laminin, Ddo_003647 (mRNA) Dugesia dorotocephala

Overview
Namelaminin
Unique NameDdo_003647
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length7422
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteLaminin
Homology
BLAST of laminin vs. uniprot
Match: gi|30179887|sp|Q06561|UNC52_CAEEL (RecName: Full=Basement membrane proteoglycan; AltName: Full=Perlecan homolog; AltName: Full=Uncoordinated protein 52; Short=Protein unc-52; Flags: Precursor)

HSP 1 Score: 158.303 bits (399), Expect = 6.67488e-37
Identity = 167/654 (25.54%), Postives = 265/654 (40.52%), Query Frame = 3
Query: 1920 LKVSPKTITIKPGGDARFLCQLMGADGKVIWRRFDKKSLEVNKENRIGGSTQSI-------LEIKQATKNDHGTIYECVF----NKLIEQVTLFV--------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK-NTDKCIGTHFLCDD-DVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGI-ARRRVMA-PDFIVVV----------------------SKGSI-----------------------CQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFN-----------VEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVG---NLEKCNCPAGYSGLSCE 3611
+ V P ++ G D F C+ +D V + R+GG S L I +D GT Y CV N + + TL V +C +++ C N+ C+ + CDG+ DC D SDE C PN C+ +CV K W CDG DDCG+N DELNC K ++ C T F C D +P S+ CDG +DC DE C P VV+P Q + V G+T +LTC+ P P I WR NWG + E T++ TLT+H+ G Y+CE I + RV+A PD IV V ++G++ C+ ++ C+KC+C +++DC S+ Y + + +G DA V +++++ ID+N+ F T F G + G + YG + +++ SG + + P++V+KG + + + + L ++ +R+ + E + + +R+ + VL +++ L + + QT + +S A+ D+YT G +E+C CP GY G SCE
Sbjct: 47 ITVFPSEKEVRDGRDVSFECRARTSDNSV---------YPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDP-PQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGG-----YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAG----DAEGVTI----------------SDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGH-HSSEPMVVLKGNQNILVHRVRNQEHVL-------RSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAV---DRYTPDGLALEVEQCVCPPGYLGTSCE 646

HSP 2 Score: 158.303 bits (399), Expect = 6.67488e-37
Identity = 167/654 (25.54%), Postives = 265/654 (40.52%), Query Frame = -3
Query: 3812 LKVSPKTITIKPGGDARFLCQLMGADGKVIWRRFDKKSLEVNKENRIGGSTQSI-------LEIKQATKNDHGTIYECVF----NKLIEQVTLFV--------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK-NTDKCIGTHFLCDD-DVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGI-ARRRVMA-PDFIVVV----------------------SKGSI-----------------------CQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFN-----------VEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVG---NLEKCNCPAGYSGLSCE 5503
+ V P ++ G D F C+ +D V + R+GG S L I +D GT Y CV N + + TL V +C +++ C N+ C+ + CDG+ DC D SDE C PN C+ +CV K W CDG DDCG+N DELNC K ++ C T F C D +P S+ CDG +DC DE C P VV+P Q + V G+T +LTC+ P P I WR NWG + E T++ TLT+H+ G Y+CE I + RV+A PD IV V ++G++ C+ ++ C+KC+C +++DC S+ Y + + +G DA V +++++ ID+N+ F T F G + G + YG + +++ SG + + P++V+KG + + + + L ++ +R+ + E + + +R+ + VL +++ L + + QT + +S A+ D+YT G +E+C CP GY G SCE
Sbjct: 47 ITVFPSEKEVRDGRDVSFECRARTSDNSV---------YPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDP-PQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGG-----YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAG----DAEGVTI----------------SDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGH-HSSEPMVVLKGNQNILVHRVRNQEHVL-------RSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAV---DRYTPDGLALEVEQCVCPPGYLGTSCE 646

HSP 3 Score: 57.3806 bits (137), Expect = 1.91526e-06
Identity = 62/236 (26.27%), Postives = 96/236 (40.68%), Query Frame = 3
Query: 2907 CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKIRVVLWEQEWH-ADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 3611
CI C+CS +T C SA+ Y ++ D + T++ +P T A L I+ S+ + Y+ G + YG L Y SG +I+ G+D +Q R P YA ENK+++ + E W D Q +R+H + L +++ LL K Y + TD + ++ A T +E+C CP GY G SCE
Sbjct: 718 CIPCFCSGVTQQC-SASSYRRTSVSIDYAR--GDRDQLELTTSDSRQPYSPQT--RAELSGQAIEFRSFEEAR-GQTLYWKLPEKFLGDKVTSYGGTLEYTFKFSGNGNSDQSADVILR--GNDIA----LQYKHREPFYADR---ENKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFAEPYGQGLT-AAEVEQCICPPGYVGTSCE 934

HSP 4 Score: 57.3806 bits (137), Expect = 1.91526e-06
Identity = 62/236 (26.27%), Postives = 96/236 (40.68%), Query Frame = -3
Query: 3812 CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKIRVVLWEQEWH-ADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 4516
CI C+CS +T C SA+ Y ++ D + T++ +P T A L I+ S+ + Y+ G + YG L Y SG +I+ G+D +Q R P YA ENK+++ + E W D Q +R+H + L +++ LL K Y + TD + ++ A T +E+C CP GY G SCE
Sbjct: 718 CIPCFCSGVTQQC-SASSYRRTSVSIDYAR--GDRDQLELTTSDSRQPYSPQT--RAELSGQAIEFRSFEEAR-GQTLYWKLPEKFLGDKVTSYGGTLEYTFKFSGNGNSDQSADVILR--GNDIA----LQYKHREPFYADR---ENKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFAEPYGQGLT-AAEVEQCICPPGYVGTSCE 934
BLAST of laminin vs. uniprot
Match: gi|317373536|sp|P98160|PGBM_HUMAN (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; AltName: Full=Perlecan; Short=PLC; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 155.606 bits (392), Expect = 4.31179e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 2951
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 532

HSP 2 Score: 155.606 bits (392), Expect = 4.31179e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = -3
Query: 4472 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 5242
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 532
BLAST of laminin vs. uniprot
Match: gi|1172451|sp|Q05793|PGBM_MOUSE (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 154.836 bits (390), Expect = 6.38179e-36
Identity = 96/299 (32.11%), Postives = 136/299 (45.48%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNE---CSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGY----------------VNNPQPVESGIKP 3002
C + C + CI + CDG+ DC D SDE C C PN C+ C +K W+CDG DC + DE NC VK + G THF C + IP S+ CD +SDC DE C PQVV P +Q I G T+T TC +G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY D++ C+ C+C +T+ C S+ + VN P + G+ P
Sbjct: 285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQ-SIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGR-----GTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLE---DSASCLPCFCFGVTNVCQSSLRFRDQIRLSFDQPNDFKGVNVTMPSQPGVPP 565

HSP 2 Score: 154.836 bits (390), Expect = 6.38179e-36
Identity = 96/299 (32.11%), Postives = 136/299 (45.48%), Query Frame = -3
Query: 4421 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNE---CSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGY----------------VNNPQPVESGIKP 5242
C + C + CI + CDG+ DC D SDE C C PN C+ C +K W+CDG DC + DE NC VK + G THF C + IP S+ CD +SDC DE C PQVV P +Q I G T+T TC +G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY D++ C+ C+C +T+ C S+ + VN P + G+ P
Sbjct: 285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQ-SIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGR-----GTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLE---DSASCLPCFCFGVTNVCQSSLRFRDQIRLSFDQPNDFKGVNVTMPSQPGVPP 565
BLAST of laminin vs. uniprot
Match: gi|160409939|sp|A2ARV4|LRP2_MOUSE (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 91.2781 bits (225), Expect = 1.37581e-16
Identity = 57/150 (38.00%), Postives = 76/150 (50.67%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDED-RTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDEL-NCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLT 2618
C+ NQ C N CI + CDG NDCGD SDED R C CS C + P +RC+ +HW CDG DC + DEL NC ++ C F C + I +S+ CD +DC DE+ CS+P P + Q + +G +T
Sbjct: 2908 CSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTC--INSRPPNRRCIPQHWVCDGDADCADALDELQNCTMR---ACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP----PCRDDQFTCQNGQCIT 3048

HSP 2 Score: 91.2781 bits (225), Expect = 1.37581e-16
Identity = 57/150 (38.00%), Postives = 76/150 (50.67%), Query Frame = -3
Query: 4805 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDED-RTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDEL-NCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLT 5242
C+ NQ C N CI + CDG NDCGD SDED R C CS C + P +RC+ +HW CDG DC + DEL NC ++ C F C + I +S+ CD +DC DE+ CS+P P + Q + +G +T
Sbjct: 2908 CSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTC--INSRPPNRRCIPQHWVCDGDADCADALDELQNCTMR---ACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP----PCRDDQFTCQNGQCIT 3048

HSP 3 Score: 82.0333 bits (201), Expect = 7.99377e-14
Identity = 48/138 (34.78%), Postives = 71/138 (51.45%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKN-TDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEK 2579
++C + C N C+ CDG +DC DNSDE + N CS +A C + G +C+ W+CD +DC + DE NCP ++ + C T F CD+ + IP+ + CD D+DC DEK+C P +
Sbjct: 1023 QQCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTC--VHGG----QCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQ 1154

HSP 4 Score: 82.0333 bits (201), Expect = 7.99377e-14
Identity = 48/138 (34.78%), Postives = 71/138 (51.45%), Query Frame = -3
Query: 4844 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKN-TDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEK 5248
++C + C N C+ CDG +DC DNSDE + N CS +A C + G +C+ W+CD +DC + DE NCP ++ + C T F CD+ + IP+ + CD D+DC DEK+C P +
Sbjct: 1023 QQCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTC--VHGG----QCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQ 1154

HSP 5 Score: 80.1073 bits (196), Expect = 3.18883e-13
Identity = 69/188 (36.70%), Postives = 84/188 (44.68%), Query Frame = 3
Query: 2094 QATKNDHGTIYECVFNKLIEQVTLFV------------EEECALN----QRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCD-FLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFS 2603
QA+ H T + C ++ I L+V E C LN Q KC + CI+ CDG DC DNSDE C P H D F D T C+ W+CDG DC DE N V T C +HFLCD+ I S+ CDGD+DC+ M DEK C P Q Q +S
Sbjct: 1145 QASGTCHPTQFRCPDHRCIS--PLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSSCINSRYRCDGVYDCKDNSDE--AGCPTRPPGMCHPDEFQCQGDGT--CIPNTWECDGHPDCIQGSDEHNGCVPKT--CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDCPTQPFHCPSSQWQCPGYS 1324

HSP 6 Score: 80.1073 bits (196), Expect = 3.18883e-13
Identity = 69/188 (36.70%), Postives = 84/188 (44.68%), Query Frame = -3
Query: 4820 QATKNDHGTIYECVFNKLIEQVTLFV------------EEECALN----QRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCD-FLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFS 5329
QA+ H T + C ++ I L+V E C LN Q KC + CI+ CDG DC DNSDE C P H D F D T C+ W+CDG DC DE N V T C +HFLCD+ I S+ CDGD+DC+ M DEK C P Q Q +S
Sbjct: 1145 QASGTCHPTQFRCPDHRCIS--PLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSSCINSRYRCDGVYDCKDNSDE--AGCPTRPPGMCHPDEFQCQGDGT--CIPNTWECDGHPDCIQGSDEHNGCVPKT--CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDCPTQPFHCPSSQWQCPGYS 1324

HSP 7 Score: 78.1814 bits (191), Expect = 1.06666e-12
Identity = 45/117 (38.46%), Postives = 62/117 (52.99%), Query Frame = 3
Query: 2199 KCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSC 2549
+C N CI CDG +DCGDNSDE+ EC+ + C AD ++C+ W CD +DCG+N DE +C +K C HF C +P++ CDG +DC DE +C
Sbjct: 3728 RCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-----AD--QQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 8 Score: 78.1814 bits (191), Expect = 1.06666e-12
Identity = 45/117 (38.46%), Postives = 62/117 (52.99%), Query Frame = -3
Query: 4874 KCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSC 5224
+C N CI CDG +DCGDNSDE+ EC+ + C AD ++C+ W CD +DCG+N DE +C +K C HF C +P++ CDG +DC DE +C
Sbjct: 3728 RCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-----AD--QQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 9 Score: 78.1814 bits (191), Expect = 1.21981e-12
Identity = 45/124 (36.29%), Postives = 63/124 (50.81%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE--LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 2540
C L Q +C++ C C+ + DC D SDEDR C + C N C KRC+ ++WQCD +DDC +N DE +C + C F C++ IP+S+ CD D+DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRT---CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 10 Score: 78.1814 bits (191), Expect = 1.21981e-12
Identity = 45/124 (36.29%), Postives = 63/124 (50.81%), Query Frame = -3
Query: 4883 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE--LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 5242
C L Q +C++ C C+ + DC D SDEDR C + C N C KRC+ ++WQCD +DDC +N DE +C + C F C++ IP+S+ CD D+DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRT---CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 11 Score: 73.9442 bits (180), Expect = 2.02396e-11
Identity = 46/128 (35.94%), Postives = 63/128 (49.22%), Query Frame = 3
Query: 2181 CALNQRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSH 2555
C + KC+ ++C+ CDG NDCGD SDE+ C + C N C P RC+ +W CDG DC ++ DE + + + C F CD+ I S+ CDGD+DC M DE H
Sbjct: 2823 CQPDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSP-HRCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHH 2944

HSP 12 Score: 73.9442 bits (180), Expect = 2.02396e-11
Identity = 46/128 (35.94%), Postives = 63/128 (49.22%), Query Frame = -3
Query: 4868 CALNQRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSH 5242
C + KC+ ++C+ CDG NDCGD SDE+ C + C N C P RC+ +W CDG DC ++ DE + + + C F CD+ I S+ CDGD+DC M DE H
Sbjct: 2823 CQPDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSP-HRCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHH 2944

HSP 13 Score: 72.4034 bits (176), Expect = 6.82668e-11
Identity = 45/127 (35.43%), Postives = 58/127 (45.67%), Query Frame = 3
Query: 2169 VEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK--NTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEK 2543
V EC ++ +C + CI CD +NDCGDNSDE C P C + CV K CDG DC + DE CP + N C F C + V I + CDG++DC DE+
Sbjct: 3757 VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEE 3876

