ifb, Ddo_001875 (mRNA) Dugesia dorotocephala

Overview
Nameifb
Unique NameDdo_001875
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1995
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteIFB
Homology
BLAST of ifb vs. uniprot
Match: gi|266617|sp|Q01241|NF70_DORPE (RecName: Full=70 kDa neurofilament protein; Short=NF70 [Doryteuthis pealeii])

HSP 1 Score: 376.711 bits (966), Expect = 1.50216e-119
Identity = 234/558 (41.94%), Postives = 365/558 (65.41%), Query Frame = 1
Query:  223 SYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKD-ASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRK----DAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQIT-NVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESN--WGTGAQILTTLQNSKGEEKATHTQRTVYQ 1872
SYG +A PG NI GVN++ RE+EK ++++LN+RFANYI+KVR LE +NK+L+ EL +LK +WGKET+ IK +Y+ ++ RK +D K L++R+ + D ++ Q +L + H D+E I + QL+D E EIS LRR + LE+EK+R + + ++ +E+ +++ DL+ ET+ H+ A+N Q+L +++EF K + E++EL++L Y+D +++++FWRNE+AQA+RDIQ EYD K + ++ ++EA Y LK+QEFRT TK++ E + +EEN +LK + E+RNRL +LE RN LER L R+++EK R+ E E ++E+ + E+E+I+ ELQ L+D KLSLELEIAAYRK+LEGEE RV K ++ + L+ +TRS + T +QI+ +++GE++AKT++QRT+KG+V+I+E G FI LE ++E+++G+ + R D+ + V Y IP ++ TG KIW+K + Q + +S N WGTG+ ++T LQN KGE+KA +TQ TVYQ
Sbjct: 68 SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSTILTRSEGGYEATGD---SQISMKMMRGELAAKTTYQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVDDNK-VYTYEIP--NLVLKTGT--VVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNTVYQ 615
BLAST of ifb vs. uniprot
Match: gi|124235|sp|P23731|IFEB_ASCSU (RecName: Full=Intermediate filament protein B; Short=IF-B [Ascaris suum])

HSP 1 Score: 325.479 bits (833), Expect = 2.37671e-100
Identity = 212/598 (35.45%), Postives = 348/598 (58.19%), Query Frame = 1
Query:   88 YSVLAQSNIQPISGPRNVVITRTGPTIA-ATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGEEKATHTQRTV 1866
Y + +S IQP R V T++ + A +TG R+++M G ++ G S + N + + +KEK E+Q LNDR NYID+V+ LE++N++L +L +L+ +WGK+T+ IK Y + + RK +D KA++++++ + D + E + DV SD+E I++ + + D + E+ LR R L EE+ R N + R+ EE+ + + DLD+ETL I QN+VQ+L++++EFL+++ E E++EL +L+ + +D+++F++NE+A A+RDI++EYD + + +ME+ Y LK+ E + + + + E+ REE R+++ + ++R +L +LE +N LE+ + L ++++ R++E+ L + E + +V ELQ LLD K L+ EIA YRKMLEGEE RV + M + T T V+GE+S KT+FQR+AKGNVTI EC P+GKFI LENT S+ E++ + L R DN R ++ Y IP T+L+ R KI+A+ Q + L E+ WG GA ++T+L N G+E+ATHTQ+T+
Sbjct: 11 YEIAYRSTIQP----RTAVRTQSRQSGAYSTGAVSGGGGRVLKMVTEMGSASIGGISPALSANAAKSFLEATDKEKKEMQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGRWGKDTSEIKIQYSDSLRDARKEIDDGARRKAEIDVKVARLRDDLAELRNRYEDVQHRRESDREKINQWQHAIEDAQSELEMLRARWRQLTEEEKRLNGDNARIWEELQKARNDLDEETLGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDYIAKQGKQDMESWYKLKVSEVQGSANRANMESSYQREEVKRMRDNIGDLRGKLGDLEAKNALLEKEVQNLNYQLNDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEESRVGLR---------------QMVEQVVKTHSLQQQEDTDSTRNVRGEVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRSKDENLGEHRLKRKLDNRREIV-YTIPPNTVLKA---GRTMKIYARDQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|46576384|sp|Q19289|IFB1_CAEEL (RecName: Full=Intermediate filament protein ifb-1; AltName: Full=Cel IF B1; AltName: Full=Intermediate filament protein B1; Short=IF-B1)

HSP 1 Score: 320.087 bits (819), Expect = 2.85657e-98
Identity = 210/597 (35.18%), Postives = 352/597 (58.96%), Query Frame = 1
Query:   88 YSVLAQSNIQPISGPRNVVITRTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGEEKATHTQRTV 1866
Y + +S IQP + R+ +R + GN + R+++M G + G S + N + + +KEK LQ LNDR NYID+V+ LE++N++L +L +L+ +WGK+T+ IK Y + RK +D A KA++++++ D + E + D+ Q SD+E I + TN ++D + E+ LR R L +E+ R + R+ EE+ + + DLD ET+ I QN+VQ+L++++EFL+++ E E++EL +L+ + +D+++F++NE+A A+RDI++EYD + + +ME+ Y LK+ E + + + + E+ R+E R+++ + ++R +L +LE +N+ LE+ + L ++ + R++E+ L + E + +V ELQ LLD K L+ EIA YRKMLEGEE RV G + + + ++ QQ + T++ V+GE+S KT+FQR+AKGNVTI EC P+GKFI LEN+ ++ E++ + + R D GR I Y IPA +++P GKN I+A+ Q + L E+ WG GA ++T+L N GEE+ATHTQ+T+
Sbjct: 10 YEMQYRSTIQPRTAVRSQ--SRQSGNYVSGGNGAGSGGRVLKMVTEMGSATVGGISPALSANAAKSFLEATDKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEMLRARFKQLTDEEKRVTADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRV----------GLTQMVEQAVKTHSLQQQENTDSTRS-----VRGEVSTKTTFQRSAKGNVTISECDPNGKFIKLENSHRNKDENVGEHKIRRKLD-GRREIVYSIPANVVIKP-GKN--LTIYARDQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|46576376|sp|P90901|IFA1_CAEEL (RecName: Full=Intermediate filament protein ifa-1; AltName: Full=Cel IF A1; AltName: Full=Intermediate filament protein A1; Short=IF-A1)

