, isoform A [Drosophila melanogaster][more]
gi|665407712|ref|NP_001285859.1|8.809200e-5736.25rhodopsin 5, isoform B [Drosophila melanogaster][more]
gi|17738051|ref|NP_524407.1|4.509270e-5535.67neither inactivation nor afterpotential E [Drosoph... [more]
gi|17136434|ref|NP_476701.1|6.716780e-5534.86rhodopsin 4 [Drosophila melanogaster][more]
gi|17738059|ref|NP_524411.1|1.437670e-5335.40rhodopsin 3 [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_008381 ID=Ddo_008381|Name=opsin-like|organism=Dugesia dorotocephala|type=mRNA|length=2922bp
TTACAAATGAGCGTCCAGTCCTTTTTAAGTATAGGACAAAAATTGATAGA
AAATAAGACGGCAAATGTTTCGAAGGTTCCATGGCATTGGGATTCTGATT
TCGAATCCATCGTTCATCCTTACTGGAGAGAATTCGAATTGGTTCCAGAA
GTGTATCATTACTTAGTCGGAGTTTATATTTCCTTTGTCGGAATAGCAGG
AGTTTTAGGAAATCTTCTAGTACTTTATATATTTGCTAGTGCGAAAAGTT
TGAGGACCCCTCCTAATATGTTTATTATGAGTTTGGCGATCGGAGATCTG
ACGTTTTCAGCAGTGAATGGCTTTCCACTATTAACTATTTCGAGTTTTAA
CACTCGTTGGGCTTGGGGAAAACTAACTTGTGAAATATACGGATTCATTG
GGGGTCTTTTCGGATTTATATCCATTAATACAATGGCACTTATTTCGTTG
GACAGATACTTTGTTATCGCTCAACCTTTTCAAACTATGAAATCGTTGAC
CATTAAAAGAGCGATAATAATGCTCGTGTTCGTTTGGCTTTATTCTTTGA
TATGGTCGACACCGCCATTTTTTGGATTTGGAAACTATGTCCCTGAAGGA
TTTCAAACTTCCTGTACATTTGATTATCTAACTCAATCCAAAGGAAACAT
AATTTTTAATATAGGAATGTACATCGGGAATTTCGTTATTCCTGTTGCAA
TAATAATATTTTGTTATTATCAGATAGTAAAAGCTGTTAGACTTCATGAA
CTAGAAATGTTGAAGATGGCTCAAAAAATGAATGCTTCTCATCCAGCTTC
CATGAAGACGGGTGCTAAAAAAGCAGATGTTCAAGCTGCAAAAATTTCTG
TGATAATTGTCTTTCTATATTTGATATCCTGGACTCCGTATGCAGTTATT
GCTCTGATGGCGCTTACTGGACGCAGAGATCACCTAAACCCTTATACAGC
TGAATTACCTGTACTTTTTGCTAAAACATCGGCTATGTATAATCCTTTTA
TTTACGCGATCAATCATCCGAAATTTAGAATTCAACTTGAAAAGAAATTC
CCTTGTTTGATTTGCTGTTGTCCACCCAAACCAAAAGAACGTGATACAAC
AAGTGTTGCTTCGGCCACGAAACCGAGCAAATATCAAAGCGAAAAAGAAA
GTTCGATGTCTCAACTTGATTCTGAAGATGATAAACAAAATGTCGAAACC