HSP 14 Score: 72.4034 bits (176), Expect = 6.82668e-11
Identity = 45/127 (35.43%), Postives = 58/127 (45.67%), Query Frame = -3
Query: 4880 VEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK--NTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEK 5254
V EC ++ +C + CI CD +NDCGDNSDE C P C + CV K CDG DC + DE CP + N C F C + V I + CDG++DC DE+
Sbjct: 3757 VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEE 3876

HSP 15 Score: 71.2478 bits (173), Expect = 1.48887e-10
Identity = 50/137 (36.50%), Postives = 68/137 (49.64%), Query Frame = 3
Query: 2178 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSME--DEKSCSHPQVVEPE 2576
C Q C N CI ++ CD NDCGD SDE T C + C A C RCV H++CD +DCG+N DE C ++ + T F C + IP SY C+G ++C + DEK+C P +P+
Sbjct: 2700 RCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTC-------ANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCP-PITCQPD 2826

HSP 16 Score: 71.2478 bits (173), Expect = 1.48887e-10
Identity = 50/137 (36.50%), Postives = 68/137 (49.64%), Query Frame = -3
Query: 4847 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSME--DEKSCSHPQVVEPE 5245
C Q C N CI ++ CD NDCGD SDE T C + C A C RCV H++CD +DCG+N DE C ++ + T F C + IP SY C+G ++C + DEK+C P +P+
Sbjct: 2700 RCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTC-------ANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCP-PITCQPD 2826

HSP 17 Score: 70.8626 bits (172), Expect = 1.88285e-10
Identity = 44/129 (34.11%), Postives = 59/129 (45.74%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNEC---SPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDEL--NCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCS 2552
C +CKN +CI CDG+NDC D SDE+ C SP CD RC+ H C+G+DDCG+ DE +C C T + C + + + Y CD DC + DE C+
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCD-------NSRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCN 3965

HSP 18 Score: 70.8626 bits (172), Expect = 1.88285e-10
Identity = 44/129 (34.11%), Postives = 59/129 (45.74%), Query Frame = -3
Query: 4871 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNEC---SPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDEL--NCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCS 5242
C +CKN +CI CDG+NDC D SDE+ C SP CD RC+ H C+G+DDCG+ DE +C C T + C + + + Y CD DC + DE C+
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCD-------NSRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCN 3965

HSP 19 Score: 67.0106 bits (162), Expect = 2.51174e-09
Identity = 44/125 (35.20%), Postives = 61/125 (48.80%), Query Frame = 3
Query: 2190 NQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNE-CSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQ 2561
+Q C N C + ++ CD K DC D+SDE C CS C + C+++ + CD +DC +N DE NC N D C G F C + I +++ CDGD DC+ DE C Q
Sbjct: 148 DQLTCANGACYNTSQKCDHKVDCRDSSDE--ANCTTLCSQKEFQCG-------SGECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 20 Score: 67.0106 bits (162), Expect = 2.51174e-09
Identity = 44/125 (35.20%), Postives = 61/125 (48.80%), Query Frame = -3
Query: 4862 NQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNE-CSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQ 5233
+Q C N C + ++ CD K DC D+SDE C CS C + C+++ + CD +DC +N DE NC N D C G F C + I +++ CDGD DC+ DE C Q
Sbjct: 148 DQLTCANGACYNTSQKCDHKVDCRDSSDE--ANCTTLCSQKEFQCG-------SGECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 21 Score: 65.855 bits (159), Expect = 5.76041e-09
Identity = 46/144 (31.94%), Postives = 65/144 (45.14%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDV---------LIPRSYWCDGDSDCKSMEDEKSC 2549
E L C N+ +C N CI E CD +DC DNSDED + C C P C+ RC+ + W+CD +DCG+ DE P+ +C+ + CD+ IP+ C+G DC+ DE+ C
Sbjct: 3586 EDRVLCEHHRCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCN-------NGRCIPQSWKCDVDNDCGDYSDE---PIH---ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716

HSP 22 Score: 65.855 bits (159), Expect = 5.76041e-09
Identity = 46/144 (31.94%), Postives = 65/144 (45.14%), Query Frame = -3
Query: 4874 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDV---------LIPRSYWCDGDSDCKSMEDEKSC 5272
E L C N+ +C N CI E CD +DC DNSDED + C C P C+ RC+ + W+CD +DCG+ DE P+ +C+ + CD+ IP+ C+G DC+ DE+ C
Sbjct: 3586 EDRVLCEHHRCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCN-------NGRCIPQSWKCDVDNDCGDYSDE---PIH---ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716

HSP 23 Score: 64.3142 bits (155), Expect = 1.8787e-08
Identity = 49/138 (35.51%), Postives = 63/138 (45.65%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLK--GADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTH----FLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPE 2576
C Q KC N CI ++ CD NDCGD SDE +EC A +CD RC+ + C+G DDC +N DE C + + H F C + IP + CDG DC DE+SC + E E
Sbjct: 3637 CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDEP---IHECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC------ESVPCHPSGDFRCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESE 3765

HSP 24 Score: 64.3142 bits (155), Expect = 1.8787e-08
Identity = 49/138 (35.51%), Postives = 63/138 (45.65%), Query Frame = -3
Query: 4847 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLK--GADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTH----FLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPE 5242
C Q KC N CI ++ CD NDCGD SDE +EC A +CD RC+ + C+G DDC +N DE C + + H F C + IP + CDG DC DE+SC + E E
Sbjct: 3637 CRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDEP---IHECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC------ESVPCHPSGDFRCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESE 3765

HSP 25 Score: 60.8474 bits (146), Expect = 2.19126e-07
Identity = 43/129 (33.33%), Postives = 56/129 (43.41%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE-LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHP 2558
+EC +C N CI + CDG DC D++DE C FL A+ T C+ W CD DC + DE NCP C C + +P Y CD SDC DE++C +P
Sbjct: 26 QECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEIGCPPRSCGSGF----FLCPAEGT--CIPSSWVCDQDKDCSDGADEQQNCPGTT---CSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145

HSP 26 Score: 60.8474 bits (146), Expect = 2.19126e-07
Identity = 43/129 (33.33%), Postives = 56/129 (43.41%), Query Frame = -3
Query: 4865 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE-LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHP 5248
+EC +C N CI + CDG DC D++DE C FL A+ T C+ W CD DC + DE NCP C C + +P Y CD SDC DE++C +P
Sbjct: 26 QECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEIGCPPRSCGSGF----FLCPAEGT--CIPSSWVCDQDKDCSDGADEQQNCPGTT---CSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145

HSP 27 Score: 56.9954 bits (136), Expect = 3.1252e-06
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQR-KCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKC 2447
E++ L C QR +C N CI ++ C+G +DCGD SDE C + P C + CV +H+ CD +DDCG+ DE C + C
Sbjct: 3875 EEIHLCFNVPCESPQRFRCDNSRCIYGHQLCNGVDDCGDGSDEKEEHCRK--PTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTC 3972

HSP 28 Score: 56.9954 bits (136), Expect = 3.1252e-06
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = -3
Query: 4976 EQVTLFVEEECALNQR-KCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKC 5272
E++ L C QR +C N CI ++ C+G +DCGD SDE C + P C + CV +H+ CD +DDCG+ DE C + C
Sbjct: 3875 EEIHLCFNVPCESPQRFRCDNSRCIYGHQLCNGVDDCGDGSDEKEEHCRK--PTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTC 3972

HSP 29 Score: 56.225 bits (134), Expect = 4.40712e-06
Identity = 45/137 (32.85%), Postives = 61/137 (44.53%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNEC-SPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNN--FDELNCP----VKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 2540
E T+ C C N C+ + CD NDCGDNSDE C S C RC+ + C+GI++C +N DE NCP + KC T ++ +PR++ CDGD+DC DE
Sbjct: 2732 ELPTVCAFHTCRSTAFTCANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNSTTEFTCS-------NGRCIPLSYVCNGINNCHDNDTSDEKNCPPITCQPDFAKCQTT------NICVPRAFLCDGDNDCGDGSDE 2855

HSP 30 Score: 56.225 bits (134), Expect = 4.40712e-06
Identity = 45/137 (32.85%), Postives = 61/137 (44.53%), Query Frame = -3
Query: 4883 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNEC-SPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNN--FDELNCP----VKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 5272
E T+ C C N C+ + CD NDCGDNSDE C S C RC+ + C+GI++C +N DE NCP + KC T ++ +PR++ CDGD+DC DE
Sbjct: 2732 ELPTVCAFHTCRSTAFTCANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNSTTEFTCS-------NGRCIPLSYVCNGINNCHDNDTSDEKNCPPITCQPDFAKCQTT------NICVPRAFLCDGDNDCGDGSDE 2855
BLAST of laminin vs. uniprot
Match: gi|160332309|sp|P98164|LRP2_HUMAN (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 90.8929 bits (224), Expect = 1.7692e-16
Identity = 50/137 (36.50%), Postives = 70/137 (51.09%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDED--RTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEK 2579
E+C L CKN C+ CDG +DC DNSDE T N CS +A C C+ HW+CD +DC + DE NCP C+ T + CD+ I +++ CD D+DC DEK+C+ + +P +
Sbjct: 1024 EQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGH-------GECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETCQPSQ 1153

HSP 2 Score: 90.8929 bits (224), Expect = 1.7692e-16
Identity = 50/137 (36.50%), Postives = 70/137 (51.09%), Query Frame = -3
Query: 4844 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDED--RTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEK 5248
E+C L CKN C+ CDG +DC DNSDE T N CS +A C C+ HW+CD +DC + DE NCP C+ T + CD+ I +++ CD D+DC DEK+C+ + +P +
Sbjct: 1024 EQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGH-------GECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETCQPSQ 1153

HSP 3 Score: 80.4925 bits (197), Expect = 2.29916e-13
Identity = 48/126 (38.10%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2172 EEECALNQRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 2540
+ C KC N ++CI CDG NDCGDNSDE+ T C + CS + C + RC+ +HW CD DC + DE + C+ F CD IP + CDGD+DC M DE
Sbjct: 2819 DRTCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQC-------ASGRCIPQHWYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDE 2937

HSP 4 Score: 80.4925 bits (197), Expect = 2.29916e-13
Identity = 48/126 (38.10%), Postives = 62/126 (49.21%), Query Frame = -3
Query: 4883 EEECALNQRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 5251
+ C KC N ++CI CDG NDCGDNSDE+ T C + CS + C + RC+ +HW CD DC + DE + C+ F CD IP + CDGD+DC M DE
Sbjct: 2819 DRTCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQC-------ASGRCIPQHWYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDE 2937

HSP 5 Score: 75.8702 bits (185), Expect = 5.07366e-12
Identity = 52/155 (33.55%), Postives = 75/155 (48.39%), Query Frame = 3
Query: 2172 EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDED-RTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE-LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLT 2624
E C ++ KC CI CDG NDCGD SDED R +C CS + C + P +RC+ + W CDG DC + +DE NC + C F C + IP+ + CD +DC DE+ C + + +Q Q + +G ++ T
Sbjct: 2903 ERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKRHQCQNQNCSDSEFLC--VNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRT---CSENEFTCGYGLCIPKIFRCDRHNDCGDYSDERGC----LYQTCQQNQFTCQNGRCISKT 3048

HSP 6 Score: 75.8702 bits (185), Expect = 5.07366e-12
Identity = 52/155 (33.55%), Postives = 75/155 (48.39%), Query Frame = -3
Query: 4799 EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDED-RTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE-LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLT 5251
E C ++ KC CI CDG NDCGD SDED R +C CS + C + P +RC+ + W CDG DC + +DE NC + C F C + IP+ + CD +DC DE+ C + + +Q Q + +G ++ T
Sbjct: 2903 ERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKRHQCQNQNCSDSEFLC--VNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRT---CSENEFTCGYGLCIPKIFRCDRHNDCGDYSDERGC----LYQTCQQNQFTCQNGRCISKT 3048

HSP 7 Score: 74.7146 bits (182), Expect = 1.41119e-11
Identity = 47/129 (36.43%), Postives = 65/129 (50.39%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCK--SMEDEKSC 2549
E C + C N CI E CD NDCGD SDE + C + CSP A C RCV ++CD +DCG+ DE C ++ + T F+C++ IPR + C+G +C + DEK+C
Sbjct: 2698 ERCGASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTC-------ANGRCVQYSYRCDYYNDCGDGSDEAGCLFRDCNA--TTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNC 2817

HSP 8 Score: 74.7146 bits (182), Expect = 1.41119e-11
Identity = 47/129 (36.43%), Postives = 65/129 (50.39%), Query Frame = -3
Query: 4874 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCK--SMEDEKSC 5248
E C + C N CI E CD NDCGD SDE + C + CSP A C RCV ++CD +DCG+ DE C ++ + T F+C++ IPR + C+G +C + DEK+C
Sbjct: 2698 ERCGASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTC-------ANGRCVQYSYRCDYYNDCGDGSDEAGCLFRDCNA--TTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNC 2817

HSP 9 Score: 74.3294 bits (181), Expect = 1.6138e-11
Identity = 42/117 (35.90%), Postives = 58/117 (49.57%), Query Frame = 3
Query: 2199 KCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSC 2549
+CKN CI CDG+NDCGDNSDE+ EC+ + C ++C+ W CD +DCG+N DE +C ++ C +F C + CDG +DC DE C
Sbjct: 3726 RCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRC-------VNQQCIPSRWICDHYNDCGDNSDERDCEMRT---CHPEYFQCTSGHCVHSELKCDGSADCLDASDEADC 3832

HSP 10 Score: 74.3294 bits (181), Expect = 1.6138e-11
Identity = 42/117 (35.90%), Postives = 58/117 (49.57%), Query Frame = -3
Query: 4874 KCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSC 5224
+CKN CI CDG+NDCGDNSDE+ EC+ + C ++C+ W CD +DCG+N DE +C ++ C +F C + CDG +DC DE C
Sbjct: 3726 RCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRC-------VNQQCIPSRWICDHYNDCGDNSDERDCEMRT---CHPEYFQCTSGHCVHSELKCDGSADCLDASDEADC 3832