HSP 1 Score: 303.138 bits (775), Expect = 4.90343e-92
Identity = 208/585 (35.56%), Postives = 345/585 (58.97%), Query Frame = 1
Query:  145 ITRTGPTI-AATGNQGTTNI----RMI----EMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDAS-DSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTG-SQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL--SESNWGTGAQILTTLQNSKGEEKATHTQR 1860
T T P+ A G + T N+ RM+ EM+ G +P N + + + RE+EK E+ +LNDR A+YI+KVR LE +N++L+ +L L+ +WGK+T I+ +Y+ ++V +K +D+ + +E ++ ++D + E + +L D + D+ ID + LS+ E EIS L+RR+A LE+E R +E RL E+ + + DLD+ETL I QN+VQ+LL++I+FL+++ ++EI+EL +L +D + ++++F++NE++ A+RDI+ EYD+ + +ME+ Y LK+QE +T +++ E +EE RL+ QL ++R +L +LE RN+ LE+ + L ++++ R +E+ ++ + E + +++ELQ+LLD K +L+ EIA YRKMLEGEE R K + + + T T+ VVKGE +++ SFQR+AKGNV+I E SPDGKFI+L+NT ++ E I + L R D R + Y +P +L GK KI+A+ Q + + +E ++G+G + T L N +GEE+ATH QR
Sbjct: 11 FTSTTPSARAPLGGRTTGNVTSQDRMLKIVTEMRSGAGSGLSP-----FGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLK---------------QLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA-GKT--LKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571
BLAST of ifb vs. uniprot
Match: gi|266616|sp|Q01240|NF60_DORPE (RecName: Full=60 kDa neurofilament protein; Short=NF60 [Doryteuthis pealeii])

HSP 1 Score: 289.271 bits (739), Expect = 1.67552e-87
Identity = 173/385 (44.94%), Postives = 265/385 (68.83%), Query Frame = 1
Query:  223 SYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKD-ASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRK 1374
SYG +A PG NI GVN++ RE+EK ++++LN+RFANYI+KVR LE +NK+L+ EL +LK +WGKET+ IK +Y+ ++ RK +D K L++R+ + D ++ Q +L + H D+E I + QL+D E EIS LRR + LE+EK+R + + ++ +E+ +++ DL+ ET+ H+ A+N Q+L +++EF K + E++EL++L Y+D +++++FWRNE+AQA+RDIQ EYD K + ++ ++EA Y LK+QEFRT TK++ E + +EEN +LK + E+RNRL +LE RN LER L R+++EK R+ E E ++E+ + E+E+I+ ELQ L+D KLSLELEIAAYRK+LEGEE RV K
Sbjct: 68 SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMK 452
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15011956 (SmedAsxldir_c69509_g1_i1|m.14946|m.134)

HSP 1 Score: 905.205 bits (2338), Expect = 0
Identity = 463/590 (78.47%), Postives = 539/590 (91.36%), Query Frame = 1
Query:  112 IQPISGPRNVVITRTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQ-FSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGAQILTTLQNSKGEEKATHTQRTVYQM* 1878
IQPISG RNVVITRTGPT++ G QG +NIR IEM KSYG+S+ PGA++NIVHNGVNNLMNGREKEKNELQ+LNDRFANYIDKVR+LEDENKRLS+EL+DLKDQWGKETARIK YDNDM+ LR+SLDQAE +KAQ+EM+IN++EDLI EAQ ELND QLH++DKETIDKM + LSDYEHEI++LR+RL GLEEEKVRDNKEI RLKEE+N LK+DL+KETLEHITA NE+QSL+DQIEFLKKIFESE+REL+SL+YKD++++KDFWRNEMAQALRDIQ EYDRK++TL +MEAQYTLKIQE RTTQ++E+ ETVQLREEN R+K+QL EMRNRLPELE RNN+LER+L++L+REI+EK+REF+ EK +LRKEL+NR+AELE I++ELQ+LLDAKLSLELEI AYRKMLEGEEYRVNRK Q +Q G S+D DH+TR++ISQQH +P TKTQ+T+V+KGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQ+EDISGY+L RNTDNGRIVIK+VIP+KTILEPTGKNRYYKIWA+G +PQGS + E SESNWG GAQI+T LQNSKGEEKATHTQRTVYQ+*
Sbjct: 22 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL* 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15038947 (dd_smedV4_3871_0_1|m.24747|m.30510)