AACAAGGGTCAAGCTGCTAGTGGTCATACGAATGAGGCTTACGAAAGTGA
AAAATAATTTGTCGAAAATAGAAATTTCAATGTGTAACAACATTAGATTC
TTTATTTTTATTTCACTGTTTTATTCAGCACCGAAATAGGCGCAAATAAT
TATTTGTTTAATGTTCGAAATATATTTATCACATATATTTTTATGATGTT
CATAAATTAATCATTAGAAATCTTAGTATATAATATAAAAATAAAATTTT
CTTGTTAATAATTATTAACAAGAAAATTTTATTTTTATATTATATACTAA
GATTTCTAATGATTAATTTATGAACATCATAAAAATATATGTGATAAATA
TATTTCGAACATTAAACAAATAATTATTTGCGCCTATTTCGGTGCTGAAT
AAAACAGTGAAATAAAAATAAAGAATCTAATGTTGTTACACATTGAAATT
TCTATTTTCGACAAATTATTTTTCACTTTCGTAAGCCTCATTCGTATGAC
CACTAGCAGCTTGACCCTTGTTGGTTTCGACATTTTGTTTATCATCTTCA
GAATCAAGTTGAGACATCGAACTTTCTTTTTCGCTTTGATATTTGCTCGG
TTTCGTGGCCGAAGCAACACTTGTTGTATCACGTTCTTTTGGTTTGGGTG
GACAACAGCAAATCAAACAAGGGAATTTCTTTTCAAGTTGAATTCTAAAT
TTCGGATGATTGATCGCGTAAATAAAAGGATTATACATAGCCGATGTTTT
AGCAAAAAGTACAGGTAATTCAGCTGTATAAGGGTTTAGGTGATCTCTGC
GTCCAGTAAGCGCCATCAGAGCAATAACTGCATACGGAGTCCAGGATATC
AAATATAGAAAGACAATTATCACAGAAATTTTTGCAGCTTGAACATCTGC
TTTTTTAGCACCCGTCTTCATGGAAGCTGGATGAGAAGCATTCATTTTTT
GAGCCATCTTCAACATTTCTAGTTCATGAAGTCTAACAGCTTTTACTATC
TGATAATAACAAAATATTATTATTGCAACAGGAATAACGAAATTCCCGAT
GTACATTCCTATATTAAAAATTATGTTTCCTTTGGATTGAGTTAGATAAT
CAAATGTACAGGAAGTTTGAAATCCTTCAGGGACATAGTTTCCAAATCCA
AAAAATGGCGGTGTCGACCATATCAAAGAATAAAGCCAAACGAACACGAG
CATTATTATCGCTCTTTTAATGGTCAACGATTTCATAGTTTGAAAAGGTT
GAGCGATAACAAAGTATCTGTCCAACGAAATAAGTGCCATTGTATTAATG
GATATAAATCCGAAAAGACCCCCAATGAATCCGTATATTTCACAAGTTAG
TTTTCCCCAAGCCCAACGAGTGTTAAAACTCGAAATAGTTAATAGTGGAA
AGCCATTCACTGCTGAAAACGTCAGATCTCCGATCGCCAAACTCATAATA
AACATATTAGGAGGGGTCCTCAAACTTTTCGCACTAGCAAATATATAAAG
TACTAGAAGATTTCCTAAAACTCCTGCTATTCCGACAAAGGAAATATAAA
CTCCGACTAAGTAATGATACACTTCTGGAACCAATTCGAATTCTCTCCAG
TAAGGATGAACGATGGATTCGAAATCAGAATCCCAATGCCATGGAACCTT
CGAAACATTTGCCGTCTTATTTTCTATCAATTTTTGTCCTATACTTAAAA
AGGACTGGACGCTCATTTGTAA