HSP 11 Score: 72.4034 bits (176), Expect = 5.91933e-11
Identity = 52/137 (37.96%), Postives = 64/137 (46.72%), Query Frame = 3
Query: 2181 CALNQRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQ 2588
C +Q KC + D CI CDG DC DNSDE C P H D + + C+ W+CDG DC DE N V T C ++F CD+ I R++ CD D+DC M DEK C P Q Q
Sbjct: 1187 CTASQFKCASGDKCIGVTNRCDGVFDCSDNSDE--AGCPTRPPGMCHSDEFQCQE-DGICIPNFWECDGHPDCLYGSDEHNACVPKT--CPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQ 1318

HSP 12 Score: 72.4034 bits (176), Expect = 5.91933e-11
Identity = 52/137 (37.96%), Postives = 64/137 (46.72%), Query Frame = -3
Query: 4835 CALNQRKCKN-DLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQ 5242
C +Q KC + D CI CDG DC DNSDE C P H D + + C+ W+CDG DC DE N V T C ++F CD+ I R++ CD D+DC M DEK C P Q Q
Sbjct: 1187 CTASQFKCASGDKCIGVTNRCDGVFDCSDNSDE--AGCPTRPPGMCHSDEFQCQE-DGICIPNFWECDGHPDCLYGSDEHNACVPKT--CPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQ 1318

HSP 13 Score: 70.0922 bits (170), Expect = 3.30182e-10
Identity = 48/144 (33.33%), Postives = 68/144 (47.22%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDV---------LIPRSYWCDGDSDCKSMEDEKSC 2549
E L C N+ +C N CI E+ CD NDC DNSDED + C C P C RC+ + W+CD +DCG++ DE P+ ++C+ + LCD+ IP+ C+G DC+ DE+ C
Sbjct: 3584 EDRLLCENHHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRC-------ANGRCIPQAWKCDVDNDCGDHSDE---PI---EECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGC 3714

HSP 14 Score: 70.0922 bits (170), Expect = 3.30182e-10
Identity = 48/144 (33.33%), Postives = 68/144 (47.22%), Query Frame = -3
Query: 4874 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRC--NECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDV---------LIPRSYWCDGDSDCKSMEDEKSC 5272
E L C N+ +C N CI E+ CD NDC DNSDED + C C P C RC+ + W+CD +DCG++ DE P+ ++C+ + LCD+ IP+ C+G DC+ DE+ C
Sbjct: 3584 EDRLLCENHHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRC-------ANGRCIPQAWKCDVDNDCGDHSDE---PI---EECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGC 3714

HSP 15 Score: 69.707 bits (169), Expect = 3.97066e-10
Identity = 43/132 (32.58%), Postives = 63/132 (47.73%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE--LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 2540
+++ L + C L Q +C + C C+ +C D SDEDR C HCD + KRC+ + WQCD +DC +N DE +C + C F C + IP+++ CD D+DC DE
Sbjct: 3543 DELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCEN-----HHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRT---CRPGQFRCANGRCIPQAWKCDVDNDCGDHSDE 3666

HSP 16 Score: 69.707 bits (169), Expect = 3.97066e-10
Identity = 43/132 (32.58%), Postives = 63/132 (47.73%), Query Frame = -3
Query: 4883 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDE--LNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDE 5272
+++ L + C L Q +C + C C+ +C D SDEDR C HCD + KRC+ + WQCD +DC +N DE +C + C F C + IP+++ CD D+DC DE
Sbjct: 3543 DELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCEN-----HHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRT---CRPGQFRCANGRCIPQAWKCDVDNDCGDHSDE 3666

HSP 17 Score: 69.3218 bits (168), Expect = 5.74223e-10
Identity = 50/134 (37.31%), Postives = 69/134 (51.49%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCD-FLKGADPTK-RCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPE 2576
C Q +C N CI + CD NDCGD+SDE EC +A CD F + + T RC+ K C+G+DDC +N DE C + +G F C + IP + CDG +DC DE++C+ + E E
Sbjct: 3635 CRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEP---IEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCHP-VGD-FRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESE 3763

HSP 18 Score: 69.3218 bits (168), Expect = 5.74223e-10
Identity = 50/134 (37.31%), Postives = 69/134 (51.49%), Query Frame = -3
Query: 4847 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCD-FLKGADPTK-RCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPE 5242
C Q +C N CI + CD NDCGD+SDE EC +A CD F + + T RC+ K C+G+DDC +N DE C + +G F C + IP + CDG +DC DE++C+ + E E
Sbjct: 3635 CRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEP---IEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCHP-VGD-FRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESE 3763

HSP 19 Score: 67.0106 bits (162), Expect = 2.70842e-09
Identity = 45/131 (34.35%), Postives = 60/131 (45.80%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDD-VLIPRSYWCDGDSDCKSMEDEKSCSHPQV 2564
E C +Q C N CID + CDG DC D SDE N C+ + C +C+ +CDG+ DC +N DE CP + C F C +D + IP + CDG DC DE + P+
Sbjct: 1147 ETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLN-CTASQFKCA------SGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKT 1270

HSP 20 Score: 67.0106 bits (162), Expect = 2.70842e-09
Identity = 45/131 (34.35%), Postives = 60/131 (45.80%), Query Frame = -3
Query: 4859 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDD-VLIPRSYWCDGDSDCKSMEDEKSCSHPQV 5248
E C +Q C N CID + CDG DC D SDE N C+ + C +C+ +CDG+ DC +N DE CP + C F C +D + IP + CDG DC DE + P+
Sbjct: 1147 ETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLN-CTASQFKCA------SGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKT 1270

HSP 21 Score: 64.6994 bits (156), Expect = 1.34333e-08
Identity = 41/111 (36.94%), Postives = 50/111 (45.05%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK--CIGTHFLCDDDVLIPRSYW 2501
EC ++ +C N CI CD NDCGDNSDE C P C + CV +CDG DC + DE +CP + D C T F C + V IP YW
Sbjct: 3757 RECTESEFRCVNQQCIPSRWICDHYNDCGDNSDERDCEMRTCHPEYFQC-------TSGHCVHSELKCDGSADCLDASDEADCPTRFPDGAYCQATMFECKNHVCIP-PYW 3859

HSP 22 Score: 64.6994 bits (156), Expect = 1.34333e-08
Identity = 41/111 (36.94%), Postives = 50/111 (45.05%), Query Frame = -3
Query: 4922 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK--CIGTHFLCDDDVLIPRSYW 5248
EC ++ +C N CI CD NDCGDNSDE C P C + CV +CDG DC + DE +CP + D C T F C + V IP YW
Sbjct: 3757 RECTESEFRCVNQQCIPSRWICDHYNDCGDNSDERDCEMRTCHPEYFQC-------TSGHCVHSELKCDGSADCLDASDEADCPTRFPDGAYCQATMFECKNHVCIP-PYW 3859

HSP 23 Score: 64.6994 bits (156), Expect = 1.35464e-08
Identity = 45/136 (33.09%), Postives = 63/136 (46.32%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN---ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSC 2549
EQ+ + C+ + C + CI + CD +NDC D SDE + C CD +C+ K+W CD +DCG+ DE NC +T+ C + F C + I S+ CDGD DC DE C
Sbjct: 1057 EQLCGTLNNTCSSSAFTCGHGECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCD-------NHQCISKNWVCDTDNDCGDGSDEKNC--NSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGC 1183

HSP 24 Score: 64.6994 bits (156), Expect = 1.35464e-08
Identity = 45/136 (33.09%), Postives = 63/136 (46.32%), Query Frame = -3
Query: 4874 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN---ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSC 5272
EQ+ + C+ + C + CI + CD +NDC D SDE + C CD +C+ K+W CD +DCG+ DE NC +T+ C + F C + I S+ CDGD DC DE C
Sbjct: 1057 EQLCGTLNNTCSSSAFTCGHGECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCD-------NHQCISKNWVCDTDNDCGDGSDEKNC--NSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGC 1183

HSP 25 Score: 64.3142 bits (155), Expect = 1.81662e-08
Identity = 44/129 (34.11%), Postives = 64/129 (49.61%), Query Frame = 3
Query: 2172 EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHP 2558
+ C+ +Q C N CI CD DC D +DE+ + C + CD GA C +CD DC ++ DE+NC T+ C+ F C + IPR+Y CD D+DC+ DE +C++P
Sbjct: 105 QSTCSSHQITCSNGQCIPSEYRCDHVRDCPDGADENDCQYPTCE--QLTCD--NGA-----CYNTSQKCDWKVDCRDSSDEINC----TEICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYP 220

HSP 26 Score: 64.3142 bits (155), Expect = 1.81662e-08
Identity = 44/129 (34.11%), Postives = 64/129 (49.61%), Query Frame = -3
Query: 4865 EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHP 5251
+ C+ +Q C N CI CD DC D +DE+ + C + CD GA C +CD DC ++ DE+NC T+ C+ F C + IPR+Y CD D+DC+ DE +C++P
Sbjct: 105 QSTCSSHQITCSNGQCIPSEYRCDHVRDCPDGADENDCQYPTCE--QLTCD--NGA-----CYNTSQKCDWKVDCRDSSDEINC----TEICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYP 220

HSP 27 Score: 61.6178 bits (148), Expect = 1.11107e-07
Identity = 45/139 (32.37%), Postives = 63/139 (45.32%), Query Frame = 3
Query: 2151 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNE----CSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDD-----VLIPRSYWCDGDSDCKSMEDE 2540
E T C+ ++ +C + CI ++ +CD + DC D SDE + C C + CD RC+ W CDG +DCG+ DE C + FLC +D IP+S+ CDGD DC DE
Sbjct: 2854 ENPTYCTTHTCSSSEFQCASGRCIPQHWYCDQETDCFDASDEPAS-CGHSERTCLADEFKCD-------GGRCIPSEWICDGDNDCGDMSDEDKRHQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDE 2984

HSP 28 Score: 61.6178 bits (148), Expect = 1.11107e-07
Identity = 45/139 (32.37%), Postives = 63/139 (45.32%), Query Frame = -3
Query: 4883 EQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNE----CSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDD-----VLIPRSYWCDGDSDCKSMEDE 5272
E T C+ ++ +C + CI ++ +CD + DC D SDE + C C + CD RC+ W CDG +DCG+ DE C + FLC +D IP+S+ CDGD DC DE
Sbjct: 2854 ENPTYCTTHTCSSSEFQCASGRCIPQHWYCDQETDCFDASDEPAS-CGHSERTCLADEFKCD-------GGRCIPSEWICDGDNDCGDMSDEDKRHQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDE 2984

HSP 29 Score: 61.6178 bits (148), Expect = 1.17823e-07
Identity = 46/129 (35.66%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 2175 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTD--KCIGTHFLCDDDVLIPRSY-WCDGDSDCKSMEDEKSCS 2552
E C N+ C N CI CD NDC D SDE C C P+ RC+ ++W CDG DDC +N DE C D KC + C + Y CDG DC EDE + S
Sbjct: 181 EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTC-------PSGRCIYQNWVCDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTS 302

HSP 30 Score: 61.6178 bits (148), Expect = 1.17823e-07
Identity = 46/129 (35.66%), Postives = 55/129 (42.64%), Query Frame = -3
Query: 4871 EECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTD--KCIGTHFLCDDDVLIPRSY-WCDGDSDCKSMEDEKSCS 5248
E C N+ C N CI CD NDC D SDE C C P+ RC+ ++W CDG DDC +N DE C D KC + C + Y CDG DC EDE + S
Sbjct: 181 EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTC-------PSGRCIYQNWVCDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTS 302
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003325 (SmedAsxldir_c101543_g1_i1|m.51138|m.8906)

HSP 1 Score: 1109.75 bits (2869), Expect = 0
Identity = 508/755 (67.28%), Postives = 617/755 (81.72%), Query Frame = 3
Query: 1356 AKKELHCEIGRLDNRWTMFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANINSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGTYVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKIRVVLWEQE-WHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIK 3617
KKELHCEI R+DN+W M ++IWT N +KID+ +Y K+ RLDTNSVSILV+K M ++ EGTYKCYQ + + +AKLL+ERS VLIE+AP Q + DNVN +ELHCRIDTANINSS I W FIPENSK+E++LP EAKV RP+ SSTSFVVIEN LK+HEGTYVC+VL KV+GR++V+ K VLKVSPK +T+KPGG ARF+C+L+G GKV+WRR DKKSL V KE R S+LE+K ATK+D GT+YEC FNKL + VTL+V+EEC LNQRKCKN+ CIDENKFCDGKNDCGDNSDEDR +CNECSPN+IHCDFLK A+P KRC+IKHWQCDGIDDCGNNFDELNCPVKN DKCIGTH+LC++++LIPRSYWCDG+ DC SMEDE+ CS+PQ++EP K IS+F+ STLT+TC+MSGRPVP+I+WRYNW HL ENL YNITT +SNCSVITS+LTV NI D SG+YSCEGI+RRR++APDF V V+KG ICQ+PFYNNDAW MCI+CYCSNLTD+C+SATGY NP +ES IKPSDAAIVN+KT EYY+PARE+TFAN KY+I++ Y K +P DYYFGG FN+ GSWL RYG+PL+Y+LILSGE+ Y+PGPL+VIKG SD +Y+C ++ +RLPVYAS + +EN +R+ LWEQ+ W D +C +R+ F+NVL NV L+LFKVKY+ QT+F MSKIS+ EAI+T + Y+W LEKC CPAGYSGLSCE K
Sbjct: 401 VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVK--YRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCENK 1153