HSP 1 Score: 484.952 bits (1247), Expect = 3.90062e-163
Identity = 267/578 (46.19%), Postives = 398/578 (68.86%), Query Frame = 1
Query:  142 VITRTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDA-SDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMT-KTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGAQILTTLQNSKGEEKATHTQRTVY 1869
+ +RT T N+ + ++ EM++SY S P + +H+ V++ + GRE+EK E+Q+LN+R ANYI+KVR LE +NKRL+ EL L+++WGKE RI+ALY+ +M L+K LD+AEA++++L +IN +E+ + E +++ N H D+E I+K+ QLS+ E EI LRRR+A LEEE+ R K I RL++EI + + DLD+ET+ HI +++EVQS D+I+F+K ++E++EL++L Y+D+ ++++DFWR+EM +LR++Q EYDRK+E ++ ++E + +K+QE R + +E E++ L+EEN RLK QL +R++ PE+E +N LER L+ L+RE+D + +FESE+ LR +L Q EL++I+ E Q ++D KLSLELEIAAYRK+LEGEE R ++ M+ T T I S KTQ++N++K E +AK + QRTAKGNV I E S DGKFIILENTG + EDISG+ + RN DN R +I+Y IP TIL+P G+ ++ KIW+KG +P GS++ E S +NWGTG I T L N EE+ATHTQ+T +
Sbjct: 1 MASRTSARSTVTINKSSPAVKEYEMRQSYNFSGAPMGGSVQIHSNVSSAVEGREREKREMQDLNERLANYIEKVRFLEAQNKRLTNELNTLRERWGKEAERIRALYEIEMDQLKKLLDEAEAARSELLPKINKLEEQLHEYLQGIDEANNQHGMDQEMIEKLNRQLSECEGEIGLLRRRIAALEEERGRSKKTISRLRDEIKRTRMDLDQETMNHIASESEVQSRKDEIDFMKDSHDNEMKELAALAYRDSTAENRDFWRSEMGSSLRELQIEYDRKLEAMRGDLENHHNVKVQELRHSSPREGVESIHLKEENIRLKNQLSNLRSKCPEMEAKNAQLERFLEELRRELDRQINDFESERDKLRSDLQRTQDELDSIMKEFQNVMDMKLSLELEIAAYRKLLEGEESRSGLRNM--------MEQTIFKTSGGIEGNIISKTAGKTQMSNLMKNERNAKVNHQRTAKGNVIIHETSADGKFIILENTGKKDEDISGFKIIRNIDNDRSIIRYEIPNSTILKPEGQQKFLKIWSKGNRPTGSNDLECSSANWGTGTHIFTALLNKSNEERATHTQKTTF 570
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15013238 (SmedAsxldir_c85434_g1_i1|m.24146|m.11304)

HSP 1 Score: 360.533 bits (924), Expect = 1.70118e-114
Identity = 224/580 (38.62%), Postives = 363/580 (62.59%), Query Frame = 1
Query:  112 IQPISGPRNVVITRTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDAS-DSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNV-VKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGAQILTTLQNSKGEEKA 1845
+ PIS R ++I RT + + ++I+ +Y P S + V N REK+K++++ LN++ A YI++VR LE +NK+ S EL +LKD+WGK+T +K Y+ +M L+K L +AE ++ + E + ++E +Q+A+ ELN + + I+ +LS+ E IS L++RL LEE K +D EI +L++EI L++DL+ +T++++ + E+Q LD++EFLK+I ++++ ELS+L Y+D + D+KDFW+ E++ A++DIQ++YD +++ L+ +E+QY +++Q+ +T K E +++EN R+K + R+R+P+LE + LER L L+ E +E R++E E KEL + + ++L+ LLD KLSL+LEIAAYRK+LEGEE R K + + ++ T +Q T K Q TN GE+SAK++F RT KGNV+I EC+ DG+ IILEN G +E+IS ++NR+ D+GR ++K+VIP KT ++ N+ KIWAKG KP G+++ E+ E+NWG G+ I T L N+ GEE+A
Sbjct: 46 VSPISSQRTIIINRTNNQVPS---------QIIQRSFNYETRVIPSKSA--AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERA 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15006730 (SmedAsxldir_c108652_g1_i6|m.91472|m.48315)

HSP 1 Score: 283.878 bits (725), Expect = 7.94939e-85
Identity = 217/622 (34.89%), Postives = 362/622 (58.20%), Query Frame = 1
Query:  100 AQSNIQPISGPRNVV--ITRT-GPTIAATGN--QGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIE---DLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKV-RDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDAS-DSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRS--------------------------TISQQHTSPMTKTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGAQILTTLQNSKGEEKATHTQ 1857
++S +PIS PRN + + +T G + +A N QG++NI +I + + +GV ++ GR +EK +LQ+LN+RFA+YI+K R LE +NK+L E+ LK ++ ++IK +Y+ ++ LR L +E S+A LE++++S+E D +++ + L D+N + K TIDK +S +E E+ L RR G + V ++ +E+ L++++ +L++D +KE L H+T ++E+QSL + +EF K+I ++E++EL+++ Y+D + ++ +W++EM +ALRDIQNEY+ K+ ++ E+EA Y L++QE RT++T+++ ET +EEN+R+K Q+ MR+R+ +LE++N + E L+ ++ +E R E + ++L+++L Q EL + ELQ LLDAKL LELEIAAY K+LE EE RVN FS G++ L+ M+ + S MT+ + T+ S + F+RT KGN++I E G IILEN G++ E + G + R D I + I K L K + AKG+ E E+ +++WG G ++TTL +S+G EKA H Q
Sbjct: 93 SRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIR------------GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVEL-RRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN-----FSADGNAT-LSQFMSFTSSSGAGGAGGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDY----QSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRIVDGSENKISFTISGKVNLNAGEK---ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 685
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15019274 (SmedSxldir_c108927_g2_i1|m.81594|m.27374)