Design Primers for opsin-like

back to top

protein sequence

>Ddo_008381-protein ID=Ddo_008381-protein|Name=opsin-like|organism=Dugesia dorotocephala|type=polypeptide|length=419bp
LQMSVQSFLSIGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPE
VYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDL
TFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISL
DRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEG
FQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHE
LEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVI
ALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKF
PCLICCCPPKPKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVET
NKGQAASGHTNEAYESEK*
back to top

coding sequence

>Ddo_008381.1.1257 ID=Ddo_008381.1.1257|Name=Ddo_008381.1.1257|organism=Dugesia dorotocephala|type=CDS|length=1257bp
TTACAAATGAGCGTCCAGTCCTTTTTAAGTATAGGACAAAAATTGATAGA
AAATAAGACGGCAAATGTTTCGAAGGTTCCATGGCATTGGGATTCTGATT
TCGAATCCATCGTTCATCCTTACTGGAGAGAATTCGAATTGGTTCCAGAA
GTGTATCATTACTTAGTCGGAGTTTATATTTCCTTTGTCGGAATAGCAGG
AGTTTTAGGAAATCTTCTAGTACTTTATATATTTGCTAGTGCGAAAAGTT
TGAGGACCCCTCCTAATATGTTTATTATGAGTTTGGCGATCGGAGATCTG
ACGTTTTCAGCAGTGAATGGCTTTCCACTATTAACTATTTCGAGTTTTAA
CACTCGTTGGGCTTGGGGAAAACTAACTTGTGAAATATACGGATTCATTG
GGGGTCTTTTCGGATTTATATCCATTAATACAATGGCACTTATTTCGTTG
GACAGATACTTTGTTATCGCTCAACCTTTTCAAACTATGAAATCGTTGAC
CATTAAAAGAGCGATAATAATGCTCGTGTTCGTTTGGCTTTATTCTTTGA
TATGGTCGACACCGCCATTTTTTGGATTTGGAAACTATGTCCCTGAAGGA
TTTCAAACTTCCTGTACATTTGATTATCTAACTCAATCCAAAGGAAACAT
AATTTTTAATATAGGAATGTACATCGGGAATTTCGTTATTCCTGTTGCAA
TAATAATATTTTGTTATTATCAGATAGTAAAAGCTGTTAGACTTCATGAA
CTAGAAATGTTGAAGATGGCTCAAAAAATGAATGCTTCTCATCCAGCTTC
CATGAAGACGGGTGCTAAAAAAGCAGATGTTCAAGCTGCAAAAATTTCTG
TGATAATTGTCTTTCTATATTTGATATCCTGGACTCCGTATGCAGTTATT
GCTCTGATGGCGCTTACTGGACGCAGAGATCACCTAAACCCTTATACAGC
TGAATTACCTGTACTTTTTGCTAAAACATCGGCTATGTATAATCCTTTTA
TTTACGCGATCAATCATCCGAAATTTAGAATTCAACTTGAAAAGAAATTC
CCTTGTTTGATTTGCTGTTGTCCACCCAAACCAAAAGAACGTGATACAAC
AAGTGTTGCTTCGGCCACGAAACCGAGCAAATATCAAAGCGAAAAAGAAA
GTTCGATGTCTCAACTTGATTCTGAAGATGATAAACAAAATGTCGAAACC
AACAAGGGTCAAGCTGCTAGTGGTCATACGAATGAGGCTTACGAAAGTGA
AAAATAA
back to top
Gene Groups
opsin-like is similar in sequence to the genes of this group: GG7488
Gene NameGene ID
SMU15026624SMU15026624
opsin-likeDdo_008381
opsin-likeGsp_022660
opsin-likePgr_015173
opsin-likePmo_026986

Gene Group Protein Sequences

>SMU15026624

MILYLTLKIFIFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESI
VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTP
PNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLF
GFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWST
PPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIF
CYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIV
FLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI
NHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMS
QLDPEDDKQVVETTKNQTTSGHTNEAYESEQK*
>Ddo_008381 opsin-like
LQMSVQSFLSIGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPE
VYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDL
TFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISL
DRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEG
FQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHE
LEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVI
ALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKF
PCLICCCPPKPKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVET
NKGQAASGHTNEAYESEK*
>Gsp_022660 opsin-like
VLFMNLHSLVGLGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFD
MVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLA
IGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMA
LISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNY
VPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAV
RVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTP
YAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL
EKKFPCLICCCPPKPKERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQ
ATETSKVQATSGHTNDAYENEQK*
>Pgr_015173 opsin-like
LSIAGDMSLQYANTIGPGMFSNSTVNVSATTAPWHWDHEFESIVHPYWRQ
FDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMS
LAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINT
MALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFG
HYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVK
AVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSW
TPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRL
QLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESSMSQLDSDGP
QKQDEGKNAGKTNPAYEDGEK*
>Pmo_026986 opsin-like
MSNCLQYGWTIASNSWSQCHGAMVTVLLTVLFEYIMMYSNSTVNSTVTIA
PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLY
IFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLT
CEIYGFIGGLFGFISINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLV
GVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIC
NFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD
I

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.