HSP 2 Score: 1109.75 bits (2869), Expect = 0
Identity = 508/755 (67.28%), Postives = 617/755 (81.72%), Query Frame = -3
Query: 3806 AKKELHCEIGRLDNRWTMFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANINSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGTYVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKIRVVLWEQE-WHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIK 6067
KKELHCEI R+DN+W M ++IWT N +KID+ +Y K+ RLDTNSVSILV+K M ++ EGTYKCYQ + + +AKLL+ERS VLIE+AP Q + DNVN +ELHCRIDTANINSS I W FIPENSK+E++LP EAKV RP+ SSTSFVVIEN LK+HEGTYVC+VL KV+GR++V+ K VLKVSPK +T+KPGG ARF+C+L+G GKV+WRR DKKSL V KE R S+LE+K ATK+D GT+YEC FNKL + VTL+V+EEC LNQRKCKN+ CIDENKFCDGKNDCGDNSDEDR +CNECSPN+IHCDFLK A+P KRC+IKHWQCDGIDDCGNNFDELNCPVKN DKCIGTH+LC++++LIPRSYWCDG+ DC SMEDE+ CS+PQ++EP K IS+F+ STLT+TC+MSGRPVP+I+WRYNW HL ENL YNITT +SNCSVITS+LTV NI D SG+YSCEGI+RRR++APDF V V+KG ICQ+PFYNNDAW MCI+CYCSNLTD+C+SATGY NP +ES IKPSDAAIVN+KT EYY+PARE+TFAN KY+I++ Y K +P DYYFGG FN+ GSWL RYG+PL+Y+LILSGE+ Y+PGPL+VIKG SD +Y+C ++ +RLPVYAS + +EN +R+ LWEQ+ W D +C +R+ F+NVL NV L+LFKVKY+ QT+F MSKIS+ EAI+T + Y+W LEKC CPAGYSGLSCE K
Sbjct: 401 VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVK--YRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCENK 1153

HSP 3 Score: 428.713 bits (1101), Expect = 4.18246e-125
Identity = 211/402 (52.49%), Postives = 283/402 (70.40%), Query Frame = 2
Query:  167 LIPLFVLYILLISSFVQGFEPTRNVSVDVEDFKSGVINVYFVCPDIRSKKELIRYYKIVDNDPVFLKEKRTAFGIIVQLKSASDLGKYQCSILKEDKSMRNATLNIMDKNTMISPRTFVYNTKETKYVTAEKGPVELVCGLKESGDVTWYRPHQYHIHSGRTFKIDNIDDYSYGTYYCSSGETRQSSVNVQKIILVKETPQKPEAPIDANVDNMESFNARSNIIRYRPQSVLKNSDTVVWENPPGTVLLDHGRDLYLKSSEIDSNGYYYRISRNGKPEINIVGKVLISKIVNDNIPMDVQGPVIYGGKMEIDCIS-KTELESDTEIVWKRNDTIIHRGNTLVIERFLKEAFGKYSCEIVKGKQELKTRFVNLMPEQKIESKIEMTPEPGNYYLFHSGSKKRV 1369
+IPLF+ L+ +F GF+PTRNVSV++++ K ++FVCP IR ++I+YYK V+N+ V +KE+ T+ GI+++LK DLGKY+CS+L +DK++RN+TLNI D++ + SP+ FVY + YV G VEL CG E V W+RP QYHI+SG +KID ID YSYGTYYCS GE + SV V+KIILVK Q E PID V +E+ + S IRYR +V+ N D V WE+PPGT+LLD+ RD Y+KS + YYRI+R G P IN +GK+LIS +D+I MDV P+ YG +M+IDC++ E D +++WK++D +IH GNTL I F K+AFGKYSCEI++G QE K RFVNL P+QKIE+KIEMTP+PG YYL+HSG KK +
Sbjct: 6 VIPLFIFQFLISQTF--GFQPTRNVSVNIKNSKFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKEL 405

HSP 4 Score: 428.713 bits (1101), Expect = 4.18246e-125
Identity = 211/402 (52.49%), Postives = 283/402 (70.40%), Query Frame = -2
Query: 6054 LIPLFVLYILLISSFVQGFEPTRNVSVDVEDFKSGVINVYFVCPDIRSKKELIRYYKIVDNDPVFLKEKRTAFGIIVQLKSASDLGKYQCSILKEDKSMRNATLNIMDKNTMISPRTFVYNTKETKYVTAEKGPVELVCGLKESGDVTWYRPHQYHIHSGRTFKIDNIDDYSYGTYYCSSGETRQSSVNVQKIILVKETPQKPEAPIDANVDNMESFNARSNIIRYRPQSVLKNSDTVVWENPPGTVLLDHGRDLYLKSSEIDSNGYYYRISRNGKPEINIVGKVLISKIVNDNIPMDVQGPVIYGGKMEIDCIS-KTELESDTEIVWKRNDTIIHRGNTLVIERFLKEAFGKYSCEIVKGKQELKTRFVNLMPEQKIESKIEMTPEPGNYYLFHSGSKKRV 7256
+IPLF+ L+ +F GF+PTRNVSV++++ K ++FVCP IR ++I+YYK V+N+ V +KE+ T+ GI+++LK DLGKY+CS+L +DK++RN+TLNI D++ + SP+ FVY + YV G VEL CG E V W+RP QYHI+SG +KID ID YSYGTYYCS GE + SV V+KIILVK Q E PID V +E+ + S IRYR +V+ N D V WE+PPGT+LLD+ RD Y+KS + YYRI+R G P IN +GK+LIS +D+I MDV P+ YG +M+IDC++ E D +++WK++D +IH GNTL I F K+AFGKYSCEI++G QE K RFVNL P+QKIE+KIEMTP+PG YYL+HSG KK +
Sbjct: 6 VIPLFIFQFLISQTF--GFQPTRNVSVNIKNSKFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKEL 405
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001730 (Asxlregen_comp65513_c0_seq1|m.19286|m.12982)

HSP 1 Score: 257.684 bits (657), Expect = 4.17214e-71
Identity = 159/513 (30.99%), Postives = 250/513 (48.73%), Query Frame = 3
Query: 1359 KKELHCEIGRLDNRWTMFAKNVIWTLNDKKIDIK-HPLYGLK-IGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANINSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGTYVCRVLGKKVFGR--VIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWRRF---------DKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDV-LIPRSYWCDGDSDCKSMEDEKSCSHPQVV-EPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA-RRRVMAPDFIVVVS 2849
K+ELHCEIG + KN IW ++I+ + Y ++ I RL VSI+VL+ + EG Y+C A +++ EV+PS+QT E HCR++ + + WSF+ + + + S + TSF+++ + G Y+C + R +IV++ + V+P I ++ G A F C ++GA + F D + V K G Q L + T ND+GT + C + +V + V+ C+ R C+N CI+ KFCDGK DC D SDED+ C +C P + C+ G P HW CDG DDCGN +DE C N +C G + C+D IPR++ CD D+DC + +DE C+ P ++ E +I+ G T+TLTC+++G P+P I WR+NWG L+ + NC STLT+ G+Y+CE ++ +R + D+ ++++
Sbjct: 410 KRELHCEIGV---NTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLE--AGKVQ--LTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC-FGNVLECGGLKYQCNDGTKSIPRAFVCDKDTDCVNGDDESRCTQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMN 911

HSP 2 Score: 257.684 bits (657), Expect = 4.17214e-71
Identity = 159/513 (30.99%), Postives = 250/513 (48.73%), Query Frame = -3
Query: 4574 KKELHCEIGRLDNRWTMFAKNVIWTLNDKKIDIK-HPLYGLK-IGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANINSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGTYVCRVLGKKVFGR--VIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWRRF---------DKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDV-LIPRSYWCDGDSDCKSMEDEKSCSHPQVV-EPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA-RRRVMAPDFIVVVS 6064
K+ELHCEIG + KN IW ++I+ + Y ++ I RL VSI+VL+ + EG Y+C A +++ EV+PS+QT E HCR++ + + WSF+ + + + S + TSF+++ + G Y+C + R +IV++ + V+P I ++ G A F C ++GA + F D + V K G Q L + T ND+GT + C + +V + V+ C+ R C+N CI+ KFCDGK DC D SDED+ C +C P + C+ G P HW CDG DDCGN +DE C N +C G + C+D IPR++ CD D+DC + +DE C+ P ++ E +I+ G T+TLTC+++G P+P I WR+NWG L+ + NC STLT+ G+Y+CE ++ +R + D+ ++++
Sbjct: 410 KRELHCEIGV---NTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLE--AGKVQ--LTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC-FGNVLECGGLKYQCNDGTKSIPRAFVCDKDTDCVNGDDESRCTQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMN 911

HSP 3 Score: 32.3426 bits (72), Expect = 4.17214e-71
Identity = 21/78 (26.92%), Postives = 34/78 (43.59%), Query Frame = 2
Query: 1154 NDTIIHRGNTLVIERFLKEAFGKYSCEIVKGKQELKTRFVN------LMPEQKIESKIEMTPEPGNYYLFHSGSKKRV 1369
ND +I + + I R K G Y C + +G+ +N + E K SKIE++ PG +G K+ +
Sbjct: 337 NDRLISQSSRHTIPRLDKTNMGVYQC-VSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKREL 413

HSP 4 Score: 32.3426 bits (72), Expect = 4.17214e-71
Identity = 21/78 (26.92%), Postives = 34/78 (43.59%), Query Frame = -2
Query: 6054 NDTIIHRGNTLVIERFLKEAFGKYSCEIVKGKQELKTRFVN------LMPEQKIESKIEMTPEPGNYYLFHSGSKKRV 6269
ND +I + + I R K G Y C + +G+ +N + E K SKIE++ PG +G K+ +
Sbjct: 337 NDRLISQSSRHTIPRLDKTNMGVYQC-VSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKREL 413
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003584 (SmedAsxldir_c102345_g1_i1|m.54199|m.2277)

HSP 1 Score: 228.024 bits (580), Expect = 5.07192e-65
Identity = 151/514 (29.38%), Postives = 247/514 (48.05%), Query Frame = 3
Query: 1359 KKELHCEI-GRLDNRWTMFAKNVIWTLNDKKI---DIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDT-ANINSSFIQWSFIPENSKTEVELPPEA-KVSRPALTSSTSFVVIENTLKRHEGTYVC-RVLGKKVFGRVIV---KAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWR-RFD-KKSLEVNKENR-----IGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGI-ARRRVMAPDFIVVV 2846
KKELHCEI NR K W +N KK DI PL + RLD VS+LV+ +++ EG Y+C +++ L++ + LIE +P V + Q E HCR++ ++ + ++W+F + +P ++ + TSF+V+ G Y+C G+ +IV K K L ++P+ I ++ G C G+ F + + ++ R +G + + + + +D+ C ++V + C R C+N C++ KFCD N C D SDED C EC P + C+ P K + HW CDG +DCGN +DE NC + + C G F C D+ IPR Y CD + DC EDE C+ PQ+ + ++ S +TLTCE +G+P+P + WR+NWG + + ++ ++C+ +TS+LT+ + G+Y+CE + +R+R + DF V++
Sbjct: 331 KKELHCEIETSSGNR----GKEAEWYINGKKFKNGDI--PL----VNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEG--QSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKS-QLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 831

HSP 2 Score: 228.024 bits (580), Expect = 5.07192e-65
Identity = 151/514 (29.38%), Postives = 247/514 (48.05%), Query Frame = -3
Query: 4577 KKELHCEI-GRLDNRWTMFAKNVIWTLNDKKI---DIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDT-ANINSSFIQWSFIPENSKTEVELPPEA-KVSRPALTSSTSFVVIENTLKRHEGTYVC-RVLGKKVFGRVIV---KAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWR-RFD-KKSLEVNKENR-----IGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGI-ARRRVMAPDFIVVV 6064
KKELHCEI NR K W +N KK DI PL + RLD VS+LV+ +++ EG Y+C +++ L++ + LIE +P V + Q E HCR++ ++ + ++W+F + +P ++ + TSF+V+ G Y+C G+ +IV K K L ++P+ I ++ G C G+ F + + ++ R +G + + + + +D+ C ++V + C R C+N C++ KFCD N C D SDED C EC P + C+ P K + HW CDG +DCGN +DE NC + + C G F C D+ IPR Y CD + DC EDE C+ PQ+ + ++ S +TLTCE +G+P+P + WR+NWG + + ++ ++C+ +TS+LT+ + G+Y+CE + +R+R + DF V++
Sbjct: 331 KKELHCEIETSSGNR----GKEAEWYINGKKFKNGDI--PL----VNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEG--QSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKS-QLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 831

HSP 3 Score: 41.9726 bits (97), Expect = 5.07192e-65
Identity = 31/104 (29.81%), Postives = 47/104 (45.19%), Query Frame = 2
Query: 1079 YGGKMEIDCISKTELE---SDTEIVWKRNDTIIHRGNTLVIERFLKEAFGKYSC----EIVKGKQELKTRFVNLMPEQKIESKIEMTPEPGNYYLFHSGSKKRV 1369
YG + + C E+E + + W + D I LVI+ F K+ G Y C ++ GK +L + + ESKIE+T +PG H G KK +
Sbjct: 236 YGERFSLRC----EVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFR-ESKIELTTKPGPQVFVHRGEKKEL 334

HSP 4 Score: 41.9726 bits (97), Expect = 5.07192e-65
Identity = 31/104 (29.81%), Postives = 47/104 (45.19%), Query Frame = -2
Query: 6054 YGGKMEIDCISKTELE---SDTEIVWKRNDTIIHRGNTLVIERFLKEAFGKYSC----EIVKGKQELKTRFVNLMPEQKIESKIEMTPEPGNYYLFHSGSKKRV 6344
YG + + C E+E + + W + D I LVI+ F K+ G Y C ++ GK +L + + ESKIE+T +PG H G KK +
Sbjct: 236 YGERFSLRC----EVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFR-ESKIELTTKPGPQVFVHRGEKKEL 334
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15035123 (SmedSxlregen_c88126_g1_i1|m.36302|m.5005)