HSP 1 Score: 280.411 bits (716), Expect = 2.15021e-83
Identity = 216/631 (34.23%), Postives = 363/631 (57.53%), Query Frame = 1
Query:  100 AQSNIQPISGPRNVV--ITRT-GPTIAATGN--QGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIE---DLIQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKV-RDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDAS-DSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRS-----------------------------------TISQQHTSPMTKTQITNVVKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGAQILTTLQNSKGEEKATHTQ 1857
++S +PIS PRN + + +T G + +A N QG++NI +I + + +GV ++ GR +EK +LQ+LN+RFA+YI+K R LE +NK+L+ E+ LK ++ ++IK +Y+ ++ LR ++++E SKA LE +++S+E D +++ + L D+N + K TIDK +S +E E+ L RR G + V ++ +E+ L++++ +L++D +KE L H+T ++E+QSL + +EF K+I ++E++EL+++ Y+D + ++ +W++EM +ALRDIQ EY+ K+ ++ E+EA Y L++QE RT++T+++ ET +EEN+R+K Q+ MR+R+ +LE++N + E L+ ++ +E R E + ++L+++L Q EL + ELQ LLDAKL LELEIAAY K+LE EE RVN FS G++ L+ M+ + S MT+ + T+ S + F+RT KGN++I E G IILEN G++ E + G + R D I + I K L K + AKG+ E E+ +++WG G ++TTL +S+G EKA H Q
Sbjct: 93 SRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIR------------GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVEL-RRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN-----FSGDGNAT-LSQFMSFTSSSGAGGAGGVGGAGGAGGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDY----QSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK---ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 694
BLAST of ifb vs. RefSeq Human
Match: gi|5031875|ref|NP_005563.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 144.05 bits (362), Expect = 1.31463e-35
Identity = 157/575 (27.30%), Postives = 273/575 (47.48%), Query Frame = 1
Query:  232 VSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQE--------------AQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIREL-----SSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES----AETVQLREENAR---LKEQLVEMRNRLPELELRNNDLE----RMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMS-AKTSFQRTAK--GNVTIQECSPDGKFIILENTGSQQEDISGYVLNR-NTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGEEKA 1845
S+ P + T I R +EK +LQELNDR A YID+VR LE EN L + + ++ +E + IKA Y+ ++ RK+LD +A+L++ ++ + + +E AQ L D+ L S + + ++ E E+ LR ++A LE + + KK L E L + A+N +Q++ ++++F K I+ E+RE + L+ D ++F + +A AL++++ +++ ++E + E+E Y+ K+ R + + S A +L++ R L QL +++ +L E + DLE R D +R + EK RE + ++++L Q LLD KL+L++EI AYRK+LEGEE R+ + SQ +R S + +T K E + +++SF + A+ G V ++E +GKF+ L N ++ + + + + R N D+ ++ Y P K L+ + IWA G S +L +++ WG G + T L NS GEE A
Sbjct: 16 ASSTPLSPTRIT----------RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ-----------ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQ----------RSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063466|ref|NP_001269554.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 144.05 bits (362), Expect = 1.31463e-35
Identity = 157/575 (27.30%), Postives = 273/575 (47.48%), Query Frame = 1
Query:  232 VSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQE--------------AQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIREL-----SSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES----AETVQLREENAR---LKEQLVEMRNRLPELELRNNDLE----RMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMS-AKTSFQRTAK--GNVTIQECSPDGKFIILENTGSQQEDISGYVLNR-NTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGEEKA 1845
S+ P + T I R +EK +LQELNDR A YID+VR LE EN L + + ++ +E + IKA Y+ ++ RK+LD +A+L++ ++ + + +E AQ L D+ L S + + ++ E E+ LR ++A LE + + KK L E L + A+N +Q++ ++++F K I+ E+RE + L+ D ++F + +A AL++++ +++ ++E + E+E Y+ K+ R + + S A +L++ R L QL +++ +L E + DLE R D +R + EK RE + ++++L Q LLD KL+L++EI AYRK+LEGEE R+ + SQ +R S + +T K E + +++SF + A+ G V ++E +GKF+ L N ++ + + + + R N D+ ++ Y P K L+ + IWA G S +L +++ WG G + T L NS GEE A
Sbjct: 16 ASSTPLSPTRIT----------RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ-----------ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQ----------RSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|27436946|ref|NP_733821.1| (lamin isoform A [Homo sapiens])

HSP 1 Score: 145.206 bits (365), Expect = 1.3405e-35
Identity = 153/553 (27.67%), Postives = 267/553 (48.28%), Query Frame = 1
Query:  298 REKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQE--------------AQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIREL-----SSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES----AETVQLREENAR---LKEQLVEMRNRLPELELRNNDLERML----DMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMS-AKTSFQRTAK--GNVTIQECSPDGKFIILENTGSQQEDISGYVLNR-NTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGEEKA 1845
R +EK +LQELNDR A YID+VR LE EN L + + ++ +E + IKA Y+ ++ RK+LD +A+L++ ++ + + +E AQ L D+ L S + + ++ E E+ LR ++A LE + + KK L E L + A+N +Q++ ++++F K I+ E+RE + L+ D ++F + +A AL++++ +++ ++E + E+E Y+ K+ R + + S A +L++ R L QL +++ +L E + DLE L D +R + EK RE + ++++L Q LLD KL+L++EI AYRK+LEGEE R+ + SQ +R S + +T K E + +++SF + A+ G V ++E +GKF+ L N ++ + + + + R N D+ ++ Y P K L+ + IWA G S +L +++ WG G + T L NS GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ-----------ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQ----------RSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063468|ref|NP_001269555.1| (lamin isoform A-delta50 [Homo sapiens])

HSP 1 Score: 144.436 bits (363), Expect = 1.38475e-35
Identity = 153/553 (27.67%), Postives = 267/553 (48.28%), Query Frame = 1
Query:  298 REKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQE--------------AQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIREL-----SSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES----AETVQLREENAR---LKEQLVEMRNRLPELELRNNDLE----RMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMS-AKTSFQRTAK--GNVTIQECSPDGKFIILENTGSQQEDISGYVLNR-NTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGEEKA 1845
R +EK +LQELNDR A YID+VR LE EN L + + ++ +E + IKA Y+ ++ RK+LD +A+L++ ++ + + +E AQ L D+ L S + + ++ E E+ LR ++A LE + + KK L E L + A+N +Q++ ++++F K I+ E+RE + L+ D ++F + +A AL++++ +++ ++E + E+E Y+ K+ R + + S A +L++ R L QL +++ +L E + DLE R D +R + EK RE + ++++L Q LLD KL+L++EI AYRK+LEGEE R+ + SQ +R S + +T K E + +++SF + A+ G V ++E +GKF+ L N ++ + + + + R N D+ ++ Y P K L+ + IWA G S +L +++ WG G + T L NS GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ-----------ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQ----------RSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDP--LLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|27436948|ref|NP_733822.1| (lamin isoform A-delta10 [Homo sapiens])

HSP 1 Score: 143.28 bits (360), Expect = 4.36033e-35
Identity = 151/550 (27.45%), Postives = 265/550 (48.18%), Query Frame = 1
Query:  298 REKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQE--------------AQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIREL-----SSLIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES----AETVQLREENAR---LKEQLVEMRNRLPELELRNNDLE----RMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGEMS-AKTSFQRTAK--GNVTIQECSPDGKFIILENTGSQQEDISGYVLNR-NTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAEL---SESNWGTGAQILTTLQNSKGE 1836
R +EK +LQELNDR A YID+VR LE EN L + + ++ +E + IKA Y+ ++ RK+LD +A+L++ ++ + + +E AQ L D+ L S + + ++ E E+ LR ++A LE + + KK L E L + A+N +Q++ ++++F K I+ E+RE + L+ D ++F + +A AL++++ +++ ++E + E+E Y+ K+ R + + S A +L++ R L QL +++ +L E + DLE R D +R + EK RE + ++++L Q LLD KL+L++EI AYRK+LEGEE R+ + SQ +R S + +T K E + +++SF + A+ G V ++E +GKF+ L N ++ + + + + R N D+ ++ Y P K L+ + IWA G S +L +++ WG G + T L NS GE
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLE--------------AALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ-----------ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQ----------RSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDD--PLLTYRFPPKFTLKA---GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGE 536
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|17136290|ref|NP_476616.1| (lamin, isoform A [Drosophila melanogaster])

HSP 1 Score: 145.591 bits (366), Expect = 2.08444e-36
Identity = 153/530 (28.87%), Postives = 271/530 (51.13%), Query Frame = 1
Query:  292 NGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETI---DKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNE----MAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLT-DHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKP--QGSSEAELSESNWGTGAQILTTLQNSKGEEKA 1845
+ R EK ELQ LNDR A YID+VR+LE EN RL+ E+ +D +ET IK +++ +++ R+ LD +A+ E+ I + + +E + +L+ + + + + + N+L++ ++ ++ R++L E + KE+ RL+++ + +K+L++ETL + +N +QSL +++ F +I EI E + + S+ +E + Q+L++++ +Y+ +M+ + E+++ Y KIQ + + S T + EE + ++ + + ELE N DL + L+R++D E L KEL+ + E+ + E Q L+D K+SL+LEIAAY K+L GEE R+N A + S + + TR+T S++ S K + V + E + + +AKGNV I+E P+GKF+ L N GS++ I G+ L R + Y +EP G +W+ K + S + W + T L NS+GE A
Sbjct: 49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769141|ref|NP_001245892.1| (lamin, isoform B [Drosophila melanogaster])

HSP 1 Score: 145.591 bits (366), Expect = 2.08444e-36
Identity = 153/530 (28.87%), Postives = 271/530 (51.13%), Query Frame = 1
Query:  292 NGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETI---DKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNE----MAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLT-DHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKP--QGSSEAELSESNWGTGAQILTTLQNSKGEEKA 1845
+ R EK ELQ LNDR A YID+VR+LE EN RL+ E+ +D +ET IK +++ +++ R+ LD +A+ E+ I + + +E + +L+ + + + + + N+L++ ++ ++ R++L E + KE+ RL+++ + +K+L++ETL + +N +QSL +++ F +I EI E + + S+ +E + Q+L++++ +Y+ +M+ + E+++ Y KIQ + + S T + EE + ++ + + ELE N DL + L+R++D E L KEL+ + E+ + E Q L+D K+SL+LEIAAY K+L GEE R+N A + S + + TR+T S++ S K + V + E + + +AKGNV I+E P+GKF+ L N GS++ I G+ L R + Y +EP G +W+ K + S + W + T L NS+GE A
Sbjct: 49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769143|ref|NP_001245893.1| (lamin, isoform C [Drosophila melanogaster])

HSP 1 Score: 145.591 bits (366), Expect = 2.08444e-36
Identity = 153/530 (28.87%), Postives = 271/530 (51.13%), Query Frame = 1
Query:  292 NGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETI---DKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNE----MAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLT-DHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKP--QGSSEAELSESNWGTGAQILTTLQNSKGEEKA 1845
+ R EK ELQ LNDR A YID+VR+LE EN RL+ E+ +D +ET IK +++ +++ R+ LD +A+ E+ I + + +E + +L+ + + + + + N+L++ ++ ++ R++L E + KE+ RL+++ + +K+L++ETL + +N +QSL +++ F +I EI E + + S+ +E + Q+L++++ +Y+ +M+ + E+++ Y KIQ + + S T + EE + ++ + + ELE N DL + L+R++D E L KEL+ + E+ + E Q L+D K+SL+LEIAAY K+L GEE R+N A + S + + TR+T S++ S K + V + E + + +AKGNV I+E P+GKF+ L N GS++ I G+ L R + Y +EP G +W+ K + S + W + T L NS+GE A
Sbjct: 49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|665404412|ref|NP_001285629.1| (lamin, isoform D [Drosophila melanogaster])