HSP 1 Score: 240.736 bits (613), Expect = 1.44437e-64
Identity = 167/522 (31.99%), Postives = 249/522 (47.70%), Query Frame = 3
Query: 1323 NPVITTSFIPEAKKELHCEIGRLDNRWTMFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTA-NINSSFIQWSFIPENSKTEVELP-PEAKVSRPALTSSTSFVVIENTLKRHEGTYVC-RVLGKKVFGRVIV---KAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWR-RFD---KKSLEVNKE---NRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGI-ARRRVMAPDFIVVV 2846
NP + KKELHCEI +D + +N+ W N K I+ + ++ R++ VSILVL D EG Y+C A ++++ +I PS+ V + E HCRID NI++ + W F N + L + +++ + TSF+ ++ G C G ++IV K K + V+P + ++ F C +G +F+ K +E +K +G S I D + C NK + V + V+E C NQR+C+N C+ KFCDG DC D SDED T CN C P C + G PT++ + K+W CDG +DCGNN+DE+NC K+T KC G F C +++ IPR CDG+SDC EDE C P ++ K + GS + L CE + P+P+I WR+NWG L I+T NC + STLT+ +Y+CE + + R ++ DF V +
Sbjct: 409 NPGPNIALKLNEKKELHCEIEDIDG---LSGENIEWFFNGKMIE-NSLIKSYRLDRVNKRLVSILVLMNSQLDNEGRYECRYGIVRKEATVMLDIDSGMIVTNPSKIKVIEG--SPVEFHCRIDDVYNIDNRNLSWRFYNNNFQINYSLENSKWRLTESKIADHTSFINLDRATMADSGYIECISGNGLTAQSQLIVVEDKHKFNITVTPNHLRVRKNQLFEFECFGQSDEGIPYGEPKFEFPGGKPVENDKRFLVTTVGPSRIRITAPHGVNIKDELKLI-CSVNKQVSAVYIQVQETCPPNQRQCQNRQCLPVGKFCDGIADCVDGSDEDPTVCNSCEPAFTTCQDVYGFAPTRKTINKNWICDGENDCGNNYDEINCEDKST-KCNGLFFTCKNNMTIPRGQVCDGNSDCLLDEDEADCLKPVIISTSKS-HVKANIGSKVKLQCEATAHPLPTIIWRFNWGCLPNENRVTISTVKKNCRKVISTLTIDEFQAGDDAIYNCEALSSSNRALSQDFHVSI 921

HSP 2 Score: 240.736 bits (613), Expect = 1.44437e-64
Identity = 167/522 (31.99%), Postives = 249/522 (47.70%), Query Frame = -3
Query: 4577 NPVITTSFIPEAKKELHCEIGRLDNRWTMFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTA-NINSSFIQWSFIPENSKTEVELP-PEAKVSRPALTSSTSFVVIENTLKRHEGTYVC-RVLGKKVFGRVIV---KAKPVLKVSPKTITIKPGGDARFLCQLMGADGKVIWR-RFD---KKSLEVNKE---NRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGI-ARRRVMAPDFIVVV 6100
NP + KKELHCEI +D + +N+ W N K I+ + ++ R++ VSILVL D EG Y+C A ++++ +I PS+ V + E HCRID NI++ + W F N + L + +++ + TSF+ ++ G C G ++IV K K + V+P + ++ F C +G +F+ K +E +K +G S I D + C NK + V + V+E C NQR+C+N C+ KFCDG DC D SDED T CN C P C + G PT++ + K+W CDG +DCGNN+DE+NC K+T KC G F C +++ IPR CDG+SDC EDE C P ++ K + GS + L CE + P+P+I WR+NWG L I+T NC + STLT+ +Y+CE + + R ++ DF V +
Sbjct: 409 NPGPNIALKLNEKKELHCEIEDIDG---LSGENIEWFFNGKMIE-NSLIKSYRLDRVNKRLVSILVLMNSQLDNEGRYECRYGIVRKEATVMLDIDSGMIVTNPSKIKVIEG--SPVEFHCRIDDVYNIDNRNLSWRFYNNNFQINYSLENSKWRLTESKIADHTSFINLDRATMADSGYIECISGNGLTAQSQLIVVEDKHKFNITVTPNHLRVRKNQLFEFECFGQSDEGIPYGEPKFEFPGGKPVENDKRFLVTTVGPSRIRITAPHGVNIKDELKLI-CSVNKQVSAVYIQVQETCPPNQRQCQNRQCLPVGKFCDGIADCVDGSDEDPTVCNSCEPAFTTCQDVYGFAPTRKTINKNWICDGENDCGNNYDEINCEDKST-KCNGLFFTCKNNMTIPRGQVCDGNSDCLLDEDEADCLKPVIISTSKS-HVKANIGSKVKLQCEATAHPLPTIIWRFNWGCLPNENRVTISTVKKNCRKVISTLTIDEFQAGDDAIYNCEALSSSNRALSQDFHVSI 921
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001643 (Asxlregen_comp65113_c0_seq2|m.18193|m.7115)

HSP 1 Score: 229.95 bits (585), Expect = 3.07482e-61
Identity = 158/515 (30.68%), Postives = 251/515 (48.74%), Query Frame = 3
Query: 1359 KKELHCEIGRLD-NRWTMFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRID-TANINSSFIQWSFIPENSK---TEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGTYVCRVL-GKKVFGRVIVKAKP---VLKVSPKTITIKPGGDARFLCQLMGAD-----GKVIWRRFDKKSLEVNK---ENRIGGSTQSILEIKQATK-NDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIAR-RRVMAPDFIVVV 2846
KKE+HCEI NR +V W N +++D + KI R D N VSI+ L + EG Y C + + A L++ + + + + P + + N + E HCR + + ++ ++WSF + + +E ++S T TSF+ I ++L + G Y+C G + +++K + +L ++P+ + ++ G C + G+ + KSL + E ++G S + L IK + +D+ EC ++ T+F+E +C N R+C N C KFCDG +C D SDE+ + CN+C P C+ P K + HW+CDG +DCGNNFDE C +N KC F C + +IPR+Y CD +SDC + EDE C PQV + G + L CE G P P I WRYNWG LS++L I T I C+ + S L + N G+Y+CE ++ R + D+ +++
Sbjct: 423 KKEMHCEISTSSPNR----GSDVEWFFNKERLD-ETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINP--ERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQS-RVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCN-ENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRRGGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 928

HSP 2 Score: 229.95 bits (585), Expect = 3.07482e-61
Identity = 158/515 (30.68%), Postives = 251/515 (48.74%), Query Frame = -3
Query: 4577 KKELHCEIGRLD-NRWTMFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTYKCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRID-TANINSSFIQWSFIPENSK---TEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGTYVCRVL-GKKVFGRVIVKAKP---VLKVSPKTITIKPGGDARFLCQLMGAD-----GKVIWRRFDKKSLEVNK---ENRIGGSTQSILEIKQATK-NDHGTIYECVFNKLIEQVTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIAR-RRVMAPDFIVVV 6064
KKE+HCEI NR +V W N +++D + KI R D N VSI+ L + EG Y C + + A L++ + + + + P + + N + E HCR + + ++ ++WSF + + +E ++S T TSF+ I ++L + G Y+C G + +++K + +L ++P+ + ++ G C + G+ + KSL + E ++G S + L IK + +D+ EC ++ T+F+E +C N R+C N C KFCDG +C D SDE+ + CN+C P C+ P K + HW+CDG +DCGNNFDE C +N KC F C + +IPR+Y CD +SDC + EDE C PQV + G + L CE G P P I WRYNWG LS++L I T I C+ + S L + N G+Y+CE ++ R + D+ +++
Sbjct: 423 KKEMHCEISTSSPNR----GSDVEWFFNKERLD-ETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINP--ERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQS-RVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCN-ENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRRGGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 928
BLAST of laminin vs. RefSeq Human
Match: gi|578798995|ref|XP_006710657.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X2 [Homo sapiens])

HSP 1 Score: 155.606 bits (392), Expect = 1.61286e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 2951
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 549

HSP 2 Score: 155.606 bits (392), Expect = 1.61286e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = -3
Query: 4472 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 5242
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 549
BLAST of laminin vs. RefSeq Human
Match: gi|126012571|ref|NP_005520.4| (basement membrane-specific heparan sulfate proteoglycan core protein isoform b precursor [Homo sapiens])

HSP 1 Score: 155.606 bits (392), Expect = 1.6273e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 2951
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 532

HSP 2 Score: 155.606 bits (392), Expect = 1.6273e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = -3
Query: 4472 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 5242
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 532
BLAST of laminin vs. RefSeq Human
Match: gi|578799001|ref|XP_006710660.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X9 [Homo sapiens])

HSP 1 Score: 155.606 bits (392), Expect = 1.62773e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 2951
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 532

HSP 2 Score: 155.606 bits (392), Expect = 1.62773e-36
Identity = 89/264 (33.71%), Postives = 125/264 (47.35%), Query Frame = -3
Query: 4472 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 5242
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V +G FY ++ C+ C+C +T C S
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQS 532
BLAST of laminin vs. RefSeq Human
Match: gi|767903961|ref|XP_011539621.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X6 [Homo sapiens])

HSP 1 Score: 153.68 bits (387), Expect = 5.67062e-36
Identity = 87/264 (32.95%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 2951
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V + C + + ++ C+ C+C +T C S
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQS 550

HSP 2 Score: 153.68 bits (387), Expect = 5.67062e-36
Identity = 87/264 (32.95%), Postives = 125/264 (47.35%), Query Frame = -3
Query: 4472 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 5242
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V + C + + ++ C+ C+C +T C S
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQS 550
BLAST of laminin vs. RefSeq Human
Match: gi|767903957|ref|XP_011539620.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X3 [Homo sapiens])

HSP 1 Score: 153.295 bits (386), Expect = 7.74627e-36
Identity = 87/264 (32.95%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 2951
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V + C + + ++ C+ C+C +T C S
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQS 550

HSP 2 Score: 153.295 bits (386), Expect = 7.74627e-36
Identity = 87/264 (32.95%), Postives = 125/264 (47.35%), Query Frame = -3
Query: 4472 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIG-THFLC-DDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARRRVM--APDFI--VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTS 5242
C + C+N CI + CDG+ DC D SDE D C PN C C +K W+CDG DC + DE NCP K ++ G T F C ++ IP S+ CD +SDC DE C PQVV P ++ I G T+T TC G P P I WR NWGH+ + +T++ TL + ++ G Y+CE + R ++ PD + +V + C + + ++ C+ C+C +T C S
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRE-SIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLE--HSAACLPCFCFGITSVCQS 550
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389355|ref|NP_001245492.2| (terribly reduced optic lobes, isoform AL [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 5.25476e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = 3
Query: 1920 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 3611
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 617 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1169

HSP 2 Score: 194.897 bits (494), Expect = 5.25476e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = -3
Query: 3812 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 5503
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 617 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1169

HSP 3 Score: 75.8702 bits (185), Expect = 5.65285e-13
Identity = 55/217 (25.35%), Postives = 87/217 (40.09%), Query Frame = 3
Query: 2178 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 2807
EC N+ +C N CID K C+ +DC + DE+ C C N C+ CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENE-EC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 686

HSP 4 Score: 75.8702 bits (185), Expect = 5.65285e-13
Identity = 55/217 (25.35%), Postives = 87/217 (40.09%), Query Frame = -3
Query: 4616 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 5245
EC N+ +C N CID K C+ +DC + DE+ C C N C+ CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENE-EC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 686

HSP 5 Score: 68.1662 bits (165), Expect = 1.36389e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = 3
Query: 2781 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 3611
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1638 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 1890

HSP 6 Score: 68.1662 bits (165), Expect = 1.36389e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = -3
Query: 3812 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 4642
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1638 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 1890

HSP 7 Score: 67.3958 bits (163), Expect = 2.60181e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = 3
Query: 2838 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 3611
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1293 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1540

HSP 8 Score: 67.3958 bits (163), Expect = 2.60181e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = -3
Query: 3812 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 4585
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1293 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1540
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389377|ref|NP_001027033.3| (terribly reduced optic lobes, isoform AW [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 5.60148e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = 3
Query: 1920 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 3611
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 896 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1448

HSP 2 Score: 194.897 bits (494), Expect = 5.60148e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = -3
Query: 3812 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 5503
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 896 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1448

HSP 3 Score: 68.1662 bits (165), Expect = 1.3044e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = 3
Query: 2781 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 3611
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1917 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 2169

HSP 4 Score: 68.1662 bits (165), Expect = 1.3044e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = -3
Query: 3812 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 4642
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1917 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 2169

HSP 5 Score: 67.3958 bits (163), Expect = 2.46731e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = 3
Query: 2838 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 3611
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1572 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1819

HSP 6 Score: 67.3958 bits (163), Expect = 2.46731e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = -3
Query: 3812 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 4585
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1572 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1819

HSP 7 Score: 63.1586 bits (152), Expect = 4.45427e-09
Identity = 46/145 (31.72%), Postives = 65/145 (44.83%), Query Frame = 3
Query: 2178 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK--NTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG 2606
EC N+ +C N CID K C+ +DC + DE+ CS C D T RC+ QCDG DC + DE +C ++++C F C IP CD DC DE +C VE E++ ++ + G
Sbjct: 531 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQC-----RDGT-RCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNC-----VEGEEEDRVGIPIG 664

HSP 8 Score: 63.1586 bits (152), Expect = 4.45427e-09
Identity = 46/145 (31.72%), Postives = 65/145 (44.83%), Query Frame = -3
Query: 4817 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK--NTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG 5245
EC N+ +C N CID K C+ +DC + DE+ CS C D T RC+ QCDG DC + DE +C ++++C F C IP CD DC DE +C VE E++ ++ + G
Sbjct: 531 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQC-----RDGT-RCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNC-----VEGEEEDRVGIPIG 664

HSP 9 Score: 54.299 bits (129), Expect = 2.22571e-06
Identity = 37/158 (23.42%), Postives = 62/158 (39.24%), Query Frame = 3
Query: 2355 CVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 2807
CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 820 CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRP---LPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 965

HSP 10 Score: 54.299 bits (129), Expect = 2.22571e-06
Identity = 37/158 (23.42%), Postives = 62/158 (39.24%), Query Frame = -3
Query: 4616 CVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 5068
CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 820 CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRP---LPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 965

HSP 11 Score: 51.9878 bits (123), Expect = 9.49499e-06
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK 2444
C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + D+
Sbjct: 808 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 889

HSP 12 Score: 51.9878 bits (123), Expect = 9.49499e-06
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = -3
Query: 4979 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK 5242
C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + D+
Sbjct: 808 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 889
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389369|ref|NP_001284822.1| (terribly reduced optic lobes, isoform AS [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 5.9487e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = 3
Query: 1920 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 3611
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 694 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1246

HSP 2 Score: 194.897 bits (494), Expect = 5.9487e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = -3
Query: 3812 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 5503
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 694 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1246

HSP 3 Score: 72.4034 bits (176), Expect = 6.83974e-12
Identity = 41/126 (32.54%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2178 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSH 2555
EC N+ +C N CID K C+ +DC + DE+ C C N C+ CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C H
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENE-EC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGH 605

HSP 4 Score: 72.4034 bits (176), Expect = 6.83974e-12
Identity = 41/126 (32.54%), Postives = 61/126 (48.41%), Query Frame = -3
Query: 4868 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSH 5245
EC N+ +C N CID K C+ +DC + DE+ C C N C+ CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C H
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENE-EC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGH 605