HSP 1 Score: 145.591 bits (366), Expect = 2.08444e-36
Identity = 153/530 (28.87%), Postives = 271/530 (51.13%), Query Frame = 1
Query:  292 NGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHISDKETI---DKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASDSKDFWRNE----MAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVNRKDAQFSQGGHSMDLT-DHMTRSTISQQHTSPMTKTQITNVVKGEMSAKTSF--QRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKP--QGSSEAELSESNWGTGAQILTTLQNSKGEEKA 1845
+ R EK ELQ LNDR A YID+VR+LE EN RL+ E+ +D +ET IK +++ +++ R+ LD +A+ E+ I + + +E + +L+ + + + + + N+L++ ++ ++ R++L E + KE+ RL+++ + +K+L++ETL + +N +QSL +++ F +I EI E + + S+ +E + Q+L++++ +Y+ +M+ + E+++ Y KIQ + + S T + EE + ++ + + ELE N DL + L+R++D E L KEL+ + E+ + E Q L+D K+SL+LEIAAY K+L GEE R+N A + S + + TR+T S++ S K + V + E + + +AKGNV I+E P+GKF+ L N GS++ I G+ L R + Y +EP G +W+ K + S + W + T L NS+GE A
Sbjct: 49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|24653664|ref|NP_523742.2| (lamin C, isoform A [Drosophila melanogaster])

HSP 1 Score: 125.561 bits (314), Expect = 8.93914e-30
Identity = 145/548 (26.46%), Postives = 261/548 (47.63%), Query Frame = 1
Query:  190 TTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGREKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIKALYDNDMVLLRKSLDQAEASKAQLEMRINSI----EDL-------IQEAQIELNDVNQLHISDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQLKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSS-----LIYKDASDSKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKESAETVQLREENARLKEQLVEMRNRLPELE-------LRNNDLERMLDMLKREIDEKHREFESEKIHLRKELMNRQAXXXXXXXXXXXXXXXXXXXXXXIAAYRKMLEGEEYRVN-------RKDAQFSQGGHSMDLTDHMTRSTISQQ-HTSPMTKTQITNVVKGEMSAKT----------------SFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDNGRIVIKYVIPAKTI 1692
T N R+ S V +S + + R++EK ELQ LNDR A YID++R+LE+EN RL++EL +D +ET+ +KA+Y+ ++ RK LD+ KA+LE+ I + +DL +EA + N+ E K L+D R++ +E +N+ RL+ +++ L+K L+ ETL + +N+ QSL +++ F ++ E+ E S + D S+ + ++ Q+L++++++Y+ +M + E+E Y +IQ + + + + EE ++ ++ + +L LE R +LE +LD ++ ++ E+E +R E+ ++ + E Q L+D K+SL+LEIAAY K+L GEE R+N D+ S G H+T S S+ +P + T + G + K S AKG++ I E +G+FI L N G+++ +++G+ L R + + K+ +K +
Sbjct: 7 TLNTRVSRASTSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD--------RKKFEDQAKELALENE---RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQY-EAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQ-------LQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGS------HLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVL 529
The following BLAST results are available for this feature:
BLAST of ifb vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|266617|sp|Q01241|NF70_DORPE1.502160e-11941.94RecName: Full=70 kDa neurofilament protein; Short=... [more]
gi|124235|sp|P23731|IFEB_ASCSU2.376710e-10035.45RecName: Full=Intermediate filament protein B; Sho... [more]
gi|46576384|sp|Q19289|IFB1_CAEEL2.856570e-9835.18RecName: Full=Intermediate filament protein ifb-1;... [more]
gi|46576376|sp|P90901|IFA1_CAEEL4.903430e-9235.56RecName: Full=Intermediate filament protein ifa-1;... [more]
gi|266616|sp|Q01240|NF60_DORPE1.675520e-8744.94RecName: Full=60 kDa neurofilament protein; Short=... [more]
back to top
BLAST of ifb vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150119560.000000e+078.47SmedAsxldir_c69509_g1_i1|m.14946|m.134[more]
SMU150389473.900620e-16346.19dd_smedV4_3871_0_1|m.24747|m.30510[more]