HSP 5 Score: 68.1662 bits (165), Expect = 1.38928e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = 3
Query: 2781 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 3611
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1715 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 1967

HSP 6 Score: 68.1662 bits (165), Expect = 1.38928e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = -3
Query: 3812 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 4642
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1715 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 1967

HSP 7 Score: 67.3958 bits (163), Expect = 2.65017e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = 3
Query: 2838 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 3611
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1370 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1617

HSP 8 Score: 67.3958 bits (163), Expect = 2.65017e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = -3
Query: 3812 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 4585
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1370 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1617

HSP 9 Score: 54.299 bits (129), Expect = 1.97315e-06
Identity = 58/255 (22.75%), Postives = 92/255 (36.08%), Query Frame = 3
Query: 2172 EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK--------------------------CIGTHFLCDDDVLIPRSYWCDGDSDCK-SMEDEKSCSH-PQVVEPE-------KQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 2807
E C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC ++T+ C T F C++ I C+G DC DE C ++P Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 526 ECRCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDIDPADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 763

HSP 10 Score: 54.299 bits (129), Expect = 1.97315e-06
Identity = 58/255 (22.75%), Postives = 92/255 (36.08%), Query Frame = -3
Query: 4616 EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK--------------------------CIGTHFLCDDDVLIPRSYWCDGDSDCK-SMEDEKSCSH-PQVVEPE-------KQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 5251
E C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC ++T+ C T F C++ I C+G DC DE C ++P Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 526 ECRCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDIDPADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 763
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389363|ref|NP_001245498.2| (terribly reduced optic lobes, isoform AP [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 5.94918e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = 3
Query: 1920 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 3611
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 695 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1247

HSP 2 Score: 194.897 bits (494), Expect = 5.94918e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = -3
Query: 3812 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 5503
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 695 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1247

HSP 3 Score: 68.5514 bits (166), Expect = 1.10776e-10
Identity = 52/212 (24.53%), Postives = 82/212 (38.68%), Query Frame = 3
Query: 2193 QRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 2807
Q +C + C E++ CD C D SDE N C N C+ CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 576 QHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 764

HSP 4 Score: 68.5514 bits (166), Expect = 1.10776e-10
Identity = 52/212 (24.53%), Postives = 82/212 (38.68%), Query Frame = -3
Query: 4616 QRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 5230
Q +C + C E++ CD C D SDE N C N C+ CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 576 QHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 764

HSP 5 Score: 68.1662 bits (165), Expect = 1.29914e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = 3
Query: 2781 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 3611
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1716 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 1968

HSP 6 Score: 68.1662 bits (165), Expect = 1.29914e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = -3
Query: 3812 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 4642
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1716 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 1968

HSP 7 Score: 67.3958 bits (163), Expect = 2.65022e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = 3
Query: 2838 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 3611
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1371 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1618

HSP 8 Score: 67.3958 bits (163), Expect = 2.65022e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = -3
Query: 3812 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 4585
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1371 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1618

HSP 9 Score: 51.9878 bits (123), Expect = 9.46781e-06
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK 2444
C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + D+
Sbjct: 607 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 688

HSP 10 Score: 51.9878 bits (123), Expect = 9.46781e-06
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = -3
Query: 4979 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK 5242
C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + D+
Sbjct: 607 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 688
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389357|ref|NP_001245497.2| (terribly reduced optic lobes, isoform AM [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 6.44253e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = 3
Query: 1920 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 3611
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 856 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1408

HSP 2 Score: 194.897 bits (494), Expect = 6.44253e-49
Identity = 174/600 (29.00%), Postives = 255/600 (42.50%), Query Frame = -3
Query: 3812 LKVSPKTITIKPGGDARFLCQLMG-ADGKVIWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGT-IYECV-FNKLI--EQVTLFV------------EEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCN-ECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNC-PVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIARR--RVMAPDFIVVVS--KGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEY-YEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGG-------VFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYA-SEDSYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFE---KQTDFMMSKISINEAIKTKDKYTWVGNL-EKCNCPAGYSGLSCE 5503
LK P + IK + F C+ G A KV W R + L +R G LEI D GT + E V + I +QVT+ + E C Q C N CID++ CDG DC D SDE +C PN C +CV + W+CDG +DCG+N DE +C P + C F C IP+S+ CD DC DE C P + P Q +S+ L LTC +G P P+I WR NWGH+ + S T TL ++ SG YSCE I R + PD IV V + +C+ F+N A C++C+C + C SA + P I++++ P R++ A + + ++F T ++ G + G+ L YG L Y++ G S + + GP ++I G N F L ++ N++ + W P +K SR+ M +L NV+ +L ++ Y + ++ D + I+++ A T DK +L EKC CP GY G SCE
Sbjct: 856 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG-----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQ-SVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHP----------PILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITG-----------NRFTLTYRVRTQPGQNNRVSIPFVPGGWQK-PDGRK-ASREEIMMILANVDNILIRLGYLDSTAREVDLI--NIALDSA-GTADKGLGSASLVEKCQCPPGYVGDSCE 1408

HSP 3 Score: 68.1662 bits (165), Expect = 1.24987e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = 3
Query: 2781 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 3611
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1877 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 2129

HSP 4 Score: 68.1662 bits (165), Expect = 1.24987e-10
Identity = 73/286 (25.52%), Postives = 122/286 (42.66%), Query Frame = -3
Query: 3812 GVYSCEG---IARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSYQLILSGESY-KYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENK----IRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDK-YTWVGNLEKCNCPAGYSGLSCE 4642
G+Y C G + +R V+ + C+ Y A + C +CYCS L C SA Y PV+ + +A ++ ++ + + + N+ Y ++ ++P Y+ +V G+ L YG LSY LI+ ESY Y G IV+ G N +L +++ D EN+ +R+ EQ D + + SR FM VL ++ +L + + + + A+ T+ T ++E C CP+GY G SCE
Sbjct: 1877 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY-RQLIPVDFIL---NAPLITDESGAVQDTENLIPDISRNMYTY-----THTSYLPK---YWSLRGSVLGNQLFSYGGRLSYSLIV--ESYGNYERGHDIVLIG-----------NGLKL-IWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCE 2129

HSP 5 Score: 67.3958 bits (163), Expect = 2.52826e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = 3
Query: 2838 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 3611
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1532 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1779

HSP 6 Score: 67.3958 bits (163), Expect = 2.52826e-10
Identity = 63/266 (23.68%), Postives = 108/266 (40.60%), Query Frame = -3
Query: 3812 VVVSKGSICQKPFYNNDAWDTSMCIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAREVTFANANLKKYYIDKNSYIKFIPTAD-----YYFGGVFNVEGSWLNRYGFPLSYQLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASED---SYENKIRVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMSKISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCE 4585
V+ + C+ ++ +++ + CI+C+CS + DC S+T Y + V S S T Y +P + + + + + FI +AD Y+ G+ L+ YG L+Y L SY +P ++ D V G D RL Y S N V + E W + +R+H + L ++ + K Y + + +++++ A T +E+C CP GY GLSCE
Sbjct: 1532 VIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEP------NALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL-----SYSPLPNGIMSRNSAPDVVIKSG--EDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVV--ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1779

HSP 7 Score: 63.1586 bits (152), Expect = 4.80013e-09
Identity = 46/145 (31.72%), Postives = 65/145 (44.83%), Query Frame = 3
Query: 2178 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK--NTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG 2606
EC N+ +C N CID K C+ +DC + DE+ CS C D T RC+ QCDG DC + DE +C ++++C F C IP CD DC DE +C VE E++ ++ + G
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQC-----RDGT-RCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNC-----VEGEEEDRVGIPIG 624

HSP 8 Score: 63.1586 bits (152), Expect = 4.80013e-09
Identity = 46/145 (31.72%), Postives = 65/145 (44.83%), Query Frame = -3
Query: 4817 ECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVK--NTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG 5245
EC N+ +C N CID K C+ +DC + DE+ CS C D T RC+ QCDG DC + DE +C ++++C F C IP CD DC DE +C VE E++ ++ + G
Sbjct: 491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQC-----RDGT-RCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNC-----VEGEEEDRVGIPIG 624

HSP 9 Score: 54.299 bits (129), Expect = 2.33921e-06
Identity = 37/158 (23.42%), Postives = 62/158 (39.24%), Query Frame = 3
Query: 2355 CVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 2807
CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 780 CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRP---LPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 925

HSP 10 Score: 54.299 bits (129), Expect = 2.33921e-06
Identity = 37/158 (23.42%), Postives = 62/158 (39.24%), Query Frame = -3
Query: 4616 CVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGTHFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSGSTL-------TLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTVHNITMDQSGVYSCEGIA 5068
CV C+G +C ++ DELNC T +C+ F C+ + S C+G +DC+ DE++C+ Q+ + + S + C G + W G L T + L + NI ++ +G Y CE +
Sbjct: 780 CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRP---LPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVG 925

HSP 11 Score: 51.9878 bits (123), Expect = 9.81351e-06
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 2181 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK 2444
C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + D+
Sbjct: 768 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 849