SMU150132381.701180e-11438.62SmedAsxldir_c85434_g1_i1|m.24146|m.11304[more]
SMU150067307.949390e-8534.89SmedAsxldir_c108652_g1_i6|m.91472|m.48315[more]
SMU150192742.150210e-8334.23SmedSxldir_c108927_g2_i1|m.81594|m.27374[more]
back to top
BLAST of ifb vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|5031875|ref|NP_005563.1|1.314630e-3527.30lamin isoform C [Homo sapiens][more]
gi|544063466|ref|NP_001269554.1|1.314630e-3527.30lamin isoform C [Homo sapiens][more]
gi|27436946|ref|NP_733821.1|1.340500e-3527.67lamin isoform A [Homo sapiens][more]
gi|544063468|ref|NP_001269555.1|1.384750e-3527.67lamin isoform A-delta50 [Homo sapiens][more]
gi|27436948|ref|NP_733822.1|4.360330e-3527.45lamin isoform A-delta10 [Homo sapiens][more]
back to top
BLAST of ifb vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136290|ref|NP_476616.1|2.084440e-3628.87lamin, isoform A [Drosophila melanogaster][more]
gi|386769141|ref|NP_001245892.1|2.084440e-3628.87lamin, isoform B [Drosophila melanogaster][more]
gi|386769143|ref|NP_001245893.1|2.084440e-3628.87lamin, isoform C [Drosophila melanogaster][more]
gi|665404412|ref|NP_001285629.1|2.084440e-3628.87lamin, isoform D [Drosophila melanogaster][more]
gi|24653664|ref|NP_523742.2|8.939140e-3026.46lamin C, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_001875 ID=Ddo_001875|Name=ifb|organism=Dugesia dorotocephala|type=mRNA|length=1995bp
CCGATCTATTCAGAGTATATAAAATCACTTTCATTATATACAAATTTAAT
TATGCAAACTTCAAAGACTACTTCAAGTAAGACTACATACAGTGTTTTGG
CTCAGTCAAATATACAACCGATCTCTGGGCCAAGAAATGTAGTCATTACA
AGAACTGGCCCCACCATTGCTGCGACTGGAAATCAAGGAACAACAAATAT
TCGAATGATAGAAATGAAGAAAAGTTATGGAGTGAGTGCAAATCCCGGCG
CATCTACTAATATCGTTCATAATGGAGTCAATAATTTAATGAATGGAAGG
GAAAAAGAAAAAAATGAATTGCAAGAACTAAATGACCGATTTGCGAATTA
TATTGATAAAGTGCGACATCTGGAGGATGAAAATAAACGACTATCAGAGG
AGTTAATGGATTTAAAAGACCAATGGGGAAAAGAGACAGCAAGAATCAAA
GCACTGTATGATAATGACATGGTGTTACTCAGAAAGTCTTTGGATCAAGC
TGAAGCTTCAAAAGCGCAATTAGAAATGCGAATTAATTCAATAGAGGATT
TGATTCAAGAAGCTCAAATAGAATTAAATGATGTGAATCAACTCCACATT
TCCGATAAGGAAACAATAGATAAAATGACAAATCAACTTTCCGATTACGA
ACACGAAATTTCGAGTCTTCGCAGAAGATTAGCTGGATTAGAAGAAGAAA
AGGTTCGAGACAATAAAGAAATTTTTAGACTGAAAGAAGAAATAAATCAA
CTGAAGAAGGATCTTGATAAAGAAACACTTGAACATATTACTGCTCAAAA
TGAAGTTCAATCTCTTCTAGATCAGATTGAGTTTTTGAAGAAAATCTTTG
AATCAGAAATACGAGAATTATCATCATTGATATATAAAGATGCTTCGGAT
AGCAAAGACTTCTGGAGAAACGAAATGGCTCAAGCTTTACGAGATATTCA
AAATGAATATGATAGAAAAATGGAAACTCTTCAAATGGAAATGGAAGCTC
AATACACTCTTAAAATTCAAGAATTCCGTACGACCCAAACAAAAGAAAGC
GCTGAAACAGTTCAGTTAAGGGAAGAAAATGCGAGATTAAAGGAACAATT
GGTAGAAATGAGAAATAGGTTACCTGAATTAGAGTTAAGAAACAACGATC
TTGAACGAATGCTAGATATGCTTAAACGAGAAATAGACGAAAAGCATAGA
GAATTTGAATCAGAGAAGATTCATTTAAGAAAGGAATTGATGAATCGTCA
AGCAGAATTAGAAAATATTGTTTTGGAATTACAACTTTTACTCGATGCCA
AATTAAGTTTGGAACTTGAAATAGCAGCCTATAGGAAGATGCTTGAAGGA
GAAGAATACAGAGTGAACCGTAAAGATGCTCAATTCAGTCAAGGAGGTCA
TAGTATGGATTTGACTGACCATATGACCAGATCTACGATTAGTCAGCAAC
ATACATCCCCAATGACGAAAACACAGATTACAAATGTTGTGAAAGGAGAA
ATGTCTGCAAAAACTTCGTTTCAGAGGACTGCAAAAGGAAATGTGACAAT
ACAAGAATGTTCTCCAGATGGAAAATTTATAATCCTTGAGAATACAGGTT
CACAGCAAGAAGATATATCTGGATACGTATTAAATAGAAATACTGATAAT
GGAAGAATCGTTATAAAATATGTGATTCCAGCGAAAACGATATTAGAACC
AACAGGAAAAAACAGATACTATAAAATTTGGGCGAAGGGTCAAAAACCTC
AAGGATCAAGTGAAGCTGAGTTGTCTGAGAGTAATTGGGGTACTGGAGCT
CAAATATTAACTACTCTGCAAAATTCTAAAGGAGAGGAAAAAGCGACTCA
TACTCAAAGAACGGTTTATCAGATGTGATCCGATCAAAAGATTATAAAAC
ATTTTATAGTTGAACATTTTTTTACTCTTTCTAGATGATTTTATAATTTA
GCTTCAATTGATTTAGAAAAAAAATAATAAATTAATTCAATGAGA

Design Primers for ifb

back to top

protein sequence

>Ddo_001875-protein ID=Ddo_001875-protein|Name=ifb|organism=Dugesia dorotocephala|type=polypeptide|length=626bp
PIYSEYIKSLSLYTNLIMQTSKTTSSKTTYSVLAQSNIQPISGPRNVVIT
RTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGR
EKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIK
ALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHI
SDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQ
LKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASD
SKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES
AETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHR
EFESEKIHLRKELMNRQAELENIVLELQLLLDAKLSLELEIAAYRKMLEG
EEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGE
MSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDN
GRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGA
QILTTLQNSKGEEKATHTQRTVYQM*
back to top

coding sequence

>Ddo_001875.1.1878 ID=Ddo_001875.1.1878|Name=Ddo_001875.1.1878|organism=Dugesia dorotocephala|type=CDS|length=1878bp
CCGATCTATTCAGAGTATATAAAATCACTTTCATTATATACAAATTTAAT
TATGCAAACTTCAAAGACTACTTCAAGTAAGACTACATACAGTGTTTTGG
CTCAGTCAAATATACAACCGATCTCTGGGCCAAGAAATGTAGTCATTACA
AGAACTGGCCCCACCATTGCTGCGACTGGAAATCAAGGAACAACAAATAT
TCGAATGATAGAAATGAAGAAAAGTTATGGAGTGAGTGCAAATCCCGGCG
CATCTACTAATATCGTTCATAATGGAGTCAATAATTTAATGAATGGAAGG
GAAAAAGAAAAAAATGAATTGCAAGAACTAAATGACCGATTTGCGAATTA
TATTGATAAAGTGCGACATCTGGAGGATGAAAATAAACGACTATCAGAGG
AGTTAATGGATTTAAAAGACCAATGGGGAAAAGAGACAGCAAGAATCAAA
GCACTGTATGATAATGACATGGTGTTACTCAGAAAGTCTTTGGATCAAGC
TGAAGCTTCAAAAGCGCAATTAGAAATGCGAATTAATTCAATAGAGGATT
TGATTCAAGAAGCTCAAATAGAATTAAATGATGTGAATCAACTCCACATT
TCCGATAAGGAAACAATAGATAAAATGACAAATCAACTTTCCGATTACGA
ACACGAAATTTCGAGTCTTCGCAGAAGATTAGCTGGATTAGAAGAAGAAA
AGGTTCGAGACAATAAAGAAATTTTTAGACTGAAAGAAGAAATAAATCAA
CTGAAGAAGGATCTTGATAAAGAAACACTTGAACATATTACTGCTCAAAA
TGAAGTTCAATCTCTTCTAGATCAGATTGAGTTTTTGAAGAAAATCTTTG
AATCAGAAATACGAGAATTATCATCATTGATATATAAAGATGCTTCGGAT
AGCAAAGACTTCTGGAGAAACGAAATGGCTCAAGCTTTACGAGATATTCA
AAATGAATATGATAGAAAAATGGAAACTCTTCAAATGGAAATGGAAGCTC
AATACACTCTTAAAATTCAAGAATTCCGTACGACCCAAACAAAAGAAAGC
GCTGAAACAGTTCAGTTAAGGGAAGAAAATGCGAGATTAAAGGAACAATT
GGTAGAAATGAGAAATAGGTTACCTGAATTAGAGTTAAGAAACAACGATC
TTGAACGAATGCTAGATATGCTTAAACGAGAAATAGACGAAAAGCATAGA
GAATTTGAATCAGAGAAGATTCATTTAAGAAAGGAATTGATGAATCGTCA
AGCAGAATTAGAAAATATTGTTTTGGAATTACAACTTTTACTCGATGCCA
AATTAAGTTTGGAACTTGAAATAGCAGCCTATAGGAAGATGCTTGAAGGA
GAAGAATACAGAGTGAACCGTAAAGATGCTCAATTCAGTCAAGGAGGTCA
TAGTATGGATTTGACTGACCATATGACCAGATCTACGATTAGTCAGCAAC
ATACATCCCCAATGACGAAAACACAGATTACAAATGTTGTGAAAGGAGAA
ATGTCTGCAAAAACTTCGTTTCAGAGGACTGCAAAAGGAAATGTGACAAT
ACAAGAATGTTCTCCAGATGGAAAATTTATAATCCTTGAGAATACAGGTT
CACAGCAAGAAGATATATCTGGATACGTATTAAATAGAAATACTGATAAT
GGAAGAATCGTTATAAAATATGTGATTCCAGCGAAAACGATATTAGAACC
AACAGGAAAAAACAGATACTATAAAATTTGGGCGAAGGGTCAAAAACCTC
AAGGATCAAGTGAAGCTGAGTTGTCTGAGAGTAATTGGGGTACTGGAGCT
CAAATATTAACTACTCTGCAAAATTCTAAAGGAGAGGAAAAAGCGACTCA
TACTCAAAGAACGGTTTATCAGATGTGA
back to top
Gene Groups
ifb is similar in sequence to the genes of this group: GG6276
Gene NameGene ID
SMU15011956SMU15011956
ifbDdo_001875
ifbGsp_021856
ifbPgr_011052
ifbPmo_026655

Gene Group Protein Sequences

>SMU15011956

MLTSKTTTSKTNYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSN
IRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFAN
YIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQ
AEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDY
EHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAH
NELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDI
QTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQ
LAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNR
KAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQT
GRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNV
TIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTIL
EPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKA
THTQRTVYQL*
>Ddo_001875 ifb
PIYSEYIKSLSLYTNLIMQTSKTTSSKTTYSVLAQSNIQPISGPRNVVIT
RTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGR
EKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIK
ALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHI
SDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQ
LKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASD
SKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES
AETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHR
EFESEKIHLRKELMNRQAELENIVLELQLLLDAKLSLELEIAAYRKMLEG
EEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGE
MSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDN
GRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGA
QILTTLQNSKGEEKATHTQRTVYQM*
>Gsp_021856 ifb
TTSKTNFKTTTNTANIQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEM
KKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVR
SLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKA
QLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGN
LRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSL
LDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDK
KMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRN
RLPELEARNSELERLLELLRREIEEKNREFDMEKANLRKELMNRQSELES
ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGR
NVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTI
QECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEP
TGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATH
TQRTVYQL*
>Pgr_011052 ifb
TSSTIIMQSSRTATSTNVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGG
AGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELN
DRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLR
KSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNS
QLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLD
HIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQ
ALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNT
KLKEQLSEMRNRLPELEARNNELERMLEMLRREIDERSRDYDMERANLRK
ELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKNAM
SLNAMSSNAMSSSSGQRMDFADSTITRTNVGQSMAAVTTSKTQVSSTVKG
QMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTD
NGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVG
TLIVTMLFNKKGEEKASHTQRTVYQM*
>Pmo_026655 ifb
MQSSRTVTSTNVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNV
RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANY
IDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSA
EGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYE
NEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQN
EVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQ
SEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQL
SDMRNRLPELEAKNNELEKMLEMLRREMDERNREYDLERANLRKELANQQ
AHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGR
RADATDSMVTRTVAGQSMAAVTTSKTQVVSSTVKGQMSAKTSFQRTAKGN
VTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTI
LEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEK
ASHTQRTVYQM*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.