HSP 12 Score: 51.9878 bits (123), Expect = 9.81351e-06
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = -3
Query: 4979 CALNQRKCKNDLCIDENKFCDGKNDCGDNSDE-DRTRCNECSPNAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDK 5242
C NQ +C N C+ + C+G ++C D+SDE + EC PN C+ + +CV +C+G DC ++ DE NC + D+
Sbjct: 768 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 849
The following BLAST results are available for this feature:
BLAST of laminin vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|30179887|sp|Q06561|UNC52_CAEEL6.674880e-3725.54RecName: Full=Basement membrane proteoglycan; AltN... [more]
gi|317373536|sp|P98160|PGBM_HUMAN4.311790e-3633.71RecName: Full=Basement membrane-specific heparan s... [more]
gi|1172451|sp|Q05793|PGBM_MOUSE6.381790e-3632.11RecName: Full=Basement membrane-specific heparan s... [more]
gi|160409939|sp|A2ARV4|LRP2_MOUSE1.375810e-1638.00RecName: Full=Low-density lipoprotein receptor-rel... [more]
gi|160332309|sp|P98164|LRP2_HUMAN1.769200e-1636.50RecName: Full=Low-density lipoprotein receptor-rel... [more]
back to top
BLAST of laminin vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150033254.182460e-12567.28SmedAsxldir_c101543_g1_i1|m.51138|m.8906[more]
SMU150017304.172140e-7130.99Asxlregen_comp65513_c0_seq1|m.19286|m.12982[more]
SMU150035845.071920e-6529.38SmedAsxldir_c102345_g1_i1|m.54199|m.2277[more]
SMU150351231.444370e-6431.99SmedSxlregen_c88126_g1_i1|m.36302|m.5005[more]
SMU150016433.074820e-6130.68Asxlregen_comp65113_c0_seq2|m.18193|m.7115[more]
back to top
BLAST of laminin vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|578798995|ref|XP_006710657.1|1.612860e-3633.71PREDICTED: basement membrane-specific heparan sulf... [more]
gi|126012571|ref|NP_005520.4|1.627300e-3633.71basement membrane-specific heparan sulfate proteog... [more]
gi|578799001|ref|XP_006710660.1|1.627730e-3633.71PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903961|ref|XP_011539621.1|5.670620e-3632.95PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903957|ref|XP_011539620.1|7.746270e-3632.95PREDICTED: basement membrane-specific heparan sulf... [more]
back to top
BLAST of laminin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|665389355|ref|NP_001245492.2|5.254760e-4929.00terribly reduced optic lobes, isoform AL [Drosophi... [more]
gi|665389377|ref|NP_001027033.3|5.601480e-4929.00terribly reduced optic lobes, isoform AW [Drosophi... [more]
gi|665389369|ref|NP_001284822.1|5.948700e-4929.00terribly reduced optic lobes, isoform AS [Drosophi... [more]
gi|665389363|ref|NP_001245498.2|5.949180e-4929.00terribly reduced optic lobes, isoform AP [Drosophi... [more]
gi|665389357|ref|NP_001245497.2|6.442530e-4929.00terribly reduced optic lobes, isoform AM [Drosophi... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_003647 ID=Ddo_003647|Name=laminin|organism=Dugesia dorotocephala|type=mRNA|length=7422bp
AACTGCATATTGAAACGAATAGGTCGAATAGTTGGAATCTGAAATATACA
CATCGTTTACTTATAATTGGTGGTCTGAAAATTGGAATTCATTTGCTGAC
AAACAGGTTTACCATCTGCATCATTCGTGTTAGAATAGGCAAATGAGTCC
CGATTGTCGATTCTATCTCATTCCGTTATTCGTCCTCTACATTCTTCTTA
TAAGCTCTTTTGTTCAAGGGTTTGAACCAACGAGGAATGTGTCTGTGGAC
GTTGAAGACTTTAAATCAGGTGTCATTAATGTGTACTTTGTCTGTCCGGA
TATTCGATCCAAGAAAGAACTCATAAGATATTATAAAATCGTCGATAATG
ATCCGGTATTTTTAAAAGAAAAACGAACAGCTTTTGGGATAATTGTACAA
CTAAAATCAGCCTCAGATTTAGGAAAGTATCAATGTTCTATTTTAAAGGA
AGACAAATCCATGAGAAATGCTACACTCAATATTATGGATAAAAATACGA
TGATTAGTCCAAGAACTTTTGTGTATAATACAAAAGAAACTAAATATGTA
ACCGCTGAGAAGGGTCCAGTCGAGTTGGTTTGTGGACTGAAGGAGTCTGG
CGATGTGACATGGTATAGACCCCATCAGTACCATATTCATTCCGGAAGAA
CTTTTAAAATAGATAACATAGACGATTATTCCTATGGAACATATTATTGT
TCTTCCGGAGAAACAAGGCAATCCTCTGTCAATGTACAGAAAATTATTTT
GGTTAAAGAAACCCCACAAAAACCAGAAGCTCCAATCGACGCCAATGTTG
ATAACATGGAGTCTTTCAATGCCAGATCAAATATTATTCGTTATCGGCCT
CAAAGTGTTTTAAAAAACAGTGATACTGTGGTATGGGAAAACCCTCCGGG
AACAGTTTTATTAGACCATGGTCGAGACCTATATCTAAAATCATCGGAAA
TTGATAGTAATGGATACTACTACAGGATTAGTAGAAATGGAAAGCCAGAA
ATTAATATCGTTGGAAAGGTTTTAATTTCCAAAATAGTAAATGACAATAT
ACCGATGGATGTCCAGGGACCCGTTATATACGGAGGGAAAATGGAAATCG
ACTGTATTTCTAAGACAGAATTAGAAAGTGATACTGAAATTGTTTGGAAA
AGAAATGATACGATTATTCACCGGGGAAATACTTTGGTTATTGAAAGATT
CTTGAAAGAAGCATTCGGTAAATACAGTTGTGAAATAGTTAAAGGAAAGC
AGGAATTAAAAACACGTTTTGTAAACCTAATGCCAGAACAAAAAATCGAA
TCGAAGATTGAAATGACACCGGAACCCGGTAATTACTACCTCTTTCATTC
CGGAAGCAAAAAAAGAGTTACATTGCGAAATTGGAAGACTTGATAATAGA
TGGACAATGTTTGCAAAGAATGTTATTTGGACATTAAATGATAAGAAAAT
TGATATAAAACATCCATTATATGGTTTGAAAATCGGAAGATTAGATACAA
ATTCAGTCAGTATATTGGTTCTTAAAGAAATGGCAGATGATCTTGAAGGG
ACGTATAAATGTTATCAGAATACAACGGTACTTGCAGCAAAACTTTTGAT
GGAGAGAAGTGATGTATTAATTGAGGTTGCTCCATCTGAACAAACTGTAT
TCGATAATGTTAACCAAGAATCCGAATTGCATTGTCGAATAGATACTGCT
AACATTAATTCAAGCTTCATACAATGGTCATTTATTCCAGAAAATTCCAA
AACGGAAGTAGAACTTCCACCTGAAGCTAAGGTTTCTCGACCAGCATTGA
CCTCTTCAACTTCATTTGTTGTAATTGAAAACACCTTGAAAAGACATGAA
GGTACATATGTCTGCAGAGTTCTTGGTAAAAAGGTTTTTGGCCGAGTGAT
TGTTAAGGCAAAACCAGTATTGAAAGTTTCCCCCAAAACAATAACCATTA
AACCTGGAGGTGATGCGAGATTTCTTTGTCAACTAATGGGAGCAGATGGA
AAAGTTATTTGGAGGAGATTTGACAAAAAGAGTTTAGAAGTCAACAAAGA
AAACAGAATTGGTGGAAGTACTCAGAGTATATTAGAAATAAAACAAGCAA
CGAAAAATGATCACGGAACTATTTATGAATGTGTTTTTAATAAACTAATT
GAGCAAGTGACGCTCTTTGTTGAAGAAGAATGTGCTTTGAATCAAAGAAA
ATGTAAAAATGATCTCTGTATAGATGAAAATAAGTTTTGTGACGGTAAAA
ATGACTGTGGAGATAATTCTGATGAAGACCGAACGAGATGCAATGAATGT
AGTCCAAACGCTATTCACTGCGACTTTCTGAAAGGCGCAGATCCGACCAA
ACGTTGTGTTATAAAGCATTGGCAGTGTGACGGCATTGATGACTGTGGAA
ATAACTTTGATGAGCTTAATTGTCCAGTTAAGAACACGGACAAATGCATT
GGCACTCATTTTCTCTGTGATGACGATGTTTTGATTCCCAGATCATATTG
GTGTGATGGGGATTCTGATTGCAAATCAATGGAAGATGAGAAGAGTTGCA
GTCATCCTCAAGTAGTAGAGCCTGAAAAACAGATGCAAATATCAGTTTTT
AGCGGTTCAACTTTAACTCTAACTTGTGAAATGTCAGGCCGTCCAGTACC
CTCAATCACATGGAGATACAATTGGGGACATTTATCTGAGAATCTTTTGT
ATAATATAACGACGAAGATATCAAATTGTAGTGTAATAACAAGCACTTTA
ACTGTTCACAACATCACCATGGATCAAAGTGGAGTTTATTCTTGCGAAGG
AATAGCAAGACGTCGAGTGATGGCACCCGACTTCATTGTTGTAGTTTCAA
AGGGCTCAATTTGTCAAAAACCATTTTATAACAATGATGCGTGGGATACG
TCAATGTGCATCAAATGTTATTGCTCAAATCTGACCGATGATTGCACCAG
CGCTACTGGCTACGTAAATAATCCGCAACCAGTTGAAAGTGGTATAAAGC
CTTCAGATGCTGCTATAGTCAATTACAAAACAACTGAATATTATGAACCG
GCGCGAGAAGTCACATTTGCAAATGCAAATTTAAAGAAATACTATATTGA
TAAAAATTCCTATATTAAATTCATACCGACTGCCGATTATTATTTTGGGG
GAGTTTTCAATGTGGAAGGATCTTGGTTGAACAGATATGGCTTTCCTCTA
TCGTACCAACTAATTTTATCAGGTGAAAGCTACAAATATATACCTGGTCC
ACTTATCGTAATAAAGGGAGGCTCTGACTATGTATATTATTGTGGGATCC
AAAATGATTTCCGTCTCCCAGTTTATGCATCGGAAGATAGTTATGAAAAT
AAAATCAGAGTGGTCTTATGGGAACAAGAATGGCATGCTGATCCTCAGTG
CAAAAAAGGTGTATCTAGACAACATTTCATGAATGTTTTAATAAACGTGA
ACTTACTTCTCTTCAAAGTCAAATACTTTGAAAAACAAACTGATTTTATG
ATGTCAAAGATATCAATAAACGAAGCTATAAAAACGAAAGATAAATATAC
TTGGGTCGGTAATTTGGAAAAATGTAACTGCCCAGCAGGATATTCGGGAT
TATCATGCGAAATTAAGTCAAATGAACGATAATTCTTCATCAATCAACTA
TAGTATTACCCAATTTTAGAAACTTTATTTGTTTTTGCGTTATAATTTGT
TATATGCCTTTAAAGGCATATAACAAATTATAACGCAAAAACAAATAAAG
TTTCTAAAATTGGGTAATACTATAGTTGATTGATGAAGAATTATCGTTCA
TTTGACTTAATTTCGCATGATAATCCCGAATATCCTGCTGGGCAGTTACA
TTTTTCCAAATTACCGACCCAAGTATATTTATCTTTCGTTTTTATAGCTT
CGTTTATTGATATCTTTGACATCATAAAATCAGTTTGTTTTTCAAAGTAT
TTGACTTTGAAGAGAAGTAAGTTCACGTTTATTAAAACATTCATGAAATG
TTGTCTAGATACACCTTTTTTGCACTGAGGATCAGCATGCCATTCTTGTT
CCCATAAGACCACTCTGATTTTATTTTCATAACTATCTTCCGATGCATAA
ACTGGGAGACGGAAATCATTTTGGATCCCACAATAATATACATAGTCAGA
GCCTCCCTTTATTACGATAAGTGGACCAGGTATATATTTGTAGCTTTCAC
CTGATAAAATTAGTTGGTACGATAGAGGAAAGCCATATCTGTTCAACCAA
GATCCTTCCACATTGAAAACTCCCCCAAAATAATAATCGGCAGTCGGTAT
GAATTTAATATAGGAATTTTTATCAATATAGTATTTCTTTAAATTTGCAT
TTGCAAATGTGACTTCTCGCGCCGGTTCATAATATTCAGTTGTTTTGTAA
TTGACTATAGCAGCATCTGAAGGCTTTATACCACTTTCAACTGGTTGCGG
ATTATTTACGTAGCCAGTAGCGCTGGTGCAATCATCGGTCAGATTTGAGC
AATAACATTTGATGCACATTGACGTATCCCACGCATCATTGTTATAAAAT
GGTTTTTGACAAATTGAGCCCTTTGAAACTACAACAATGAAGTCGGGTGC
CATCACTCGACGTCTTGCTATTCCTTCGCAAGAATAAACTCCACTTTGAT
CCATGGTGATGTTGTGAACAGTTAAAGTGCTTGTTATTACACTACAATTT
GATATCTTCGTCGTTATATTATACAAAAGATTCTCAGATAAATGTCCCCA
ATTGTATCTCCATGTGATTGAGGGTACTGGACGGCCTGACATTTCACAAG
TTAGAGTTAAAGTTGAACCGCTAAAAACTGATATTTGCATCTGTTTTTCA
GGCTCTACTACTTGAGGATGACTGCAACTCTTCTCATCTTCCATTGATTT
GCAATCAGAATCCCCATCACACCAATATGATCTGGGAATCAAAACATCGT
CATCACAGAGAAAATGAGTGCCAATGCATTTGTCCGTGTTCTTAACTGGA
CAATTAAGCTCATCAAAGTTATTTCCACAGTCATCAATGCCGTCACACTG
CCAATGCTTTATAACACAACGTTTGGTCGGATCTGCGCCTTTCAGAAAGT
CGCAGTGAATAGCGTTTGGACTACATTCATTGCATCTCGTTCGGTCTTCA
TCAGAATTATCTCCACAGTCATTTTTACCGTCACAAAACTTATTTTCATC
TATACAGAGATCATTTTTACATTTTCTTTGATTCAAAGCACATTCTTCTT
CAACAAAGAGCGTCACTTGCTCAATTAGTTTATTAAAAACACATTCATAA
ATAGTTCCGTGATCATTTTTCGTTGCTTGTTTTATTTCTAATATACTCTG
AGTACTTCCACCAATTCTGTTTTCTTTGTTGACTTCTAAACTCTTTTTGT
CAAATCTCCTCCAAATAACTTTTCCATCTGCTCCCATTAGTTGACAAAGA
AATCTCGCATCACCTCCAGGTTTAATGGTTATTGTTTTGGGGGAAACTTT
CAATACTGGTTTTGCCTTAACAATCACTCGGCCAAAAACCTTTTTACCAA
GAACTCTGCAGACATATGTACCTTCATGTCTTTTCAAGGTGTTTTCAATT
ACAACAAATGAAGTTGAAGAGGTCAATGCTGGTCGAGAAACCTTAGCTTC
AGGTGGAAGTTCTACTTCCGTTTTGGAATTTTCTGGAATAAATGACCATT
GTATGAAGCTTGAATTAATGTTAGCAGTATCTATTCGACAATGCAATTCG
GATTCTTGGTTAACATTATCGAATACAGTTTGTTCAGATGGAGCAACCTC
AATTAATACATCACTTCTCTCCATCAAAAGTTTTGCTGCAAGTACCGTTG
TATTCTGATAACATTTATACGTCCCTTCAAGATCATCTGCCATTTCTTTA
AGAACCAATATACTGACTGAATTTGTATCTAATCTTCCGATTTTCAAACC
ATATAATGGATGTTTTATATCAATTTTCTTATCATTTAATGTCCAAATAA
CATTCTTTGCAAACATTGTCCATCTATTATCAAGTCTTCCAATTTCGCAA
TGTAACTCTTTTTTTGCTTCCGGAATGAAAGAGGTAGTAATTACCGGGTT
CCGGTGTCATTTCAATCTTCGATTCGATTTTTTGTTCTGGCATTAGGTTT
ACAAAACGTGTTTTTAATTCCTGCTTTCCTTTAACTATTTCACAACTGTA
TTTACCGAATGCTTCTTTCAAGAATCTTTCAATAACCAAAGTATTTCCCC
GGTGAATAATCGTATCATTTCTTTTCCAAACAATTTCAGTATCACTTTCT
AATTCTGTCTTAGAAATACAGTCGATTTCCATTTTCCCTCCGTATATAAC
GGGTCCCTGGACATCCATCGGTATATTGTCATTTACTATTTTGGAAATTA
AAACCTTTCCAACGATATTAATTTCTGGCTTTCCATTTCTACTAATCCTG
TAGTAGTATCCATTACTATCAATTTCCGATGATTTTAGATATAGGTCTCG
ACCATGGTCTAATAAAACTGTTCCCGGAGGGTTTTCCCATACCACAGTAT
CACTGTTTTTTAAAACACTTTGAGGCCGATAACGAATAATATTTGATCTG
GCATTGAAAGACTCCATGTTATCAACATTGGCGTCGATTGGAGCTTCTGG
TTTTTGTGGGGTTTCTTTAACCAAAATAATTTTCTGTACATTGACAGAGG
ATTGCCTTGTTTCTCCGGAAGAACAATAATATGTTCCATAGGAATAATCG
TCTATGTTATCTATTTTAAAAGTTCTTCCGGAATGAATATGGTACTGATG
GGGTCTATACCATGTCACATCGCCAGACTCCTTCAGTCCACAAACCAACT
CGACTGGACCCTTCTCAGCGGTTACATATTTAGTTTCTTTTGTATTATAC
ACAAAAGTTCTTGGACTAATCATCGTATTTTTATCCATAATATTGAGTGT
AGCATTTCTCATGGATTTGTCTTCCTTTAAAATAGAACATTGATACTTTC
CTAAATCTGAGGCTGATTTTAGTTGTACAATTATCCCAAAAGCTGTTCGT
TTTTCTTTTAAAAATACCGGATCATTATCGACGATTTTATAATATCTTAT
GAGTTCTTTCTTGGATCGAATATCCGGACAGACAAAGTACACATTAATGA
CACCTGATTTAAAGTCTTCAACGTCCACAGACACATTCCTCGTTGGTTCA
AACCCTTGAACAAAAGAGCTTATAAGAAGAATGTAGAGGACGAATAACGG
AATGAGATAGAATCGACAATCGGGACTCATTTGCCTATTCTAACACGAAT
GATGCAGATGGTAAACCTGTTTGTCAGCAAATGAATTCCAATTTTCAGAC
CACCAATTATAAGTAAACGATGTGTATATTTCAGATTCCAACTATTCGAC
CTATTCGTTTCAATATGCAGTT

Design Primers for laminin

back to top

protein sequence

>Ddo_003647-protein ID=Ddo_003647-protein|Name=laminin|organism=Dugesia dorotocephala|type=polypeptide|length=742bp
MFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTY
KCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANI
NSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGT
YVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKV
IWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQ
VTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSP
NAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGT
HFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG
STLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTV
HNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSM
CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAR
EVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSY
QLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKI
RVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMS
KISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIKSNER*
back to top

coding sequence

>Ddo_003647.1407.3632 ID=Ddo_003647.1407.3632|Name=Ddo_003647.1407.3632|organism=Dugesia dorotocephala|type=CDS|length=2226bp
ATGTTTGCAAAGAATGTTATTTGGACATTAAATGATAAGAAAATTGATAT
AAAACATCCATTATATGGTTTGAAAATCGGAAGATTAGATACAAATTCAG
TCAGTATATTGGTTCTTAAAGAAATGGCAGATGATCTTGAAGGGACGTAT
AAATGTTATCAGAATACAACGGTACTTGCAGCAAAACTTTTGATGGAGAG
AAGTGATGTATTAATTGAGGTTGCTCCATCTGAACAAACTGTATTCGATA
ATGTTAACCAAGAATCCGAATTGCATTGTCGAATAGATACTGCTAACATT
AATTCAAGCTTCATACAATGGTCATTTATTCCAGAAAATTCCAAAACGGA
AGTAGAACTTCCACCTGAAGCTAAGGTTTCTCGACCAGCATTGACCTCTT
CAACTTCATTTGTTGTAATTGAAAACACCTTGAAAAGACATGAAGGTACA
TATGTCTGCAGAGTTCTTGGTAAAAAGGTTTTTGGCCGAGTGATTGTTAA
GGCAAAACCAGTATTGAAAGTTTCCCCCAAAACAATAACCATTAAACCTG
GAGGTGATGCGAGATTTCTTTGTCAACTAATGGGAGCAGATGGAAAAGTT
ATTTGGAGGAGATTTGACAAAAAGAGTTTAGAAGTCAACAAAGAAAACAG
AATTGGTGGAAGTACTCAGAGTATATTAGAAATAAAACAAGCAACGAAAA
ATGATCACGGAACTATTTATGAATGTGTTTTTAATAAACTAATTGAGCAA
GTGACGCTCTTTGTTGAAGAAGAATGTGCTTTGAATCAAAGAAAATGTAA
AAATGATCTCTGTATAGATGAAAATAAGTTTTGTGACGGTAAAAATGACT
GTGGAGATAATTCTGATGAAGACCGAACGAGATGCAATGAATGTAGTCCA
AACGCTATTCACTGCGACTTTCTGAAAGGCGCAGATCCGACCAAACGTTG
TGTTATAAAGCATTGGCAGTGTGACGGCATTGATGACTGTGGAAATAACT
TTGATGAGCTTAATTGTCCAGTTAAGAACACGGACAAATGCATTGGCACT
CATTTTCTCTGTGATGACGATGTTTTGATTCCCAGATCATATTGGTGTGA
TGGGGATTCTGATTGCAAATCAATGGAAGATGAGAAGAGTTGCAGTCATC
CTCAAGTAGTAGAGCCTGAAAAACAGATGCAAATATCAGTTTTTAGCGGT
TCAACTTTAACTCTAACTTGTGAAATGTCAGGCCGTCCAGTACCCTCAAT
CACATGGAGATACAATTGGGGACATTTATCTGAGAATCTTTTGTATAATA
TAACGACGAAGATATCAAATTGTAGTGTAATAACAAGCACTTTAACTGTT
CACAACATCACCATGGATCAAAGTGGAGTTTATTCTTGCGAAGGAATAGC
AAGACGTCGAGTGATGGCACCCGACTTCATTGTTGTAGTTTCAAAGGGCT
CAATTTGTCAAAAACCATTTTATAACAATGATGCGTGGGATACGTCAATG
TGCATCAAATGTTATTGCTCAAATCTGACCGATGATTGCACCAGCGCTAC
TGGCTACGTAAATAATCCGCAACCAGTTGAAAGTGGTATAAAGCCTTCAG
ATGCTGCTATAGTCAATTACAAAACAACTGAATATTATGAACCGGCGCGA
GAAGTCACATTTGCAAATGCAAATTTAAAGAAATACTATATTGATAAAAA
TTCCTATATTAAATTCATACCGACTGCCGATTATTATTTTGGGGGAGTTT
TCAATGTGGAAGGATCTTGGTTGAACAGATATGGCTTTCCTCTATCGTAC
CAACTAATTTTATCAGGTGAAAGCTACAAATATATACCTGGTCCACTTAT
CGTAATAAAGGGAGGCTCTGACTATGTATATTATTGTGGGATCCAAAATG
ATTTCCGTCTCCCAGTTTATGCATCGGAAGATAGTTATGAAAATAAAATC
AGAGTGGTCTTATGGGAACAAGAATGGCATGCTGATCCTCAGTGCAAAAA
AGGTGTATCTAGACAACATTTCATGAATGTTTTAATAAACGTGAACTTAC
TTCTCTTCAAAGTCAAATACTTTGAAAAACAAACTGATTTTATGATGTCA
AAGATATCAATAAACGAAGCTATAAAAACGAAAGATAAATATACTTGGGT
CGGTAATTTGGAAAAATGTAACTGCCCAGCAGGATATTCGGGATTATCAT
GCGAAATTAAGTCAAATGAACGATAA
back to top
Gene Groups
laminin is similar in sequence to the genes of this group: GG2514
Gene NameGene ID
SMU15003325SMU15003325
lamininDdo_003647
lamininGsp_020815
Pgr_001754Pgr_001754
lamininPgr_008586
Pmo_019678Pmo_019678
lamininPmo_031777

Gene Group Protein Sequences

>SMU15003325

MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIR
PDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDK
TIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESV
NWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVK
NMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTI
LLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAM
DVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFK
KDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSG
VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNS
VSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELAD
NVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAAS
STSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKP
GGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATK
DDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKND
CGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNN
FDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN
PQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYN
ITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKG
QICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPS
DAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGA
FNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKY
RLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLV
LFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSC
ENKVE*
>Ddo_003647 laminin
MFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTY
KCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANI
NSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGT
YVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKV
IWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQ
VTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSP
NAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGT
HFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG
STLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTV
HNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSM
CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAR
EVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSY
QLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKI
RVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMS
KISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIKSNER*
>Gsp_020815 laminin
MTTFNNIPLLIFIFTKILQSEGFQPTRNVSVDVDDLKIRNMNLYFVCPYV
RSKTNVIKYFKYVENTSIVLKEKQNAHGIIITLKDASDMGKYGCSVILEN
GMIKNATFNIIDKQLMENPKLFIYKTEETIYVTQKGNVAELSCGNLMNPS
TTWYRPPQYHIYSGSKYIIKDVDRYSYGTYYCTSETTNTNTVSVRKVILV
KEIPKIKEKSIEEEVNYVETLSVQPGTVRYRSSNIAKSNDMIIWENPPGT
ILLDHERDLYIQSIKDDENIFYYRINRYGDSSINNVGKLIISIKKQDKLM
NLQSPVIYGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNK
KTFGKYSCEVLQGNEKQKTRFLNLLPEQKIESKIEMTPEPGNFYLYHSGA
KKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSV
SILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADN
VNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSS
TSFIVINNVLKRHEGTYVCQVLNTKVFGKIIVRTKPVLTVTPKSITIKPG
STARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRD
DHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDC
GDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNF
DELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP
QVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNI
TTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVMAPDFSVSVSKGL
ICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSD
AAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAF
NMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYR
LPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLAL
FKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCE
TKID*
>Pgr_001754 Pgr_001754
MESPTKFTYDLSQTKYVIQNSGSVELDCGAPANEIVTWFRPPQFHIYTGS
KLKIETLTKFDYGTYYCAIGSTAKSTVPVTKVILLPEEPKQKEKKLDEDF
LFMESLVPKSSEVRFKPSDVAGKFDTVTWEQPPGTILLEHGRNLYFQSYS
PETSKTPFYYRIHRNGDHLINKVGKLFIAHWQDKEEQMTVEGAVQYGNDM
TINCFSDPESINETHVVWRLDDKIIHRGNTYTIKNFQKKYFGKYSCEIEK
GGVRIVSRSINLAPEQDLAAKIEMTPDPGNYYNFHSGKNKELHCEIQRED
GNWKFKSKDIIWTLNGRKIDIGNPGSPFANTKRFGRLNTQSVSILVLKEL
GEDNKGTYKCFQGSTVYAATLLMEPSEILIELSPPEQTAADNVNQMAEFH
CRIDTPNYNSSFIRWSFIPEGSDQEEKVPTEAVIDNPIQTSSTSFVSIEN
VLKRHEGQYVCRVLDRKVVGKLIVKSRPVLKVNPKEITVKPGGTARYLCQ
LTGIEGKVIWRRRDKKSFIENKETRMGGDTNSLLEIKQTTTADDGTVYEC
NFNKLTEYVTLWVKDDCALNQRKCQNSTCIDENKFCDGKNDCGDNSDEDP
KRCNECTPNSIHCDFLNNSIPNKRCVVKHWQCDGVDDCGNNFDELNCPVK
NTEKCLGSHYQCGNETLIPRAYWCDGEVDCKSGEDEEGCTSPQVIEPAKP
SQLTVVENSTMIIECQISGRPVPTVTWRYNWGYLPDKLEHNITDVVTNCS
MVTSTLRINNISPEQSGIYTCEGIAKRRVMAPDISVTVTKETVCKRPFFN
NDAWTQELCLRCYCSNVTDDCTSASGYVINPDLIESQARSSDAAVINYKT
NEYYEPARPVGFANDTLKMYIINKENYKKLIPDDDHFLGGSFNMRGSWIN
RYGFPLTYKLTLAGESVGHISGPIVVMVGHSEKKIFYCTPKYRLPAYASD
DNTENNMRIILWEQDRWFVDDKCSKSVTRSEFIEVLRDVRLVLFRVRYFT
KQTDFKMSKITMQEAIKSKYEHSWIPRIEKCNCPQGYSGLSCENKST*
>Pgr_008586 laminin
MISIAKSLFIVKLVVLGFLVDENTAVFNLTRNVSIQVEPLKYGEVNIYFV
CPNIRSNEDKVMYYKVEKGIKGLIQKRKPHGIILKIKTKSDLGEYQCSII
SKDSSTRNATLNIIDSKEMESPVKFVYDYSKTKYVIEKSGSVELDSEAST
NDMVTWYRPPQFHIFTGRKLKIDNLNEFDFGTYYFAIGMTSKSVLQVTKV
ILLPQRPTKREKTIDEDVMYLENIIPKAKEIRYRPGNVAGISETVTWEQP
PGTILLEHGRDAYFYSYTASKSDLPLYYRINKNGDFTVNKVGKVFISEWK
NREVEMSVEGRAAYGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYF
IKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYY
NFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNIN
RFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIEL
SPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPES
IVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTGILIVKTKQMLTV
NPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNS
LLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDE
GKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQC
DGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKS
MEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG
YLPDTMDHNVTEVVTNCTLITSTLTITNISPEDSGIYTCEGIEKRRIMAP
DFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPD
LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVT
SDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNA
KKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVF
IELLRDVRFIFFRIKYFRKQSDFKMSMITMQEAIKTKYDYLWVPRLEKCN
CPSGYSGLSCETKTE*
>Pmo_019678 Pmo_019678
GVFNNEVVTWYRPPQFHIFTGNKLEIKQLTEFDFGTYYFSVGMTTKSVLL
VTKVILLPSEPEKREKTIDEDVLYLENVIPKAKDIRYRPGNVDGNSDIVT
WEQPPGTILLEHGRDAYFSAYSINQTELPFYYRINRNGDSSVNKVGKVFI
SEWKDREVEMSVEGRAAYGAEMKVNCFPSPDLGNDTEVIWKLDGKEIHRG
NTYIIKTFQKEVYGRYSCEIHSRGILIKSRIINLTPREGIESKIEMTLDP
GLYYNFHPDKTKELHCEIQREDGEWKFKSKDIIWTFNGRKIDVYNPLSAF
GNINRFGRLDTRSVSILVLRNMGEDNQGVYKCFQGPSTYAAILIMEQSEV
LIELSPPKLIVQHNSNHVAEFHCRIDTPGYNSSFIEWKFKEFNSTIEQDI
PPEATVEKPHQTSATSFITIKNSLKKHEGIYVCKVLGQQVSGILIVKTKQ
VLTVNPKEITVSPGGTARFFCQLSGIDGKVVWRRKDRKNFILNKENRKGG
STNSLLEVNHVTTADDGTIYECNFNELTESAILWVKDECALNQRKCKNET
CIDETKFCDGKDDCGDNSDEDPTRCKECIPNSIHCDFLNNSSPIKRCIVR
HWQCDGVDDCGNNFDELNCPVMNKDRCIGSHYLCGNGTLIPRAYWCDGEP
DCRSMEDEEGCSSSQVIEPSKLSHLSIIENSTLTLICQISGRPIPTITWR
YNWGYLPDSLNHNLTEVVTNCSMITSTLTINNIAPENSGIYTCEGIEKRR
IMAPDYAVTVTKGSVCKRPFFNNDAWDQEFCLRCYCSNVTDDCTSASGYI
TNPDLVESKVRSSDAAIMNYKTNDYHEPARSISFVDDNLKMYSINKTNYM
KYVIEDDFFLGGSFNMRGSWINRYGYPLTYKIVISGDSVGHISGPIVVIM
SNNEKKIYYCSWKYRISAYASDEYYENNIRIILWEQDRWFTDNACTTKVQ
RAEFLEILK
>Pmo_031777 laminin
MHIFIPLLVMVGYFTKSYESVFPHTRTVSIDLEKLKKEPFNIYFTCANIR
SKQDRVRYFRVQNGARGLIEKKKRFGIILSIKSESDLGQYECSVTAPDKT
VLNATLNTVDMKKMESPTKFVYDLSKTKYVIQKSGSVELDCGTSGNEVVT
WYKPTQYHIFTGSKLKIDSLTNFDYGTYYCAVGDTNKATLMVTKVILLPE
EPKQKEKKIDEDVMYIESFIPKSKSVRFKPIDVVDKSFAVTWEQPPGTVL
LEHARKLYFQSFSPDQTKIPFFYRITKNGDPSVNKVGKVYISDWTDKEVE
VTLEGAVQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQ
KQFFGKYSCEIQQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMG
KNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRL
DTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQ
TAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKP
VLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGKLIVKSRPVLTVNPKEI
TVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIK
QATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCN
GVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDD
CGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE
GCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDK
LDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVT
VTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESK
VKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHF
LGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYY
CTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEVLR
DVRLVLFRVKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGY
SGLSCEMKEN*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.